| Basic Information | |
|---|---|
| Family ID | F092807 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 39 residues |
| Representative Sequence | NAIERQGYAVLGRRPAISKARKLALVARAALGKLL |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.93 % |
| % of genes near scaffold ends (potentially truncated) | 99.07 % |
| % of genes from short scaffolds (< 2000 bps) | 93.46 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.149 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.364 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.664 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.51% β-sheet: 0.00% Coil/Unstructured: 63.49% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF00494 | SQS_PSY | 88.79 |
| PF13450 | NAD_binding_8 | 8.41 |
| PF01593 | Amino_oxidase | 0.93 |
| PF00248 | Aldo_ket_red | 0.93 |
| PF14489 | QueF | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG1562 | Phytoene/squalene synthetase | Lipid transport and metabolism [I] | 88.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005338|Ga0068868_101428065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 646 | Open in IMG/M |
| 3300005542|Ga0070732_10009157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5405 | Open in IMG/M |
| 3300005598|Ga0066706_11125636 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 599 | Open in IMG/M |
| 3300005994|Ga0066789_10047466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1884 | Open in IMG/M |
| 3300005994|Ga0066789_10510107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 502 | Open in IMG/M |
| 3300006028|Ga0070717_10934497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300006052|Ga0075029_100906081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 605 | Open in IMG/M |
| 3300006163|Ga0070715_10082504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 1462 | Open in IMG/M |
| 3300006354|Ga0075021_10154187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1389 | Open in IMG/M |
| 3300006796|Ga0066665_10450239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300007788|Ga0099795_10269743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300009038|Ga0099829_10023389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4285 | Open in IMG/M |
| 3300009137|Ga0066709_104671795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300009518|Ga0116128_1089555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
| 3300009623|Ga0116133_1233354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300009624|Ga0116105_1118748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300009629|Ga0116119_1040681 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1223 | Open in IMG/M |
| 3300009824|Ga0116219_10379745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300010048|Ga0126373_11156972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300010359|Ga0126376_10676803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 989 | Open in IMG/M |
| 3300010379|Ga0136449_100508470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2089 | Open in IMG/M |
| 3300010379|Ga0136449_101221611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1181 | Open in IMG/M |
| 3300010401|Ga0134121_11068112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
| 3300010880|Ga0126350_10255495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300011269|Ga0137392_11211281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300011270|Ga0137391_10736291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300012189|Ga0137388_11365416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300012202|Ga0137363_11620055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 539 | Open in IMG/M |
