Basic Information | |
---|---|
Family ID | F092794 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 107 |
Average Sequence Length | 42 residues |
Representative Sequence | MPSAEHEGITGVTFDSDGHRLLGTLYLARGCAPKPTALLLH |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 43.93 % |
% of genes near scaffold ends (potentially truncated) | 99.07 % |
% of genes from short scaffolds (< 2000 bps) | 96.26 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (63.551 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (55.140 % of family members) |
Environment Ontology (ENVO) | Unclassified (53.271 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Unclassified (52.336 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 26.09% Coil/Unstructured: 73.91% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF05853 | BKACE | 93.46 |
PF01614 | IclR | 1.87 |
PF12911 | OppC_N | 0.93 |
PF00596 | Aldolase_II | 0.93 |
PF12697 | Abhydrolase_6 | 0.93 |
PF00496 | SBP_bac_5 | 0.93 |
PF02737 | 3HCDH_N | 0.93 |
COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
---|---|---|---|
COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 93.46 |
COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 1.87 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.93 |
COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.93 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.93 |
COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 0.93 |
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 63.55 % |
Unclassified | root | N/A | 36.45 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_109866310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 818 | Open in IMG/M |
3300005332|Ga0066388_107471047 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300005445|Ga0070708_100554799 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
3300005468|Ga0070707_100603994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1060 | Open in IMG/M |
3300005556|Ga0066707_10659032 | Not Available | 661 | Open in IMG/M |
3300005764|Ga0066903_103138001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 894 | Open in IMG/M |
3300006102|Ga0075015_100429099 | Not Available | 750 | Open in IMG/M |
3300006163|Ga0070715_10260397 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
3300006175|Ga0070712_100715136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 855 | Open in IMG/M |
3300006354|Ga0075021_10976980 | Not Available | 552 | Open in IMG/M |
3300006791|Ga0066653_10149174 | Not Available | 1136 | Open in IMG/M |
3300006914|Ga0075436_100635285 | Not Available | 788 | Open in IMG/M |
3300010047|Ga0126382_10886455 | Not Available | 770 | Open in IMG/M |
3300010048|Ga0126373_11230175 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300010366|Ga0126379_11533073 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
3300010376|Ga0126381_101646969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 927 | Open in IMG/M |
3300010398|Ga0126383_11662339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 728 | Open in IMG/M |
3300011085|Ga0138581_1137998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 1060 | Open in IMG/M |
3300011120|Ga0150983_13239789 | Not Available | 646 | Open in IMG/M |
3300012200|Ga0137382_11266268 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300012210|Ga0137378_10925567 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300012685|Ga0137397_10187937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1536 | Open in IMG/M |
3300012971|Ga0126369_11560994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 750 | Open in IMG/M |
