Metagenome Family F092832

Overview

Basic Information

• Family ID: F092832
• Family Type: Metagenome
• Number of Sequences: 107
• Average Sequence Length: 42 residues
• Representative Sequence: PVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNS
• Number of Associated Samples: 17
• Number of Associated Scaffolds: 107

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 1.96 %
• % of genes near scaffold ends (potentially truncated): 94.39 %
• % of genes from short scaffolds (< 2000 bps): 84.11 %
• Associated GOLD sequencing projects: 10
• AlphaFold2 3D model prediction: No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (90.654 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont (69.159 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut (100.000 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 35.71%
  β-sheet: 4.76%
  Coil/Unstructured: 59.52%

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 107 Family Scaffolds
PF00078	RVT_1	1.87
PF10168	Nup88	0.93
PF08916	Phe_ZIP	0.93
PF00643	zf-B_box	0.93
PF08441	Integrin_alpha2	0.93

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
All Organisms	root	All Organisms	9.35 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
cellular organisms	root	All Organisms → cellular organisms	7.48 %
Viruses	superkingdom	All Organisms → Viruses	1.87 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	7.48 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	6.54 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	4.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	4.67 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	3.74 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Cnidaria	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria	0.93 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	3.74 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	2.80 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Spiralia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia	0.93 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	2.80 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Lophotrochozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa	0.93 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	2.80 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Mollusca	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca	0.93 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	1.87 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Gastropoda	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda	0.93 %
Chelicerata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata	0.93 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	1.87 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Heterobranchia	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia	0.93 %
Arachnida	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida	0.93 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	1.87 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Euthyneura	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura	0.93 %
Araneae	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae	0.93 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	1.87 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Panpulmonata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Panpulmonata	0.93 %
Araneomorphae	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae	0.93 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	1.87 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Entelegynae	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae	0.93 %
Sacoglossa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Panpulmonata → Sacoglossa	0.93 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	1.87 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Orbiculariae	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae	0.93 %
Placobranchoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Panpulmonata → Sacoglossa → Placobranchoidea	0.93 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	1.87 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Araneoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea	0.93 %
Plakobranchidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Panpulmonata → Sacoglossa → Placobranchoidea → Plakobranchidae	0.93 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Paraneoptera	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera	1.87 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Elysia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Panpulmonata → Sacoglossa → Placobranchoidea → Plakobranchidae → Elysia	0.93 %
Theridiidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Theridiidae	0.93 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Hemiptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera	1.87 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Elysia chlorotica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Panpulmonata → Sacoglossa → Placobranchoidea → Plakobranchidae → Elysia → Elysia chlorotica	0.93 %
Parasteatoda	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Theridiidae → Parasteatoda	0.93 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Sternorrhyncha	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha	1.87 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Parasteatoda tepidariorum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Theridiidae → Parasteatoda → Parasteatoda tepidariorum	0.93 %
Elysia chlorotica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Panpulmonata → Sacoglossa → Placobranchoidea → Plakobranchidae → Elysia → Elysia chlorotica	0.93 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Aphidomorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha	1.87 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Parasteatoda tepidariorum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Theridiidae → Parasteatoda → Parasteatoda tepidariorum	0.93 %
Elysia chlorotica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Panpulmonata → Sacoglossa → Placobranchoidea → Plakobranchidae → Elysia → Elysia chlorotica	0.93 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Aphidoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea	1.87 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Parasteatoda tepidariorum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Theridiidae → Parasteatoda → Parasteatoda tepidariorum	0.93 %
Elysia chlorotica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Panpulmonata → Sacoglossa → Placobranchoidea → Plakobranchidae → Elysia → Elysia chlorotica	0.93 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Aphididae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae	1.87 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Parasteatoda tepidariorum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Theridiidae → Parasteatoda → Parasteatoda tepidariorum	0.93 %
Elysia chlorotica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Panpulmonata → Sacoglossa → Placobranchoidea → Plakobranchidae → Elysia → Elysia chlorotica	0.93 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Aphidinae	subfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae	0.93 %
Parasteatoda tepidariorum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Theridiidae → Parasteatoda → Parasteatoda tepidariorum	0.93 %
Elysia chlorotica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Panpulmonata → Sacoglossa → Placobranchoidea → Plakobranchidae → Elysia → Elysia chlorotica	0.93 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Aphidini	tribe	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini	0.93 %
Parasteatoda tepidariorum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Theridiidae → Parasteatoda → Parasteatoda tepidariorum	0.93 %
Elysia chlorotica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Panpulmonata → Sacoglossa → Placobranchoidea → Plakobranchidae → Elysia → Elysia chlorotica	0.93 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Level 27