| 3300012203|Ga0137399_11087016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300012351|Ga0137386_10519939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300012532|Ga0137373_11221394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300012960|Ga0164301_10638042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300014155|Ga0181524_10149800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1209 | Open in IMG/M |
| 3300014165|Ga0181523_10232842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1057 | Open in IMG/M |
| 3300014487|Ga0182000_10121953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
| 3300014489|Ga0182018_10273695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
| 3300014496|Ga0182011_10537067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300015054|Ga0137420_1250218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1162 | Open in IMG/M |
| 3300016270|Ga0182036_10685960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300016294|Ga0182041_12253036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300016371|Ga0182034_11215523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300017823|Ga0187818_10285160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
| 3300017961|Ga0187778_10387936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300017995|Ga0187816_10044487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1839 | Open in IMG/M |
| 3300018007|Ga0187805_10219102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300018013|Ga0187873_1050930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1797 | Open in IMG/M |
| 3300018013|Ga0187873_1284476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300018017|Ga0187872_10210123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300018026|Ga0187857_10403143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300018040|Ga0187862_10832167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300018040|Ga0187862_10897609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300018043|Ga0187887_10525465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300018058|Ga0187766_10146014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1466 | Open in IMG/M |
| 3300018086|Ga0187769_10260472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1291 | Open in IMG/M |
| 3300018088|Ga0187771_10324880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1291 | Open in IMG/M |
| 3300018090|Ga0187770_11139444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300018468|Ga0066662_10470636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1133 | Open in IMG/M |
| 3300019785|Ga0182022_1065311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300019786|Ga0182025_1126761 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1588 | Open in IMG/M |
| 3300020581|Ga0210399_11015186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300020581|Ga0210399_11223050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300021168|Ga0210406_10595768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
| 3300021170|Ga0210400_10729376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300021401|Ga0210393_10493611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
| 3300021401|Ga0210393_11222577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300021401|Ga0210393_11315481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300021403|Ga0210397_10741381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
| 3300021406|Ga0210386_10834770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300021861|Ga0213853_10504197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 528 | Open in IMG/M |