3300015245|Ga0137409_10048122 | All Organisms → cellular organisms → Bacteria | 4060 | Open in IMG/M |
3300015371|Ga0132258_11680094 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
3300017926|Ga0187807_1185604 | Not Available | 671 | Open in IMG/M |
3300017927|Ga0187824_10240910 | Not Available | 625 | Open in IMG/M |
3300017928|Ga0187806_1087211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 985 | Open in IMG/M |
3300018042|Ga0187871_10169326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 1229 | Open in IMG/M |
3300018060|Ga0187765_10218189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 1110 | Open in IMG/M |
3300018468|Ga0066662_12891306 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300021478|Ga0210402_11009671 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300021560|Ga0126371_11214850 | Not Available | 890 | Open in IMG/M |
3300022510|Ga0242652_1047117 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300022533|Ga0242662_10099706 | Not Available | 827 | Open in IMG/M |
3300022726|Ga0242654_10074845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1015 | Open in IMG/M |
3300025320|Ga0209171_10038595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3340 | Open in IMG/M |
3300025906|Ga0207699_10208071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus neocaledonicus | 1329 | Open in IMG/M |
3300026340|Ga0257162_1039460 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300026557|Ga0179587_10474931 | Not Available | 819 | Open in IMG/M |
3300027729|Ga0209248_10122940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 779 | Open in IMG/M |
3300027829|Ga0209773_10006977 | All Organisms → cellular organisms → Bacteria | 4250 | Open in IMG/M |
3300027874|Ga0209465_10614988 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300027884|Ga0209275_10350184 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300027894|Ga0209068_10940350 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300028138|Ga0247684_1019835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus neocaledonicus | 1060 | Open in IMG/M |
3300030511|Ga0268241_10072257 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300030578|Ga0210275_10392971 | Not Available | 507 | Open in IMG/M |
3300031546|Ga0318538_10691134 | Not Available | 553 | Open in IMG/M |
3300031564|Ga0318573_10331835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 815 | Open in IMG/M |
3300031572|Ga0318515_10089738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 1602 | Open in IMG/M |
3300031573|Ga0310915_10780682 | Not Available | 672 | Open in IMG/M |
3300031640|Ga0318555_10587762 | Not Available | 603 | Open in IMG/M |
3300031668|Ga0318542_10409342 | Not Available | 701 | Open in IMG/M |
3300031668|Ga0318542_10620168 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300031681|Ga0318572_10595848 | Not Available | 658 | Open in IMG/M |
3300031713|Ga0318496_10295759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 893 | Open in IMG/M |
3300031719|Ga0306917_11474036 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300031747|Ga0318502_10734168 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
3300031748|Ga0318492_10436952 | Not Available | 690 | Open in IMG/M |
3300031751|Ga0318494_10645393 | Not Available | 619 | Open in IMG/M |
3300031764|Ga0318535_10474736 | Not Available | 556 | Open in IMG/M |
3300031764|Ga0318535_10481124 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300031765|Ga0318554_10007543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5262 | Open in IMG/M |
