| Basic Information | |
|---|---|
| Family ID | F092789 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MRVQAQGRGHNGKKFRETCETVVVNGHGGLLMLKHEVDNGEML |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 46.73 % |
| % of genes near scaffold ends (potentially truncated) | 98.13 % |
| % of genes from short scaffolds (< 2000 bps) | 86.92 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.131 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (48.598 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.991 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.533 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 29.58% Coil/Unstructured: 70.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF01546 | Peptidase_M20 | 23.36 |
| PF00248 | Aldo_ket_red | 6.54 |
| PF00072 | Response_reg | 3.74 |
| PF00962 | A_deaminase | 2.80 |
| PF03551 | PadR | 2.80 |
| PF02055 | Glyco_hydro_30 | 1.87 |
| PF02566 | OsmC | 1.87 |
| PF12704 | MacB_PCD | 1.87 |
| PF10417 | 1-cysPrx_C | 1.87 |
| PF14026 | DUF4242 | 0.93 |
| PF02518 | HATPase_c | 0.93 |
| PF00480 | ROK | 0.93 |
| PF13384 | HTH_23 | 0.93 |
| PF06718 | DUF1203 | 0.93 |
| PF15780 | ASH | 0.93 |
| PF13620 | CarboxypepD_reg | 0.93 |
| PF00383 | dCMP_cyt_deam_1 | 0.93 |
| PF12680 | SnoaL_2 | 0.93 |
| PF01794 | Ferric_reduct | 0.93 |
| PF04030 | ALO | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 2.80 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 2.80 |
| COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 2.80 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 2.80 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 1.87 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 1.87 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.87 |
| COG5520 | O-Glycosyl hydrolase | Cell wall/membrane/envelope biogenesis [M] | 1.87 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.13 % |
| Unclassified | root | N/A | 1.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_101793041 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300002906|JGI25614J43888_10160255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300002914|JGI25617J43924_10114534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 954 | Open in IMG/M |
| 3300004080|Ga0062385_10497894 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300004091|Ga0062387_100165687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1292 | Open in IMG/M |
| 3300005541|Ga0070733_10264807 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300005602|Ga0070762_10067728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2003 | Open in IMG/M |
| 3300006102|Ga0075015_100910140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300006163|Ga0070715_10379411 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300006176|Ga0070765_101265407 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300007255|Ga0099791_10070458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1585 | Open in IMG/M |
| 3300007258|Ga0099793_10274307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
| 3300007265|Ga0099794_10081678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1595 | Open in IMG/M |
| 3300007265|Ga0099794_10126546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1288 | Open in IMG/M |
| 3300007265|Ga0099794_10452377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300009038|Ga0099829_11438736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300009090|Ga0099827_10184586 | All Organisms → cellular organisms → Bacteria | 1727 | Open in IMG/M |