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Aphis	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis	0.93 %
Parasteatoda tepidariorum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Theridiidae → Parasteatoda → Parasteatoda tepidariorum	0.93 %
Elysia chlorotica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Panpulmonata → Sacoglossa → Placobranchoidea → Plakobranchidae → Elysia → Elysia chlorotica	0.93 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Level 28

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	90.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.87 %
Aphis	subgenus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis	0.93 %
Parasteatoda tepidariorum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Theridiidae → Parasteatoda → Parasteatoda tepidariorum	0.93 %
Elysia chlorotica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Panpulmonata → Sacoglossa → Placobranchoidea → Plakobranchidae → Elysia → Elysia chlorotica	0.93 %
Anthozoa	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	0.93 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300001734|JGI24668J20090_10017140	Not Available	1496
3300001734|JGI24668J20090_10020726	Not Available	1392
3300001734|JGI24668J20090_10238668	Not Available	524
3300001741|JGI24671J20093_10110209	Not Available	667
3300001741|JGI24671J20093_10200120	Not Available	526
3300001742|JGI24673J20094_10180181	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Gastropoda → Heterobranchia → Euthyneura → Panpulmonata → Sacoglossa → Placobranchoidea → Plakobranchidae → Elysia → Elysia chlorotica	601
3300001742|JGI24673J20094_10259717	Not Available	509
3300001746|JGI24672J20091_10119744	Not Available	584
3300001746|JGI24672J20091_10125305	Not Available	574
3300002181|JGI24670J26820_11215616	Not Available	527
3300002181|JGI24670J26820_11266330	Not Available	562
3300002181|JGI24670J26820_11273694	Not Available	568
3300002181|JGI24670J26820_11402277	Not Available	697
3300002181|JGI24670J26820_11479849	Not Available	823
3300002181|JGI24670J26820_11510130	Not Available	893
3300002181|JGI24670J26820_11554289	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Araneae → Araneomorphae → Entelegynae → Orbiculariae → Araneoidea → Theridiidae → Parasteatoda → Parasteatoda tepidariorum	1041
3300002181|JGI24670J26820_11576064	Not Available	1152
3300002181|JGI24670J26820_11619272	Not Available	1657
3300003829|Ga0056137_1012144	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis	988
3300003829|Ga0056137_1019544	Not Available	676
3300004098|Ga0065184_10006744	Not Available	3125
3300004098|Ga0065184_10027660	Not Available	1912
3300027540|Ga0209791_1046291	Not Available	1642
3300027540|Ga0209791_1058102	Not Available	1504
3300027540|Ga0209791_1085228	Not Available	1285
3300027540|Ga0209791_1100190	Not Available	1196
3300027540|Ga0209791_1111900	Not Available	1136
3300027540|Ga0209791_1127165	Not Available	1070
3300027540|Ga0209791_1130368	Not Available	1057
3300027540|Ga0209791_1150542	Not Available	983
3300027540|Ga0209791_1280716	Not Available	664
3300027540|Ga0209791_1317385	Not Available	605
3300027540|Ga0209791_1352895	Not Available	552
3300027551|Ga0209338_1006490	Not Available	4912
3300027551|Ga0209338_1093517	Not Available	1742
3300027551|Ga0209338_1159946	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1247