3300031768|Ga0318509_10744556 | Not Available | 543 | Open in IMG/M |
3300031769|Ga0318526_10266150 | Not Available | 701 | Open in IMG/M |
3300031779|Ga0318566_10535495 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300031781|Ga0318547_11013711 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300031792|Ga0318529_10621395 | Not Available | 501 | Open in IMG/M |
3300031798|Ga0318523_10491381 | Not Available | 607 | Open in IMG/M |
3300031805|Ga0318497_10286459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 916 | Open in IMG/M |
3300031831|Ga0318564_10128402 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
3300031831|Ga0318564_10254426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 778 | Open in IMG/M |
3300031831|Ga0318564_10362284 | Not Available | 636 | Open in IMG/M |
3300031835|Ga0318517_10372328 | Not Available | 645 | Open in IMG/M |
3300031835|Ga0318517_10489098 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300031859|Ga0318527_10414285 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300031893|Ga0318536_10368901 | Not Available | 726 | Open in IMG/M |
3300031910|Ga0306923_11732407 | Not Available | 644 | Open in IMG/M |
3300031912|Ga0306921_10272056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1984 | Open in IMG/M |
3300031942|Ga0310916_11369078 | Not Available | 580 | Open in IMG/M |
3300031947|Ga0310909_10768789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 797 | Open in IMG/M |
3300031981|Ga0318531_10261356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 781 | Open in IMG/M |
3300031981|Ga0318531_10399894 | Not Available | 622 | Open in IMG/M |
3300032008|Ga0318562_10104688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 1608 | Open in IMG/M |
3300032008|Ga0318562_10170672 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
3300032008|Ga0318562_10326910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 891 | Open in IMG/M |
3300032009|Ga0318563_10164241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 1193 | Open in IMG/M |
3300032009|Ga0318563_10349987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 799 | Open in IMG/M |
3300032025|Ga0318507_10227996 | Not Available | 806 | Open in IMG/M |
3300032025|Ga0318507_10345168 | Not Available | 648 | Open in IMG/M |
3300032041|Ga0318549_10566543 | Not Available | 510 | Open in IMG/M |
3300032052|Ga0318506_10069677 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
3300032054|Ga0318570_10515744 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300032055|Ga0318575_10182606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 1050 | Open in IMG/M |
3300032059|Ga0318533_10515344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 877 | Open in IMG/M |
3300032064|Ga0318510_10555770 | Not Available | 501 | Open in IMG/M |
3300032067|Ga0318524_10255954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 901 | Open in IMG/M |
3300032068|Ga0318553_10163760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 1154 | Open in IMG/M |
3300032076|Ga0306924_12606015 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300032261|Ga0306920_103542550 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300032828|Ga0335080_10938197 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300032896|Ga0335075_11247898 | Not Available | 640 | Open in IMG/M |
3300033289|Ga0310914_11185192 | Not Available | 665 | Open in IMG/M |
3300033290|Ga0318519_10237815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 1050 | Open in IMG/M |