| 3300009137|Ga0066709_101266946 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300009143|Ga0099792_11145333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300009792|Ga0126374_10778343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300010321|Ga0134067_10056284 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300010337|Ga0134062_10433132 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300010360|Ga0126372_11137672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300010366|Ga0126379_12817977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300010376|Ga0126381_101100782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1148 | Open in IMG/M |
| 3300010379|Ga0136449_102741914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300011269|Ga0137392_11012658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300011269|Ga0137392_11216715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300011269|Ga0137392_11353866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300012096|Ga0137389_10290930 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300012096|Ga0137389_11606522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300012096|Ga0137389_11629115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300012189|Ga0137388_11668330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300012202|Ga0137363_10237695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1477 | Open in IMG/M |
| 3300012202|Ga0137363_10622849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300012202|Ga0137363_11360193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300012202|Ga0137363_11416289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300012203|Ga0137399_10172922 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
| 3300012203|Ga0137399_10179987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1706 | Open in IMG/M |
| 3300012203|Ga0137399_10729587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300012205|Ga0137362_10033877 | All Organisms → cellular organisms → Bacteria | 4069 | Open in IMG/M |
| 3300012210|Ga0137378_11145232 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300012211|Ga0137377_10038940 | All Organisms → cellular organisms → Bacteria | 4349 | Open in IMG/M |
| 3300012349|Ga0137387_10006159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6706 | Open in IMG/M |
| 3300012363|Ga0137390_10831094 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300012582|Ga0137358_10085777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2123 | Open in IMG/M |
| 3300012582|Ga0137358_10198471 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300012582|Ga0137358_10467695 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300012582|Ga0137358_10970245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300012683|Ga0137398_10217340 | Not Available | 1265 | Open in IMG/M |
| 3300012685|Ga0137397_10025092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4218 | Open in IMG/M |
| 3300012917|Ga0137395_10338079 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300012918|Ga0137396_10013088 | All Organisms → cellular organisms → Bacteria | 5146 | Open in IMG/M |
| 3300012918|Ga0137396_10597921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300012922|Ga0137394_10040078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3837 | Open in IMG/M |
| 3300012925|Ga0137419_10429624 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300012927|Ga0137416_11733729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_58_21 | 570 | Open in IMG/M |
| 3300012930|Ga0137407_11017039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300012931|Ga0153915_10697419 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1173 | Open in IMG/M |
| 3300012944|Ga0137410_10086793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2298 | Open in IMG/M |