3300027551|Ga0209338_1201520	Not Available	1052
3300027551|Ga0209338_1211422	Not Available	1014
3300027551|Ga0209338_1228579	Not Available	951
3300027551|Ga0209338_1260123	Not Available	850
3300027551|Ga0209338_1263780	Not Available	839
3300027556|Ga0209743_1114637	Not Available	1277
3300027556|Ga0209743_1410153	Not Available	522
3300027564|Ga0209428_1054701	Not Available	2010
3300027564|Ga0209428_1142384	Not Available	1248
3300027564|Ga0209428_1165351	Not Available	1139
3300027564|Ga0209428_1180890	Not Available	1075
3300027564|Ga0209428_1189273	Not Available	1043
3300027564|Ga0209428_1202919	Not Available	996
3300027564|Ga0209428_1232878	Not Available	903
3300027564|Ga0209428_1241594	Not Available	879
3300027564|Ga0209428_1244859	Not Available	870
3300027564|Ga0209428_1325769	Not Available	676
3300027584|Ga0209637_1052243	Not Available	2145
3300027584|Ga0209637_1065426	Not Available	1945
3300027584|Ga0209637_1066655	Not Available	1929
3300027584|Ga0209637_1070794	Not Available	1877
3300027584|Ga0209637_1073607	Not Available	1844
3300027584|Ga0209637_1104101	Not Available	1552
3300027584|Ga0209637_1132702	Not Available	1351
3300027584|Ga0209637_1198584	Not Available	1043
3300027584|Ga0209637_1277957	Not Available	804
3300027585|Ga0209150_1076920	Not Available	1410
3300027585|Ga0209150_1197468	Not Available	882
3300027613|Ga0209122_1001059	Not Available	6898
3300027613|Ga0209122_1056292	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa	1796
3300027613|Ga0209122_1176193	Not Available	1019
3300027613|Ga0209122_1210099	Not Available	913
3300027613|Ga0209122_1232337	Not Available	852
3300027613|Ga0209122_1279457	Not Available	739
3300027613|Ga0209122_1366678	Not Available	583
3300027620|Ga0209260_10097371	Not Available	851
3300027626|Ga0209149_1021619	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5076
3300027626|Ga0209149_1094812	Not Available	2356
3300027626|Ga0209149_1124784	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae	1927
3300027626|Ga0209149_1137588	Not Available	1782
3300027626|Ga0209149_1142483	Not Available	1733
3300027626|Ga0209149_1160758	All Organisms → Viruses → Predicted Viral	1557
3300027626|Ga0209149_1171929	Not Available	1460
3300027626|Ga0209149_1189018	Not Available	1330
3300027626|Ga0209149_1202445	All Organisms → Viruses → Predicted Viral	1238
3300027626|Ga0209149_1227919	Not Available	1085
3300027626|Ga0209149_1244779	Not Available	998
3300027626|Ga0209149_1265847	Not Available	899
3300027626|Ga0209149_1317183	Not Available	697
3300027626|Ga0209149_1335472	Not Available	638
3300027626|Ga0209149_1367344	Not Available	541
3300027632|Ga0209339_1032729	Not Available	3666
3300027632|Ga0209339_1048264	Not Available	3064
3300027632|Ga0209339_1073492	Not Available	2462
3300027632|Ga0209339_1081275	Not Available	2327
3300027632|Ga0209339_1095759	Not Available	2113
3300027632|Ga0209339_1174473	Not Available	1384
3300027632|Ga0209339_1192588	Not Available	1272
3300027632|Ga0209339_1247330	Not Available	1009
3300027632|Ga0209339_1252300	Not Available	989
3300027632|Ga0209339_1321533	Not Available	751
3300027632|Ga0209339_1359432	Not Available	650
3300027632|Ga0209339_1366536	Not Available	632
3300027632|Ga0209339_1372386	Not Available	618
3300027632|Ga0209339_1404269	All Organisms → cellular organisms → Eukaryota	545
3300027632|Ga0209339_1411010	Not Available	531