3300033290|Ga0318519_10566784 | Not Available | 688 | Open in IMG/M |
3300033290|Ga0318519_11005048 | Not Available | 518 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 55.14% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.54% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.67% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.80% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.80% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.80% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.87% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.87% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.93% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011085 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
3300030578 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1098663101 | 3300000956 | Soil | MPRAEHEGITGVTFDSDGLRLLGPLYLARGCQPKPTVLLL |
Ga0066388_1074710472 | 3300005332 | Tropical Forest Soil | MPIAPEEHDGITGVTFTSDGHRLLGTLYLARGSEPKPTALL |
Ga0070708_1005547993 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | TGVTFDSGGHRLVGTLYLARGAAPKPTVLLPHGCPGLRAG* |
Ga0070707_1006039941 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VPVDRAPAPAAPGEHDGLTGVTFDSGGHRLVGTLYLARGAAPKPT |
Ga0066707_106590321 | 3300005556 | Soil | MPVAPGEHDGITGVTFTSDGHRLLGTLYLARGDEPK |
Ga0066903_1031380011 | 3300005764 | Tropical Forest Soil | MPGTEHEGITGVTFDSEGFRLLGTLYLARGSQPKPT |
Ga0075015_1004290992 | 3300006102 | Watersheds | MWGTEGHPEHEGITGVTFDSDGHRLVGTLYLARGEEP |
Ga0070715_102603971 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIAPGEHDGITGVTFTSDGHRLLGTLYLARGDEPKPTALLL |
Ga0070712_1007151362 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLAGYGGISGITFDSDGHRLVGVAYLARGRHPKPTALLLHGCP |
Ga0075021_109769802 | 3300006354 | Watersheds | MWATERHPEHEGITGVIFGSDGHRLVGTLYLARGEEP |
Ga0066653_101491742 | 3300006791 | Soil | MPIAPEEHDGITGVTFTSDGYRLLGTLYLARGSEPKP |
Ga0075436_1006352852 | 3300006914 | Populus Rhizosphere | MPRGEHEGITGVTFDSDGLRLLGTLYLARGCLPKPTV |
Ga0126382_108864552 | 3300010047 | Tropical Forest Soil | MSCAEHEGITGVTFDSDGHRLLGTLYLARGAEPKPTALLLHGCP |
Ga0126373_112301751 | 3300010048 | Tropical Forest Soil | MTPAGHEGITGITFDSDGHRLVGVAYLARGHHPKPTALLLLGCPGLAQNLDVAAA |
Ga0126379_115330731 | 3300010366 | Tropical Forest Soil | MAPAGHEGITGITFDSDGHRLVGVAYLARGHHPKPT |
Ga0126381_1016469692 | 3300010376 | Tropical Forest Soil | MRLAEHAGLVGVTFGSEGHDLVGVLYLARGSEPKPTVL |
Ga0126383_116623392 | 3300010398 | Tropical Forest Soil | MRLAEHAGLVGVTFGSEGHDLVGVLYLARGSEPKPT |
Ga0138581_11379982 | 3300011085 | Peatlands Soil | MWATEGHPEHEGITGVTFDSDGHRLVGTLYLARGEEPKP |
Ga0150983_132397891 | 3300011120 | Forest Soil | MSATEPPAGHEGIAGVTFGSDGHRLLGVQYLAAGEEPKPAVLLLHGCP |
Ga0137382_112662681 | 3300012200 | Vadose Zone Soil | MPIAPAEHDGITGVTFSSDGHRLLGTLYLARGSEPKPTALL |
Ga0137378_109255671 | 3300012210 | Vadose Zone Soil | MTPAGDEGITGITFDSDGHRLVGMAYLARGHRPKLTALLHGCPGLEQNLDVAAVLRDRG |
Ga0137397_101879372 | 3300012685 | Vadose Zone Soil | MPIAPGEHDGITGVTFTSDRHRLLGTLYLARGSEPKQTALLLHGFP |
Ga0126369_115609941 | 3300012971 | Tropical Forest Soil | MTPGGHEGVTGVTFDSDGHRLLGALYLARGGAPKPTALLLHGCPG |
Ga0137409_100481221 | 3300015245 | Vadose Zone Soil | MPVAPGEHDGITGVTFTSDGHRLLGTLYLARGDEPKPT |
Ga0132258_116800941 | 3300015371 | Arabidopsis Rhizosphere | MWATEPHLEHEGIAGAIFDSEGPRLVGTVYLARGEEPKPTALLLHG |
Ga0187807_11856041 | 3300017926 | Freshwater Sediment | MSPAGHEGITGITFDSDGHRLAGVAYLARGRHPKPTALLLHG |
Ga0187824_102409102 | 3300017927 | Freshwater Sediment | MPVAPGEHDGITGVTFSSDGHQLLGTLYLARGSEPK |