| 3300012944|Ga0137410_10193457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1572 | Open in IMG/M |
| 3300015054|Ga0137420_1410904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7274 | Open in IMG/M |
| 3300015241|Ga0137418_10538578 | Not Available | 927 | Open in IMG/M |
| 3300015245|Ga0137409_11561428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300018012|Ga0187810_10173858 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300018058|Ga0187766_11321486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300018090|Ga0187770_11216411 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300020140|Ga0179590_1012481 | All Organisms → cellular organisms → Bacteria | 1864 | Open in IMG/M |
| 3300020140|Ga0179590_1046438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1110 | Open in IMG/M |
| 3300020581|Ga0210399_10065717 | All Organisms → cellular organisms → Bacteria | 2932 | Open in IMG/M |
| 3300021086|Ga0179596_10181899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1016 | Open in IMG/M |
| 3300021088|Ga0210404_10135326 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300021088|Ga0210404_10176837 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300021088|Ga0210404_10905401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300021170|Ga0210400_10096724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2335 | Open in IMG/M |
| 3300021170|Ga0210400_10382353 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300021171|Ga0210405_11013352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300021403|Ga0210397_10267260 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300021433|Ga0210391_10379960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
| 3300021478|Ga0210402_10774145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300021479|Ga0210410_11396057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300024288|Ga0179589_10028805 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
| 3300024288|Ga0179589_10346659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300026325|Ga0209152_10083502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1179 | Open in IMG/M |
| 3300026361|Ga0257176_1056331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300026469|Ga0257169_1012742 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300026482|Ga0257172_1112085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300026555|Ga0179593_1007415 | All Organisms → cellular organisms → Bacteria | 2960 | Open in IMG/M |
| 3300027603|Ga0209331_1067414 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300027629|Ga0209422_1071670 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300027663|Ga0208990_1069475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1018 | Open in IMG/M |
| 3300027671|Ga0209588_1146893 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300027684|Ga0209626_1042059 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300027737|Ga0209038_10024195 | All Organisms → cellular organisms → Bacteria | 1791 | Open in IMG/M |
| 3300027867|Ga0209167_10293863 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300028047|Ga0209526_10187201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1438 | Open in IMG/M |
| 3300030991|Ga0073994_10026403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300030991|Ga0073994_12364230 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300031128|Ga0170823_11265904 | All Organisms → cellular organisms → Bacteria | 2137 | Open in IMG/M |
| 3300031128|Ga0170823_16934530 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300031231|Ga0170824_124274805 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300031682|Ga0318560_10785258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300031820|Ga0307473_11165189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300031946|Ga0310910_10159210 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