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Annelida	Host-Associated → Annelida	100.00%

Category

Habitat	Taxonomy	Distribution
Digestive System	Host-Associated → Annelida → Digestive System	100.00%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	69.16%
Digestive Tube	Host-Associated → Annelida → Digestive System → Digestive Tube	30.84%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified	69.16%
Extracellular Symbionts	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts	30.84%

Habitat

Habitat	Taxonomy	Distribution
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont	69.16%
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont	30.84%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300001734	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 1	Host-Associated
3300001741	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1	Host-Associated
3300001742	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3	Host-Associated
3300001746	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 2	Host-Associated
3300002181	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3	Host-Associated
3300003829	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type G CAVOLI	Host-Associated
3300004098	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.2 (version 2)	Host-Associated
3300027540	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.1 (SPAdes)	Host-Associated
3300027551	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 1 (SPAdes)	Host-Associated
3300027556	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 2 (SPAdes)	Host-Associated
3300027564	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 1 (SPAdes)	Host-Associated
3300027584	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type G ELBA extract 3 (SPAdes)	Host-Associated
3300027585	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.3 (SPAdes)	Host-Associated
3300027613	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 2 (SPAdes)	Host-Associated
3300027620	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type G CAVOLI (SPAdes)	Host-Associated
3300027626	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.2 (SPAdes)	Host-Associated
3300027632	Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24668J20090_100171403	3300001734	Marine Gutless Worms Symbiont	LTRRLPVVSRTGRTEYQLLLMKASDRGQNSKFLGNNFGFVLSKLTNNRVNVSVSSG*
JGI24668J20090_100207261	3300001734	Marine Gutless Worms Symbiont	FLTRRLPVVSRTGRTEYQLLLMKASDRGQNVKFLGNNFGCV*
JGI24668J20090_102386682	3300001734	Marine Gutless Worms Symbiont	KTQPKLSFQLLLMKASDRGRNVKFLGDNFGCVLSKLTKS*
JGI24671J20093_101102093	3300001741	Marine Gutless Worms Symbiont	TTAFLTRRLPVVSRTGRTEYQLLLMKASDRDRNVKFLDNNFGYV*
JGI24671J20093_102001202	3300001741	Marine Gutless Worms Symbiont	TEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNNEEKVLQ*
JGI24673J20094_101801813	3300001742	Marine Gutless Worms Symbiont	VVSRTGRTEYQLLLMKASDRGQNVKFLGNNFGCV*
JGI24673J20094_102597172	3300001742	Marine Gutless Worms Symbiont	LPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGYV*
JGI24672J20091_101197441	3300001746	Marine Gutless Worms Symbiont	RLPVVSRTGRTEYQLLLMASDRGQNVKFLGNNFGCVLSKLSNNNHHH*
JGI24672J20091_101253052	3300001746	Marine Gutless Worms Symbiont	RRLPVVSRTGRTEYQLLLMKASDRGQNVKFLGNNFGCV*
JGI24670J26820_112156161	3300002181	Marine Gutless Worms Symbiont	TTAFLARRLPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCI*
JGI24670J26820_112663301	3300002181	Marine Gutless Worms Symbiont	PVVSRTGRTEYQLLLMKASDRGRNVKFLGSNFGCVLSKLTNS*
JGI24670J26820_112736943	3300002181	Marine Gutless Worms Symbiont	GRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNNLLRIE*