Ga0187806_10872111 | 3300017928 | Freshwater Sediment | MACGGHQGIVGVTFCSDGRRLTGALYLARGAQAKPSVLLLHGCPGLEQNLDL |
Ga0187871_101693261 | 3300018042 | Peatland | MSATELSEKHEGITGVTFDSDGHRLLGVEYLAPGEEPKPAVLLLHG |
Ga0187765_102181891 | 3300018060 | Tropical Peatland | MWATEPHLEHEGIAGAIFDSEGHRLVGTLYLARGEEPKPTALLLH |
Ga0066662_128913062 | 3300018468 | Grasslands Soil | MPIAPGEHDGITGVTFTSDGHRLLGTLYLARGDEPK |
Ga0210402_110096711 | 3300021478 | Soil | MGQAGHGGITGITFDSDGHRLVGVAYLARGHHPKPTALLLHGCPGLEK |
Ga0126371_112148502 | 3300021560 | Tropical Forest Soil | MPVAPAEHDGITGVTFGSDGHRLLGTLYLARGSEPKPTALLLHGCPGLQQ |
Ga0242652_10471172 | 3300022510 | Soil | MWAIEPHPEHEGIAGAVFDSEGHRLVGTLYLARGEEPKPTALLLHGCP |
Ga0242662_100997061 | 3300022533 | Soil | MPIAPGEHDGITGVTFTSDGHRLLGTLYLARGDEP |
Ga0242654_100748451 | 3300022726 | Soil | MPIAPEEHDGITGVTFTSDGHRLLGTLYLARGDEPKP |
Ga0209171_100385951 | 3300025320 | Iron-Sulfur Acid Spring | MSATEPPAGHEGITGVTFDSDGHRLLGVQYLAAGEEPKP |
Ga0207699_102080712 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVAPAEHDGITGVTFGSGGHRLLGTLYLARGSEP |
Ga0257162_10394601 | 3300026340 | Soil | MPVAPGEHDGITGVTFTSDGHRLLGTLYLARGDEPKPTALLLH |
Ga0179587_104749311 | 3300026557 | Vadose Zone Soil | MGPSANYGITGVTFDSAGYRLVGVAYPARGTEPKPTAIVLHGCAS |
Ga0209248_101229401 | 3300027729 | Bog Forest Soil | MWATEPRPEHEGITGVTFDSDGHRLVGVCYLARGQEPKPTALLLHGCPGLE |
Ga0209773_100069771 | 3300027829 | Bog Forest Soil | MWATESHPEHEGITGVTFDSDGHRLAGVCYLARGEEPKPTALLLH |
Ga0209465_106149881 | 3300027874 | Tropical Forest Soil | VSWSATRLAEHAGITGVTFDSDGHVLVGVLYLARGGEP |
Ga0209275_103501842 | 3300027884 | Soil | MWATEAHLELEGITGVTFDSEGHRLVGVLYLARGPGPKPTALLLHG |
Ga0209068_109403501 | 3300027894 | Watersheds | MWATERHPEHEGITGVIFGSDGHRLVGTLYLARGEEPK |
Ga0247684_10198352 | 3300028138 | Soil | MPVAPAEHDGITGVTFGSDGHRLLGTLYLARGGGPKP |
Ga0268241_100722571 | 3300030511 | Soil | MPILPGEHDGITGVTFASGGHRLLGTLYLARGCDP |
Ga0210275_103929712 | 3300030578 | Soil | MWATDRNAEHEGIAGVTFDSDGHRLVGTLYLARGVEPKPTALLL |
Ga0318538_106911341 | 3300031546 | Soil | MWATEPQLEHEGIAGVTFDIDGHRLVGTIYLARAEEPKPTALLLHG |
Ga0318573_103318352 | 3300031564 | Soil | MWATEDEGLTGVTFDSDGHRLVGVLYLARGEEPKRTVLLLHG |
Ga0318515_100897382 | 3300031572 | Soil | MPSAEHEGITGVTFDSDGHRLLGTLYLARGCTPKPTALLLHGCPGLQ |
Ga0310915_107806821 | 3300031573 | Soil | MPSAEHEGITGVTFDSDGHRLLGTLYLARGCTPEPTA |
Ga0318555_105877621 | 3300031640 | Soil | MAPAGHGGITGITFDSDGHRLVGVAYLARGHHPKPAALLLHGCPGLE |
Ga0318542_104093422 | 3300031668 | Soil | MAPAGHGGIAGITFDSDGHRLVGVAYLARGHHPKPTALLLHGCPGLEQN |
Ga0318542_106201681 | 3300031668 | Soil | MPSAEHEGITGVTFDSDGHRLLGTLYLARGGAPKPTVLLLHGCPS |
Ga0318572_105958482 | 3300031681 | Soil | MWATEPHEGITGVTFDSDGHRLLGVLYLTRGEEPAP |
Ga0318496_102957592 | 3300031713 | Soil | MPSAEHEGITGVTFDSDGHRLLGTLYLARGCTPKPTALLLHGCPG |
Ga0306917_114740361 | 3300031719 | Soil | MTPAGHEGIIGVTFDSDGNRLVGVAYLARGREPKPTAL |
Ga0318502_107341681 | 3300031747 | Soil | MPSAEHEGITGVTFDSDGHRMLGTLYLARGCTLKPTALLLHGCPGLQQNADLAV |
Ga0318492_104369521 | 3300031748 | Soil | MWATEPHPEHEGIAGVTFDSDGHRLVGTIYLARGKEPKPTV |
Ga0318494_106453932 | 3300031751 | Soil | MPSAEHEGITGVTFDSDGHRLLGTLYLARGCAPKPTALLLH |
Ga0318535_104747361 | 3300031764 | Soil | MPFAEHEGITGVTFDSDGHRLIGTLYLARGGTPKP |
Ga0318535_104811242 | 3300031764 | Soil | MPFAEHEGITGVTFDSDGHRLLGTLYLARGRAPKPTALLLHGCP |
Ga0318554_100075431 | 3300031765 | Soil | MPSAEHEGITGVTFDSDGHRLLGTLYLARGYAPKPTALL |
Ga0318509_107445561 | 3300031768 | Soil | MWATEPHLEHEGIAGVIFDSEGHRLVGTLYLARGEEPKPTV |
Ga0318526_102661502 | 3300031769 | Soil | MPSAEHEGITGVTFDSDGHRLLGILYLARGNDPKPTVLLL |