| 3300031962|Ga0307479_12091724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300032180|Ga0307471_101473535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
| 3300032180|Ga0307471_101833304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 48.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.74% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.87% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.87% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.93% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1017930412 | 3300002245 | Forest Soil | MRLQAKGRAHDGRKFRETCETVVVSAHGALLLLKHEIDTGETL |
| JGI25614J43888_101602553 | 3300002906 | Grasslands Soil | MKLQALGRNHAGKKFREVCETLVVNSHGGLLMLTHEVDNDEM |
| JGI25617J43924_101145342 | 3300002914 | Grasslands Soil | MRVQAQGRAHNRKKFKETCETVVVSGHGGLLLLKHEVDDGEMLVITNPETQEEQ |
| Ga0062385_104978943 | 3300004080 | Bog Forest Soil | VFHKMRVHAKGRGYRGKKFTETCETQVVNAHGGLLLLKQEV |
| Ga0062387_1001656871 | 3300004091 | Bog Forest Soil | MRVQAKGRAHNGRKFKETCETVVVNAHGGLLLLKHEIDNGE |
| Ga0070733_102648072 | 3300005541 | Surface Soil | MFHRMKLQALGRSHAGKKFREVCETLVVNAHGGLLML |
| Ga0070762_100677281 | 3300005602 | Soil | MRLQAHGRAHNGKKFKESCETVVVNAHGGLLMLKHEID |
| Ga0075015_1009101401 | 3300006102 | Watersheds | MRVQAQGRGHNGKKFRETCETLVVNGHGGLLLLKHEVDNGEMLVITNPETMEE |
| Ga0070715_103794112 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVQAQGRAHGGKKFHETCETLVVSLHGGLLMMKNEVDN |
| Ga0070765_1012654071 | 3300006176 | Soil | MFHKMRVQAQGRAHNGKKFRETCETLVVNGHGGLLLL |
| Ga0099791_100704581 | 3300007255 | Vadose Zone Soil | MRVHAQGRAHNGKKFRETCETVVVNGHGGLLFLKHEIDNGEMLVITN |
| Ga0099793_102743073 | 3300007258 | Vadose Zone Soil | MRVEVQGRAHNRKKFKETCETVVVNGHGGLLMLKHEVDNGEMLVITNPETQE |
| Ga0099794_100816781 | 3300007265 | Vadose Zone Soil | MRVLAQGRAHNGKKFRETCETVVVNGHGGLLFLKHEIDHGEMIVITN |
| Ga0099794_101265463 | 3300007265 | Vadose Zone Soil | MRVQAQGRGHNGKKFRETCETLVVNGHGGLLLLKHEVDDGVMLMITNPETQ |
| Ga0099794_104523772 | 3300007265 | Vadose Zone Soil | MRVQAQGRGHNGKKFRETCETVVVNGHGGLLFLKHEIDDGEMLVITNPETQE |
| Ga0099829_114387361 | 3300009038 | Vadose Zone Soil | MRIQAQGRAHDRKKFKETCQTVVVNAHGGLLLLKHEVNDGEML |
| Ga0099827_101845862 | 3300009090 | Vadose Zone Soil | MKIQAQGRGHNGKKFREVCETLVVSAYGGMLMLKHEVNKDE |
| Ga0066709_1012669462 | 3300009137 | Grasslands Soil | MRVQALGRAHNGKKFRETCETVVVNGFGGLLLLKHEVNNGEMLVIT |
| Ga0099792_111453331 | 3300009143 | Vadose Zone Soil | MRVQAQGRGHNGKKFRETCETLVVNGHGGLLLLKHEVDDG |
| Ga0126374_107783432 | 3300009792 | Tropical Forest Soil | MRVQAQGRTHDRKKFKETCETVVVSAHGGLLLLKHEVD |
| Ga0134067_100562842 | 3300010321 | Grasslands Soil | MRIQAQGRGHNGKKFRETCETVVVNGFGGLLLLKH |
| Ga0134062_104331322 | 3300010337 | Grasslands Soil | MRVQAQGRGHNGKKFRETCETVVVNGHGGLLMLKHEVDNGEML |
| Ga0126372_111376721 | 3300010360 | Tropical Forest Soil | MRVQAQGRTHDRKKFKETCETVVVSAHGGLLLLKHEVDNGEM |
| Ga0126379_128179771 | 3300010366 | Tropical Forest Soil | VQAQGRAHDRKKFKETCETVVVNAHGGLLLLKHEVDNG |
| Ga0126381_1011007821 | 3300010376 | Tropical Forest Soil | MRVQAQGKDHNRRKFREVCETAVVNAHGGLLVLKHEVDNGEM |
| Ga0136449_1027419142 | 3300010379 | Peatlands Soil | MRVQAQGRGHNGKKFKETCETLVVNGHGGLLLLKHEID |
| Ga0137392_110126582 | 3300011269 | Vadose Zone Soil | MRVQAQGRAHNRKKFKETCETVVVSGHGGLLLLKHEVADGEMLVITNP |
| Ga0137392_112167152 | 3300011269 | Vadose Zone Soil | MRVLAQGRAHNGKKFRETCETVVVNGHGGLLMLKHEVDNGEMLVI |
| Ga0137392_113538662 | 3300011269 | Vadose Zone Soil | MRVQAQGRAHNRKKFKETCETVVVSGHGGLLLLKHEVADGEMLVI |