| 3300025480|Ga0208688_1068901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300025500|Ga0208686_1019182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1782 | Open in IMG/M |
| 3300025915|Ga0207693_11447985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300025926|Ga0207659_10636750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300025928|Ga0207700_10736548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300026078|Ga0207702_12046424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300026312|Ga0209153_1113838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1023 | Open in IMG/M |
| 3300026371|Ga0257179_1051271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300026474|Ga0247846_1054489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300026550|Ga0209474_10085422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2158 | Open in IMG/M |
| 3300027102|Ga0208728_103381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300027110|Ga0208488_1072494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300027505|Ga0209218_1068889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300027604|Ga0208324_1035150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1497 | Open in IMG/M |
| 3300027667|Ga0209009_1038467 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300027854|Ga0209517_10468715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300027889|Ga0209380_10190072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1205 | Open in IMG/M |
| 3300028678|Ga0302165_10057209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300028906|Ga0308309_11010524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300029882|Ga0311368_10494880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300029955|Ga0311342_10168832 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2169 | Open in IMG/M |
| 3300030007|Ga0311338_10018592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10126 | Open in IMG/M |
| 3300031040|Ga0265754_1021294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300031090|Ga0265760_10180785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300031128|Ga0170823_17029362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300031823|Ga0307478_11434194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300031946|Ga0310910_11019798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
| 3300032008|Ga0318562_10303834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
| 3300032063|Ga0318504_10436230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300032174|Ga0307470_11249689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300032205|Ga0307472_100280901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1325 | Open in IMG/M |
| 3300032782|Ga0335082_11016137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300032805|Ga0335078_12342542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300032829|Ga0335070_11659809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300032898|Ga0335072_10102918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3645 | Open in IMG/M |
| 3300033475|Ga0310811_10890857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300033545|Ga0316214_1016855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1011 | Open in IMG/M |