JGI24670J26820_114022771	3300002181	Marine Gutless Worms Symbiont	SHHFLTRRLPVVSGTGRTEYQLLLMKASDRGQNVKVSGNNFG*
JGI24670J26820_114798493	3300002181	Marine Gutless Worms Symbiont	VVSRTGRTEYQLLLMKASDRGRNVKFLGNKFGCVLSKLSNS*
JGI24670J26820_115101301	3300002181	Marine Gutless Worms Symbiont	MDRYIGVVSRTGRTEYQLLLMKASDRGRNVKFLGN
JGI24670J26820_115542893	3300002181	Marine Gutless Worms Symbiont	FTRRLPVVSRTGRKTEYQLILMKDADRGRNVKFLGNNFGCV*
JGI24670J26820_115760644	3300002181	Marine Gutless Worms Symbiont	RLPVVSRTGRTEYQLLLMKASDRDRNVKFLDNNFGYV*
JGI24670J26820_116192724	3300002181	Marine Gutless Worms Symbiont	TGRTEYQLLLMKASDRGRNVKFLGNNFGCNLTNSKL*
Ga0056137_10121442	3300003829	Marine Gutless Worms Symbiont	MASLIHLVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGC
Ga0056137_10195441	3300003829	Marine Gutless Worms Symbiont	FLTRRLPVVSRTGRTEYQLLLMKASDSSRNVKFLGNNFGCV*
Ga0065184_100067446	3300004098	Marine Gutless Worms Symbiont	PVVSRTGRTEYQLLLMKASDVQMTSKRQLLGNNFGLLEEFN*
Ga0065184_100276601	3300004098	Marine Gutless Worms Symbiont	TAFLTRRLPVVSRTGRTEYQLLLMKASDRGRNVEVLDINFGRFDEFN*
Ga0209791_10462915	3300027540	Marine Gutless Worms Symbiont	RRLPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNNS
Ga0209791_10581022	3300027540	Marine Gutless Worms Symbiont	VVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVFE
Ga0209791_10852281	3300027540	Marine Gutless Worms Symbiont	SRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNKTHIS
Ga0209791_11001902	3300027540	Marine Gutless Worms Symbiont	PVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCV
Ga0209791_11119002	3300027540	Marine Gutless Worms Symbiont	VVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLTNNLLEYIC
Ga0209791_11271651	3300027540	Marine Gutless Worms Symbiont	VVSRTARTSVLQLLLMKASDRGRNVKFLGNNFGCV
Ga0209791_11303681	3300027540	Marine Gutless Worms Symbiont	PVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNIQNLQYT
Ga0209791_11505422	3300027540	Marine Gutless Worms Symbiont	LTRRLPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNNLLRIE
Ga0209791_12807161	3300027540	Marine Gutless Worms Symbiont	FLTRRLPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCV
Ga0209791_13173852	3300027540	Marine Gutless Worms Symbiont	MTTFLTRRLPVVSRTGRTKYQLLLMKASDRGRNVNVFGNNFGC
Ga0209791_13528951	3300027540	Marine Gutless Worms Symbiont	RLPVVSRTGRTEYQLLLVKTSDRGRNVKFLGNNFGCV
Ga0209338_10064904	3300027551	Marine Gutless Worms Symbiont	MDRYIGVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNS
Ga0209338_10360692	3300027551	Marine Gutless Worms Symbiont	RTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNNNKP
Ga0209338_10935172	3300027551	Marine Gutless Worms Symbiont	SRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNIP
Ga0209338_11599461	3300027551	Marine Gutless Worms Symbiont	PVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCFE
Ga0209338_12015201	3300027551	Marine Gutless Worms Symbiont	LPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNVGCV
Ga0209338_12114221	3300027551	Marine Gutless Worms Symbiont	TRRLPVVSRTGRTEYQLLLMKASDRGRNVKFLSNNFGCV
Ga0209338_12285791	3300027551	Marine Gutless Worms Symbiont	RTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLVNI
Ga0209338_12601231	3300027551	Marine Gutless Worms Symbiont	GRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNNLHYIYIR
Ga0209338_12637801	3300027551	Marine Gutless Worms Symbiont	VVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLVNP
Ga0209743_11146371	3300027556	Marine Gutless Worms Symbiont	TAFLTRRLPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGLCFE
Ga0209743_12262721	3300027556	Marine Gutless Worms Symbiont	TGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNNNKP
Ga0209743_14101531	3300027556	Marine Gutless Worms Symbiont	LTRRFPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNS
Ga0209428_10547011	3300027564	Marine Gutless Worms Symbiont	RLPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNR
Ga0209428_11180971	3300027564	Marine Gutless Worms Symbiont	VSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNNNHNYL
Ga0209428_11423841	3300027564	Marine Gutless Worms Symbiont	RTGRTEYQLLLMKASDRGRNVKFLSNNFGCVLSKLSNTDWLN
Ga0209428_11653512	3300027564	Marine Gutless Worms Symbiont	RLPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLTNNLLEYIC
Ga0209428_11808901	3300027564	Marine Gutless Worms Symbiont	FLTRRLPVVSRTGRTEYQLLLMKASDRGRNVNFLDNNFGCV
Ga0209428_11892731	3300027564	Marine Gutless Worms Symbiont	AFLTRRLPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCV
Ga0209428_12029191	3300027564	Marine Gutless Worms Symbiont	FLTRRLPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVFE
Ga0209428_12328781	3300027564	Marine Gutless Worms Symbiont	LPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNYYYYY
Ga0209428_12415941	3300027564	Marine Gutless Worms Symbiont	LHIITVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCV
Ga0209428_12448592	3300027564	Marine Gutless Worms Symbiont	TRRLPVVSRTEYQLLLMKASDRGRNVKFLGNNFGYV
Ga0209428_13257692	3300027564	Marine Gutless Worms Symbiont	RRLPVVSRTGRTEYQLLLMKASDRCRNVKFLGNNFGCVLSKLSNS
Ga0209637_10522431	3300027584	Marine Gutless Worms Symbiont	PVVSRTGRTEYELLLMKASDRGQNVKFVGNNFGCV
Ga0209637_10654261	3300027584	Marine Gutless Worms Symbiont	RTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLVNNALE
Ga0209637_10666551	3300027584	Marine Gutless Worms Symbiont	GRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLVKQ
Ga0209637_10707941	3300027584	Marine Gutless Worms Symbiont	VVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNN
Ga0209637_10736071	3300027584	Marine Gutless Worms Symbiont	LPVVSRTGRTEYQLLLMKASGRGRNVKFLGNNFGCVLSKLTNS
Ga0209637_11041011	3300027584	Marine Gutless Worms Symbiont	TFLTRRLPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNVGCV
Ga0209637_11327021	3300027584	Marine Gutless Worms Symbiont	TTAFLTRRLPVVSRTGRTEYQLLLMKASDRGRNVKFLSNNFGCVLSKLSNTDWLN
Ga0209637_11985841	3300027584	Marine Gutless Worms Symbiont	TAFLTRRLPVVSRTGRTEYQLLLMKASDRGRNGKFLGNNFGCVLSKLSNS
Ga0209637_12421661	3300027584	Marine Gutless Worms Symbiont	VSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNS
Ga0209637_12779571	3300027584	Marine Gutless Worms Symbiont	SRTGRTEYQLLLMKASDRGRNVKLLGNNFGCVLSKLTNS
Ga0209150_10769201	3300027585	Marine Gutless Worms Symbiont	SRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKVSNS
Ga0209150_11974681	3300027585	Marine Gutless Worms Symbiont	RLPVVSRTGRTEYQLLLMKASDRGRNVKFVGNNFGYV
Ga0209122_10010591	3300027613	Marine Gutless Worms Symbiont	RRFPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGFV
Ga0209122_10562921	3300027613	Marine Gutless Worms Symbiont	RRLPIVSRTGRTEYQLFLMKASDRGQNVKFLGNNFGCV
Ga0209122_11009751	3300027613	Marine Gutless Worms Symbiont	RTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNNNHNYL
Ga0209122_11761931	3300027613	Marine Gutless Worms Symbiont	TRRLPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVFE
Ga0209122_12100991	3300027613	Marine Gutless Worms Symbiont	VVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLKLPTR
Ga0209122_12323372	3300027613	Marine Gutless Worms Symbiont	AFLTRRLPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNTQ
Ga0209122_12794571	3300027613	Marine Gutless Worms Symbiont	RLPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLVKSVL
Ga0209122_13666781	3300027613	Marine Gutless Worms Symbiont	TGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSNLNNS
Ga0209260_100973711	3300027620	Marine Gutless Worms Symbiont	LIVSRTGRTEYQLLLMKASDRGQNVKFLGNNSGCV
Ga0209149_10216195	3300027626	Marine Gutless Worms Symbiont	SRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLVNNNNTVQL
Ga0209149_10948121	3300027626	Marine Gutless Worms Symbiont	PVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNSHSS
Ga0209149_11247841	3300027626	Marine Gutless Worms Symbiont	LPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLVKS
Ga0209149_11375884	3300027626	Marine Gutless Worms Symbiont	PVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNKK
Ga0209149_11424832	3300027626	Marine Gutless Worms Symbiont	PVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNS
Ga0209149_11607581	3300027626	Marine Gutless Worms Symbiont	VVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNS
Ga0209149_11719291	3300027626	Marine Gutless Worms Symbiont	PVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNSKMRS
Ga0209149_11890182	3300027626	Marine Gutless Worms Symbiont	PVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNKQHVIVLSLS
Ga0209149_12024452	3300027626	Marine Gutless Worms Symbiont	PVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNIP
Ga0209149_12279191	3300027626	Marine Gutless Worms Symbiont	RLPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLYNS
Ga0209149_12447791	3300027626	Marine Gutless Worms Symbiont	SWYSVLPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCFE
Ga0209149_12658471	3300027626	Marine Gutless Worms Symbiont	SRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLVKSVL
Ga0209149_13171831	3300027626	Marine Gutless Worms Symbiont	MSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCLLSKLSNSI
Ga0209149_13354721	3300027626	Marine Gutless Worms Symbiont	PVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNRIS
Ga0209149_13673441	3300027626	Marine Gutless Worms Symbiont	TRRLPVVSRTGRTEYQLLLMKASDRGRNVNFLGNNFGCV
Ga0209339_10327291	3300027632	Marine Gutless Worms Symbiont	VVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLVNMT
Ga0209339_10482645	3300027632	Marine Gutless Worms Symbiont	LPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLTNS
Ga0209339_10734924	3300027632	Marine Gutless Worms Symbiont	VVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNM
Ga0209339_10812752	3300027632	Marine Gutless Worms Symbiont	THTTTFLTRRLPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNVGCV
Ga0209339_10957591	3300027632	Marine Gutless Worms Symbiont	FLTRRLPVVSRTGRTEYQLLLMKASDRGRNVKFLGNSFGCVLSKLSNI
Ga0209339_11744731	3300027632	Marine Gutless Worms Symbiont	LPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLTNNLLEYIC
Ga0209339_11925881	3300027632	Marine Gutless Worms Symbiont	PVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLVKQ
Ga0209339_12473301	3300027632	Marine Gutless Worms Symbiont	PVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNRN
Ga0209339_12523001	3300027632	Marine Gutless Worms Symbiont	PVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLVNI
Ga0209339_13215331	3300027632	Marine Gutless Worms Symbiont	RTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNNLLRIE
Ga0209339_13594323	3300027632	Marine Gutless Worms Symbiont	PVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVFE
Ga0209339_13665361	3300027632	Marine Gutless Worms Symbiont	LPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNG
Ga0209339_13723862	3300027632	Marine Gutless Worms Symbiont	LPVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCV
Ga0209339_14042692	3300027632	Marine Gutless Worms Symbiont	PVVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLVKS
Ga0209339_14110101	3300027632	Marine Gutless Worms Symbiont	VVSRTGRTEYQLLLMKASDRGRNVKFLGNNFGCVLSKLSNNLF