| Ga0137389_102909301 | 3300012096 | Vadose Zone Soil | MKLQAHGRAHNGRKFRETCETVVVNAHGALILLKHEIDDGEMLVLTHPE |
| Ga0137389_116065221 | 3300012096 | Vadose Zone Soil | MRVQAQGRAHNRKKFKETCETVVVSGHGGLLLLKHEVADGE |
| Ga0137389_116291152 | 3300012096 | Vadose Zone Soil | MRVLAQGRAHNGKKFRETCETVVVNGHGGLLFLKHEIDTGEMLVI |
| Ga0137388_116683301 | 3300012189 | Vadose Zone Soil | MRLQAQGRAHNGRKFRETCETVVVNAHGALILLKHEIDDGEMLVL |
| Ga0137363_102376952 | 3300012202 | Vadose Zone Soil | MRVQAQGRAHNRKKFKETCETVVVSGHGGLLLLKH |
| Ga0137363_106228491 | 3300012202 | Vadose Zone Soil | MRVQAQGRAHNGKKFRETCETVVVNGHGGLLFLKHEIDTDEMLVI |
| Ga0137363_113601931 | 3300012202 | Vadose Zone Soil | MRVEAHGRAHNGKRFRETCETVVVSGHGGLLFLKHEIDNGEMLVIT |
| Ga0137363_114162892 | 3300012202 | Vadose Zone Soil | MRVQAQGRGHNGKKFRETCETVVVNGHGGLLMLKHEVDNGEMLVITNPETQEEQ |
| Ga0137399_101729221 | 3300012203 | Vadose Zone Soil | MRIQAQGRAHNGKKFRETCDTLVVNGFGGLLLLKHEVNN |
| Ga0137399_101799871 | 3300012203 | Vadose Zone Soil | MRVQAQGRGHNGKKFRETCETVVVNGHGGLLMLKHEVDNGEMLVITNPET |
| Ga0137399_107295871 | 3300012203 | Vadose Zone Soil | MRVEVQGRAHNRKKFKETCETVVVNGHGGLLMLKHEVDNGEMLVITNPETQEDQ |
| Ga0137362_100338771 | 3300012205 | Vadose Zone Soil | MRVEAHGRAHNGKRFRETCETVVVSGHGGLLFLKHEIDNGEML |
| Ga0137378_111452321 | 3300012210 | Vadose Zone Soil | MKIQAQGRGHNGKKFREVCETLVVSAYGGLLMLKHEVNKDE |
| Ga0137377_100389404 | 3300012211 | Vadose Zone Soil | MRVEVQGRAHNRKKFKETCETVVVNGHGGLLMLKHEVDNGEMLVITNP |
| Ga0137387_100061591 | 3300012349 | Vadose Zone Soil | MRVEVQGRAHNRKKFKETCETVVVNGHGGLLMLKHEVDNGEMLVITNPETQEEQ |
| Ga0137390_108310942 | 3300012363 | Vadose Zone Soil | MKLQAQGRAHNGRKFRETCETVVVNAHGALILLKHEIDDGEMLVLT |
| Ga0137358_100857775 | 3300012582 | Vadose Zone Soil | MRIQAQGRAHNGKKFRETCETVVVNGFGGLLLLKHEVNNGEMLVITNPETQEELECR |
| Ga0137358_101984711 | 3300012582 | Vadose Zone Soil | MPVKASGKDHNGKKFREACETVVVNVYGGLLLLKHEIKDGEMLVLENPATQEEQ |
| Ga0137358_104676951 | 3300012582 | Vadose Zone Soil | MRVLAQGRAHNGKKFRETCETVVVNGHGGLLFLKHE |
| Ga0137358_109702452 | 3300012582 | Vadose Zone Soil | MRLKAKGRAHDGRKFSETCETVVVNAHGALLLLKHEID |
| Ga0137398_102173403 | 3300012683 | Vadose Zone Soil | VQAQGRGHNGKKFRETCETLVVNGHGGLLLLKHEVDD |
| Ga0137397_100250921 | 3300012685 | Vadose Zone Soil | MRVLAQGRAHNGKKFRETCETVVVNGHGGLLFLKHEIDTGEMLVITNPE |
| Ga0137395_103380792 | 3300012917 | Vadose Zone Soil | MKLQAHGRAHNGRKFRETCETVVVNSHGALILLKHEIDDGEMLVLTHPET |
| Ga0137396_100130881 | 3300012918 | Vadose Zone Soil | MRVLAQGRAHNGKKFRETCETVVVNGHGGLLFLKHEIDHGEMIVITNPETLEELE |
| Ga0137396_105979212 | 3300012918 | Vadose Zone Soil | MRVLAQGRAHNGKKFRETCETVVVNGHGGLLFLKHEIDHGEMIVITNPETLE |
| Ga0137394_100400782 | 3300012922 | Vadose Zone Soil | MRVQAQGRGHNGKKFRETCETVVVNGQGGLLTLKHEVNNGEMLVIT |
| Ga0137419_104296241 | 3300012925 | Vadose Zone Soil | MKLQAHGRGHNGRKFRETCETLVVNSHGALILLKHEIDDG |
| Ga0137416_117337292 | 3300012927 | Vadose Zone Soil | MRVQAQGRGHNGKKFRETCETVVVNGQGGLLTLKHEVNNG |
| Ga0137407_110170391 | 3300012930 | Vadose Zone Soil | MRVLAQGRAHNGKKFRETCETVVVNGHGGLLFLKHEIDTGEMLVITNPETLEELECR |
| Ga0153915_106974192 | 3300012931 | Freshwater Wetlands | MRVQAQGRAHNGKKFKEACETVVVNAHGGLLMLKHEIDN |
| Ga0137410_100867933 | 3300012944 | Vadose Zone Soil | MRVRAQGRGHNGKKFRETCETLVVYGYGGLLLLKHEIDN |
| Ga0137410_101934572 | 3300012944 | Vadose Zone Soil | MRVHAQGRAHNGKKFRETCETVVVNGHGGLLFLKHEIDTGEMLVITNPETL |
| Ga0137420_14109045 | 3300015054 | Vadose Zone Soil | MRVQAQGRGHNGKKFRETCETLVVNGQGGLLTLEA* |
| Ga0137418_105385781 | 3300015241 | Vadose Zone Soil | MRIQAQGRAHNGKKFRETCETVVVNGFGGLLLLKHEVNNGEMLVITNPETQEELECRIV |
| Ga0137409_115614281 | 3300015245 | Vadose Zone Soil | MRVLAEGRAHNGKKFRETCETVVVNGHGGLLFLKHEIDTSEMLVITNP |
| Ga0187810_101738582 | 3300018012 | Freshwater Sediment | MRLQALGRSHEGRKFREICETLVVSAHGGLLNLKHEVDDGEML |