| 3300033561|Ga0371490_1027592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1847 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.15% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.35% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.54% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.61% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.80% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.87% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.87% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.87% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.87% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.93% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.93% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.93% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.93% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026474 | Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T0 | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027102 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF028 (SPAdes) | Environmental | Open in IMG/M |
| 3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028678 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0068868_1014280652 | 3300005338 | Miscanthus Rhizosphere | QEILRAIEHQGYAVLGRRPAISKARKLALVARAALGKLR* |
| Ga0070732_100091576 | 3300005542 | Surface Soil | ILHAIERQGCAVLGNRPAISKPRKLALVARAAWSKLLRGMS* |
| Ga0066706_111256361 | 3300005598 | Soil | ILNAIEQQNFEVLGHRPTISKTRKLALLARAALGKVR* |
| Ga0066789_100474663 | 3300005994 | Soil | AIERQHYAVLGRRPAISKTRKLALVARAALGKLR* |
| Ga0066789_105101071 | 3300005994 | Soil | TRGGEEVLNAIESQKYAVLGRRPAISTMRKLSLLTRAVVGKLI* |
| Ga0070717_109344971 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | NFAVLGRRPAISKPRKLALVARAALGKLLVKRRGQQI* |
| Ga0075029_1009060811 | 3300006052 | Watersheds | EILNAIEKQHYAVLGNRPSISKARKLALVARAAMGKLFGRGAQQ* |
| Ga0070715_100825043 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | NAIEKQRYAVLGNRPAISKSRKLALVAHAAMAKIFGRSGEVPR* |
| Ga0075021_101541873 | 3300006354 | Watersheds | RQGYAVLGRRPAISKTRKLALVARSALGKLLGSRI* |
| Ga0066665_104502392 | 3300006796 | Soil | AIEHQGYAVLGRRPAISKNRKLLLVARAAMRKLL* |
| Ga0099795_102697432 | 3300007788 | Vadose Zone Soil | NAIERQGFAVLGHRPVISKTRKLALVARAALGKLL* |
| Ga0099829_100233891 | 3300009038 | Vadose Zone Soil | NAIERQGYAVLGRRPAISKARKLALVARAALGKLL* |
| Ga0066709_1046717952 | 3300009137 | Grasslands Soil | RQDYAVLGRRPAISKARKLALVARAALGKLLGKQKQR* |
| Ga0116128_10895552 | 3300009518 | Peatland | ERQGFAVLGRRPAISKARKLALVARAAVGKLLGPREKER* |
| Ga0116133_12333541 | 3300009623 | Peatland | AVLGRRPAISKARKLALVARAALGKVLRKPREKER* |
| Ga0116105_11187482 | 3300009624 | Peatland | IERQRFAVLGKRPVISKPRKLGLVARAALGKLMGSLS* |
| Ga0116119_10406811 | 3300009629 | Peatland | IERQGCAVLGRRPAISRARKLALVARAAVGKLLGPREKER* |
| Ga0116219_103797451 | 3300009824 | Peatlands Soil | QEILNAIEGQRYAVLGRRPAISKARKLALVARAALGKLLGKQR* |
| Ga0126373_111569722 | 3300010048 | Tropical Forest Soil | EKQDYAVLGNRPAISKPRKLALVARAASAKLFRSSLGGGR* |
| Ga0126376_106768031 | 3300010359 | Tropical Forest Soil | ILNAIERANYAVLGNRPAISKSRKLALVARAAWRKLI* |
| Ga0136449_1005084703 | 3300010379 | Peatlands Soil | IERQDFAVLGRRPAISKARKLALVARAALGKLLGKPREKER* |
| Ga0136449_1012216111 | 3300010379 | Peatlands Soil | NAIERQGFAVLGRRPAISKTRKLALVARSALGRLLGKPLGKER* |
| Ga0134121_110681123 | 3300010401 | Terrestrial Soil | QEILNAIERQGYAVLGNRPAISKSRKLALVALAALQKLI* |
| Ga0126350_102554952 | 3300010880 | Boreal Forest Soil | EILNAIEKQNYAVLGNRPAISKSRKLALVARAALSKLLAGSVRGER* |
| Ga0137392_112112812 | 3300011269 | Vadose Zone Soil | NAIERQRYAVLGRRPAISKTRKLALVARAGLGKLLGKRV* |
| Ga0137391_107362911 | 3300011270 | Vadose Zone Soil | NAIERQDYAVLGRRPAISKARKLALVARAALGKLLGKPQEKQR* |
| Ga0137388_113654161 | 3300012189 | Vadose Zone Soil | AIERQAFSVLGLRPAISKRRKLALVARAALVKFL* |
| Ga0137363_116200551 | 3300012202 | Vadose Zone Soil | NAIERQNFAVLGRRPVISKPRKLALVARAALGKLL* |