Ga0318566_105354952 | 3300031779 | Soil | MPAAEHEGITGVTFDSDGHRMLGTLYLARGCTPKPTALLLHGCPGLQQNA |
Ga0318547_110137112 | 3300031781 | Soil | MWATEPHEGITGVTFDSDGHRLLGVLYLTRGEEPA |
Ga0318529_106213951 | 3300031792 | Soil | MPFAEHEGITGVTFDSDGHRLLGTLYLARGRAPKPT |
Ga0318523_104913812 | 3300031798 | Soil | MPFAEHEGITGVTFDSDGHRLLGTLYLARGGTPKP |
Ga0318497_102864592 | 3300031805 | Soil | MPFAEHEGITGVTFDSDGHRLIGTLYLARGGTPVM |
Ga0318564_101284021 | 3300031831 | Soil | MPIAPEEHDGITGVTFTSDGHRLLGTLYLARGGEPKPTALLLHGCPGFQQN |
Ga0318564_102544262 | 3300031831 | Soil | MPFAEHEGITGVTFDSDGHRLIGTLYLARGGTPMPTVLLLH |
Ga0318564_103622841 | 3300031831 | Soil | MPFAEHEGITGVTFDSDGHRLLGTLYLARGYAPKPTALLLHGCPGL |
Ga0318517_103723281 | 3300031835 | Soil | MPSAEHEGITGVTFDSDGHRLLGILYLARGNDPKPTVLLLH |
Ga0318517_104890982 | 3300031835 | Soil | MPFAEHEGITGVTFDSDGHRLLGTLYLARGRAPKPTALLLHGC |
Ga0318527_104142851 | 3300031859 | Soil | MPIAPEEHDGITGVTFTSDGHRLLGTLYLARGSEPKPTAL |
Ga0318536_103689011 | 3300031893 | Soil | MPSAEHEGITGVTFDSDGHRLLGILYLARGNDPKPTVLLLHGCP |
Ga0306923_117324071 | 3300031910 | Soil | MPSAEHEGITGVTFDSDGHRLLGILYLARGNDPKPTVL |
Ga0306921_102720563 | 3300031912 | Soil | MPFAEHEGITGVTFDSDGHRLIGTLYLARGGTPKPTILLLHGCP |
Ga0310916_113690781 | 3300031942 | Soil | MPFAEHEGITGVTFDSDGHRLIGTLYLARGGTPMP |
Ga0310909_107687891 | 3300031947 | Soil | MWATEEHPEHEGIAGVTFDSDGHRLVGTIYLARGHDPKPT |
Ga0318531_102613562 | 3300031981 | Soil | MPFAEHEGITGVTFDSDGHRLLGTLYLARGGTPKPTVVLLHGCHG |
Ga0318531_103998942 | 3300031981 | Soil | MPIAPEEHDGITGVTFTSDGHRLLGTLYLARGSEPKPTALLLHGCPG |
Ga0318562_101046882 | 3300032008 | Soil | MPSAEHEGITGVTFDSDGHRMLGTLYLARGCTPKPTALLLHGCPGLQQN |
Ga0318562_101706722 | 3300032008 | Soil | MPIAPEEHDGITGVTFTSDGHRLLGTLYLARGSEPKP |
Ga0318562_103269101 | 3300032008 | Soil | MWATEPQLEHEGIAGVTFDSDGHRLVGTIYLARGEEPKPTALLLHG |
Ga0318563_101642411 | 3300032009 | Soil | MPSAEHEGITGVTFDSDGHRMLGTLYLARGCTPKPTALLLHGCPG |
Ga0318563_103499872 | 3300032009 | Soil | MPFAEHEGITGVTFDSDGHRLIGTLYLARGDTPKPTVLLLHGC |
Ga0318507_102279962 | 3300032025 | Soil | MWATERHPEHEGIVGVTFDSQGNRLVGTLYLARGEDPKP |
Ga0318507_103451682 | 3300032025 | Soil | MPIAPEEHDGITGVTFTSDGHRLLGTLYLARGSEPKPT |
Ga0318549_105665432 | 3300032041 | Soil | MPFAEHEGITGVTFDSDGHRLLGTLYLARGRAPKPTALLLH |
Ga0318506_100696773 | 3300032052 | Soil | MWAIEHEGLTGVTFDSDGHRLVGVLYLIRGEEPAPTVLLLHGCPGLE |
Ga0318570_105157442 | 3300032054 | Soil | MPSAEHEGITGVTFDSDGHRMLGTLYLARGCTLKPTALLLH |
Ga0318575_101826062 | 3300032055 | Soil | MPFAEHEGITGVTFDSDGHRLIGTLYLARGGTPKPT |
Ga0318533_105153442 | 3300032059 | Soil | MPFAEHEGITGVTFDSDGHRLLGTLYLARGRAPKPTALLLHGCPGLQ |
Ga0318510_105557702 | 3300032064 | Soil | MPFAEHEGITGVTFDSDGHRLIGTLYLARGGTPMPTVLLLHGCPG |
Ga0318524_102559541 | 3300032067 | Soil | MWATEGHPEHEGITGVTFPSDGHRLVGTFYLARGDEPK |
Ga0318553_101637601 | 3300032068 | Soil | MWATEPQLEHEGIAGVTFDSDGHRLVGTIYLARGEE |
Ga0306924_126060152 | 3300032076 | Soil | MWATEPQLEHEGIAGVTFDIDGHRLVGTIYLARAEEPKP |
Ga0306920_1035425502 | 3300032261 | Soil | MPGTEHEGITGVTFDSEGFRLLGTLYLARGSQPKPTVLL |
Ga0335080_109381972 | 3300032828 | Soil | MWATEGHPEHEGITGVTFSSGGHRLAGTFYLARDETDRGA |
Ga0335075_112478981 | 3300032896 | Soil | MWATDGHREHEGIGGVTFDSDGHRLLGTLYLAHGDE |
Ga0310914_111851921 | 3300033289 | Soil | MWATEDEGLTGVTFDSDGHRLVGVLYLARGEEPKRTVLLLHGCPGLEK |
Ga0318519_102378152 | 3300033290 | Soil | MSFAEHEGITGVTFDSDGHCLLGILYLARGNDPKPTVLLLHG |
Ga0318519_105667841 | 3300033290 | Soil | MPIAPEEHDGITGVTFTSDGHRLLGTLYLARGSEPKPTALMLH |
Ga0318519_110050482 | 3300033290 | Soil | MWATEEHPEHEGIAGVTFDSDGHRLVGTIYLARGHDPKPTALLLHGCPGLEKN |
⦗Top⦘ |