| Ga0137399_110870162 | 3300012203 | Vadose Zone Soil | QEILKAIERQNFKVLGQRPTISKTRKLALLARAALGKVR* |
| Ga0137386_105199392 | 3300012351 | Vadose Zone Soil | LNAIERQDYAVLGRRPAISKTRKLALVARAMLGKLL* |
| Ga0137373_112213942 | 3300012532 | Vadose Zone Soil | LNAIERQNYAVLGKRPSISKSRKLALVAHAAMTKIFGRSSQAQP* |
| Ga0164301_106380421 | 3300012960 | Soil | EILRAIERQGFAVLGQRPEISKTRNLALVARAALGKLR* |
| Ga0181524_101498001 | 3300014155 | Bog | QHYAVLGRRPTISKTRKLALVARAALGQLLGKSVERQ* |
| Ga0181523_102328422 | 3300014165 | Bog | QRYAVLGRRPAISQTRKLALVARAAMGKLLGKQI* |
| Ga0182000_101219531 | 3300014487 | Soil | NAIEAQGCAVLGRRPVLSKPRKLALVARAALGKLV* |
| Ga0182018_102736952 | 3300014489 | Palsa | LRAIERQGYAVLGRRPVISKARKLALVARAGLGKFL* |
| Ga0182011_105370671 | 3300014496 | Fen | IERQHYAVLGRRPAISKTRKLALVARAALGKLLGKQR* |
| Ga0137420_12502181 | 3300015054 | Vadose Zone Soil | IERQDYAVLDYAVLGRRPAISKARKLALVARAVLGKLLGKQEQR* |
| Ga0182036_106859601 | 3300016270 | Soil | EILKAIEQQDYAVLGRRPSISKTRKLMLVARAAWGKLA |
| Ga0182041_122530361 | 3300016294 | Soil | QGFGVLGNRPAISKSRKLALVARAALAKMFGLSGGSR |
| Ga0182034_112155232 | 3300016371 | Soil | SRGGQGILDAIERQQFKVLGRRPALSKTRKLALVARAAWGRLL |
| Ga0187818_102851601 | 3300017823 | Freshwater Sediment | LNAIEAQGYNVLGRRPAISNSRKLALVARAAWGKLPWVKKI |
| Ga0187778_103879362 | 3300017961 | Tropical Peatland | QEILRAIEAQGYQVLGLRPAISKSRKLALVARAAWRKLL |
| Ga0187816_100444873 | 3300017995 | Freshwater Sediment | EILNAIERQDFAVLGRRPAISKAGKLALVARAALGKLLGKPREKPLEKER |
| Ga0187805_102191021 | 3300018007 | Freshwater Sediment | ILRAIESQGYNVLGNRPKISKFKKLTLLARAALGKLL |
| Ga0187873_10509301 | 3300018013 | Peatland | HYAVLGRRPTISKTRKLALVARAALGQLLGKSVERQ |
| Ga0187873_12844761 | 3300018013 | Peatland | NAIERQDFAVLGRRPAISKARKLALVARAAVGKLLGPREKER |
| Ga0187872_102101231 | 3300018017 | Peatland | ILNAIERHHFAVLGRRPAISKARKLALVARAAVGALRGKPLETER |
| Ga0187857_104031432 | 3300018026 | Peatland | ERHHFAVLGRRPAISKARKLALVARAAMGKLLGKPLETER |
| Ga0187862_108321671 | 3300018040 | Peatland | EILNAIERQDFAVLGRRPAISKARKLALVARAALEKLLGKPLEKER |
| Ga0187862_108976091 | 3300018040 | Peatland | QEILTAIERQRYAVLGRRPAISKTRKLALVGRAALAKLLGKGR |
| Ga0187887_105254652 | 3300018043 | Peatland | ENQGYDVLRSRPTISKSRKLALLGRALLRRVVGPR |
| Ga0187766_101460143 | 3300018058 | Tropical Peatland | DAIQRQKFAVLGRRPAISRPRKLILVARAALGKLR |
| Ga0187769_102604721 | 3300018086 | Tropical Peatland | ILNAIEAQGFNVLGRRPAISKARKLALVARAAWSKLL |
| Ga0187771_103248801 | 3300018088 | Tropical Peatland | LNAIERQGYKVLGRRPVISRSRKLALVARAAWRKLL |
| Ga0187770_111394442 | 3300018090 | Tropical Peatland | EILNAIEKQNYAVLGNRPSISKTRKLALVARAAMAKLFGRSGGSE |
| Ga0066662_104706361 | 3300018468 | Grasslands Soil | NAIERQNYAVLGCRPVISKRRKLALVARAALHKLI |
| Ga0182022_10653112 | 3300019785 | Fen | ERQDYAVLGRRPAISKTRKLALVARAALGKFLGKQR |
| Ga0182025_11267612 | 3300019786 | Permafrost | ILNAIERQHFAALCRRPVISKPRKLALAARAATGKLWGGL |
| Ga0210399_110151862 | 3300020581 | Soil | GLEILSAIEKQSFAVLGNRPAISKTRKLALVAHAAMSKLFGSSGADAR |
| Ga0210399_112230502 | 3300020581 | Soil | KQKYAVLGNRPTISKSRKLALVSHAAIAKMFGLSGGAR |
| Ga0210406_105957681 | 3300021168 | Soil | GQEILHAIEKQGFNVLGNRPTISKSRKITLLARAAWRKWL |
| Ga0210400_107293762 | 3300021170 | Soil | ERQNYAVLGRRPAISKARKLALVARAALGKMLGKPQEKRR |
| Ga0210393_104936111 | 3300021401 | Soil | IERQGYAVLGRRPAISKSRKLGLVASAAWSKLGGATR |
| Ga0210393_112225772 | 3300021401 | Soil | NQNYAVLGNRPEISKPRKLALVARAALGKLFGAKS |
| Ga0210393_113154811 | 3300021401 | Soil | IERQRFAVLGKRPVISRPRKLGLVARAALGKLLGSLS |
| Ga0210397_107413811 | 3300021403 | Soil | LNAIETQDYAVLGRRPAISKTRKMALVARAAVGKLLGDMI |
| Ga0210386_108347701 | 3300021406 | Soil | IENQNYAVLGKRPEISKPRKLALVARAALGKLFGAKS |
| Ga0213853_105041971 | 3300021861 | Watersheds | QEILRAIEEQDYAVLGNRPAISKPRKLALVARAALGKLLGGSI |
| Ga0208688_10689011 | 3300025480 | Peatland | EILRAIERQDYAVLGRRPAISKTRKLALVARAALGKLR |
| Ga0208686_10191823 | 3300025500 | Peatland | GYAVLGRRPAISKARKLALVARAALGKVLRKPREKER |
| Ga0207693_114479852 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | ILNTIQRQDYAVLGSRPAISKPRKLALVARAAIHKLL |
| Ga0207659_106367502 | 3300025926 | Miscanthus Rhizosphere | NAIERQGYAVLGNRPAISKSRKLALVARAALHKLI |
| Ga0207700_107365482 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | YAVLGHRPAISKPRKLALVARAALAKIFGNAQGGAR |
| Ga0207702_120464241 | 3300026078 | Corn Rhizosphere | LNAIERQGYAVLGNRPAISKSRKLALVARAALHKLI |
| Ga0209153_11138382 | 3300026312 | Soil | LNAIERQGYAVLGQRPAISKSRKLALVARAALGSLI |
| Ga0257179_10512712 | 3300026371 | Soil | EILNAIERQDYAVLGRRPAISKTRKLALVACAALGKLLGKQR |
| Ga0247846_10544892 | 3300026474 | Soil | DRQDYAVLGRRPAISKPRKLALLARAALGKLLGKQR |
| Ga0209474_100854224 | 3300026550 | Soil | NAIERENYAVLGNRPAISRSRKIALVARAALHKLL |
| Ga0208728_1033812 | 3300027102 | Forest Soil | NAIEKQNYAVLGNRPAISKSRKLALVAHAAVAKIFGLSGGPR |
| Ga0208488_10724942 | 3300027110 | Forest Soil | ILNAIERQDYAVLGRRPVISKSRKLALVARSALGKVLGKQLGKQR |
| Ga0209218_10688892 | 3300027505 | Forest Soil | LNAIERQDFAVLGNRPKISKPRKLALVARAAFGKVFSRRVKADGSGAK |
| Ga0208324_10351503 | 3300027604 | Peatlands Soil | RRPAISKARKLALVARAALGKLLGKPLEKPLEKER |
| Ga0209009_10384671 | 3300027667 | Forest Soil | IEAQDYAVLGRRPAISKTRKVALVARAALGKLLGDKI |
| Ga0209517_104687152 | 3300027854 | Peatlands Soil | FAVLGRRPAISKARKLALVARAALGKLLGKPLEKPLEKER |
| Ga0209380_101900722 | 3300027889 | Soil | ERQGFAVLGRRPVISKPRKLTLVARAAMGKLLGKR |
| Ga0302165_100572091 | 3300028678 | Fen | EVLNAIERQEYAVLGRRPSISKARKLALVARAALGKLV |
| Ga0308309_110105242 | 3300028906 | Soil | AIERQGNRVLGRRPAISKSRKLALVARAALSKLGGAN |
| Ga0311368_104948801 | 3300029882 | Palsa | ILNAIEKQDFAVLGNRPSISKSRKLALVARAAIGKLFGNQGKTVLGVNRV |
| Ga0311342_101688323 | 3300029955 | Bog | ILNAIEAQGYNVLGNRPKISKFRKLVLLGRAALGKLR |
| Ga0311338_1001859211 | 3300030007 | Palsa | LNAIERQDYAVLGRRPAISKTRKLALVARAALGKFR |
| Ga0265754_10212941 | 3300031040 | Soil | GGQEILNAIEAQGYNVLGRRPSISKSRKLALVAGVAWRKLREKRA |
| Ga0265760_101807851 | 3300031090 | Soil | LNAIEGQGYNVLGRRPSISKSRKLALVARAAWAKFLRGKRA |
| Ga0170823_170293621 | 3300031128 | Forest Soil | QNYAVLGKRPAISKARKLALLARAALGKLLGKPREKPREKQR |
| Ga0307478_114341942 | 3300031823 | Hardwood Forest Soil | GQKYAVLGRRPAISKPRKLTLVARAALGKLVRKRRERHG |
| Ga0310910_110197982 | 3300031946 | Soil | EKQNYAVLGNRPAISKSRKLALVAHAALNKLFGRSGGTR |
| Ga0318562_103038342 | 3300032008 | Soil | AIEKQDFAVLGNRPAISKSRKLALVAHAALAKMFGRSGGQP |
| Ga0318504_104362302 | 3300032063 | Soil | GILDAIERQQFKVLGRRPALSKTRKLALVARAAWGRLL |
| Ga0307470_112496891 | 3300032174 | Hardwood Forest Soil | LNAIEKQGFAVLGRRPSLSKPRKLALVARAALGKLL |
| Ga0307472_1002809013 | 3300032205 | Hardwood Forest Soil | NAIEKQGFAVLGRRPSISKPRKLALVARAALGKLL |
| Ga0335082_110161371 | 3300032782 | Soil | EKQHFAVLGDRPSISKPRKLALVARAAVGKLFGGRP |
| Ga0335078_123425422 | 3300032805 | Soil | EILRAIEAQDFRVLGRRPAIPKSRKLALVMRAAWGRLPWVGTR |
| Ga0335070_116598092 | 3300032829 | Soil | KAIERQGYAVLGRRPEISKARKVALVARAALGKLR |
| Ga0335072_101029181 | 3300032898 | Soil | AIEKQGYAVLGNRPAISKPRKLALVARAALDKLTGGSK |
| Ga0310811_108908572 | 3300033475 | Soil | NAIERQGFAVLGCRPVICKRRKLALVSRAALGKLV |
| Ga0316214_10168552 | 3300033545 | Roots | QEILRAIENQDYAVLGNRPEISKPRKLALVARAALGKLFGAKS |
| Ga0371490_10275923 | 3300033561 | Peat Soil | DYAVLGRRPAISKARKLALVARAALGKLRGNPLEKER |
| ⦗Top⦘ |