| Ga0187766_113214862 | 3300018058 | Tropical Peatland | MRLQAQGRGHNGKRFKESCETVVVNAHGGLLLLKHEIDNGEMLVLT |
| Ga0187770_112164112 | 3300018090 | Tropical Peatland | MRLQALGRSHEGRKFREICETLVVSAHGGLLNLQH |
| Ga0179590_10124811 | 3300020140 | Vadose Zone Soil | MKMQAQGRGHNGKKFREICETLVVSAYGGLLMLKHEVDKDELMVITNPETQE |
| Ga0179590_10464381 | 3300020140 | Vadose Zone Soil | MFHRMKLQALGRNHAGKKFREVCETLVVNSHGGLLMLKHEVDNDEMLVLVNPETQEEQ |
| Ga0210399_100657174 | 3300020581 | Soil | MFHRMKLQALGRNHAGKKFREVCETLVVNAHGGLLILR |
| Ga0179596_101818991 | 3300021086 | Vadose Zone Soil | MFHKMRVQAQGRAHNRKKFKETCETVVVSGHGGLLLLKHEVADG |
| Ga0210404_101353262 | 3300021088 | Soil | MKLQAQGRGHNRRKFRETCETVVVSAHGALILLKHEIDDGEMLVLTHPET |
| Ga0210404_101768371 | 3300021088 | Soil | MFHRMKLQALGRSHAGKKFREVCETLVVNAHGGLLMLKH |
| Ga0210404_109054012 | 3300021088 | Soil | MRVQAQGRGHNRKKFRETCETVVVSGHGGLLLLKHEVDDGEMLVITNPETQEE |
| Ga0210400_100967241 | 3300021170 | Soil | MFHRMKLQALGRNHAGKKFREVCETLVVNAHGGLLML |
| Ga0210400_103823532 | 3300021170 | Soil | MKLQAQGRGHNRRKFRETCETVVVSAHGALILLKHEIDDGEM |
| Ga0210405_110133521 | 3300021171 | Soil | MRLQAQGRAHNRKKFKETCETVVVNAHGGLLLLKHEVDNG |
| Ga0210397_102672601 | 3300021403 | Soil | MFHKMRMQAQGRAHNGKKFRETCETLVVNGHGGLLLLKHEIDDGAML |
| Ga0210391_103799601 | 3300021433 | Soil | MRVEAQGRAHNGKKFKEVCETVVVNAHGGLLMVKHEID |
| Ga0210402_107741453 | 3300021478 | Soil | MKLQALGRSHAGKKFREVCETLVVNSHGGLLMLKHEVDNDEMLVLVNPETQEEQE |
| Ga0210410_113960572 | 3300021479 | Soil | MFHKMRMLAQGRAHNGKKFRETCETLVVNGHGGLLILKHEIDDGAMLVLTHPDTLEEQ |
| Ga0179589_100288052 | 3300024288 | Vadose Zone Soil | MKMQAQGRGHNGKKFREICETLVVSAYGGLLMLKHEVDKDELMVITNPETQEEIE |
| Ga0179589_103466591 | 3300024288 | Vadose Zone Soil | MRVQAQGRGHNGKKFRETCETLVVNGHGGLLLLKHEVDDGVMLMITNP |
| Ga0209152_100835021 | 3300026325 | Soil | MRVEAQGRAHDRKKFKETCETVVVNAHGGLLLLKHEVNNGEMLV |
| Ga0257176_10563311 | 3300026361 | Soil | MRVQAQGRGHNGKKFRETCETVVVNGQGGLLTLKHEVNNGE |
| Ga0257169_10127422 | 3300026469 | Soil | MKIQAQGRGHNGKKFREVCETLVVSAYGGLLMLKHEVNKDELMVI |
| Ga0257172_11120852 | 3300026482 | Soil | MKLQAQGRAHNGRKFRETCETVVVNAHGALILLKHEI |
| Ga0179593_10074154 | 3300026555 | Vadose Zone Soil | MKIQAQGRGHNGKKFREVCETLVVSAYGGLLMLNMK |
| Ga0209331_10674141 | 3300027603 | Forest Soil | MFHKMRVQAQGRAHSGKKFRETCETLVVNGHGGLL |
| Ga0209422_10716701 | 3300027629 | Forest Soil | MFHKMRMQAQGRAHNGKKFRETCETLVVNGHGGLLILK |
| Ga0208990_10694752 | 3300027663 | Forest Soil | MFHKMRVQAQGRAHNGKKFRETCETLVVNGHGGLLILKHEIDDGAMLVLTHPET |
| Ga0209588_11468932 | 3300027671 | Vadose Zone Soil | MKLQAQGRGHDGRKFRETCETVVVNAHGALILLKH |
| Ga0209626_10420592 | 3300027684 | Forest Soil | MFHKMRMQAQGRAHNGKKFRETCETLVVNGHGGLLMLKHEIDDGAMLV |
| Ga0209038_100241952 | 3300027737 | Bog Forest Soil | MRVHAKGRGYRGKKFTETCETLVVNAHGGLLLLKQEVN |
| Ga0209167_102938631 | 3300027867 | Surface Soil | MRLQAKGRAHDGRKFKETCETVVVSAHGALVLLKHEIDTGETLVLVHPETLE |
| Ga0209526_101872012 | 3300028047 | Forest Soil | MRVLAQGRAHNGKKFRETCETVVVNGHGGLLFLKHEIDAGEMLVITNPETLEE |
| Ga0073994_100264031 | 3300030991 | Soil | MKIQAQGRGHNRKKFREICETLVVSVHGGLLMLKQEV |
| Ga0073994_123642301 | 3300030991 | Soil | MRVQAQGRGHNGKKFRETCETVVVNGHGGLLMIKHEVDNGEMLVITNPETQE |
| Ga0170823_112659044 | 3300031128 | Forest Soil | MFHRMKLQALGRNRAGKKFREVCETLVVNSHGGLLMLT |
| Ga0170823_169345301 | 3300031128 | Forest Soil | MFHKMRIQAHGRAHNGKKFRETCETLVVNGQGGLLILKHEI |
| Ga0170824_1242748051 | 3300031231 | Forest Soil | MFHRMRVQVQARGHNRKKFRETCETVVVNGHGGLLILKHE |
| Ga0318560_107852581 | 3300031682 | Soil | MFHRMRLQALGRSHDGRKFREVCETLVVGAHGGLLMLK |
| Ga0307473_111651891 | 3300031820 | Hardwood Forest Soil | MRVLAQGRAHNGKKFRETCETVVVNGHGGLLFLKHEIDNGEML |
| Ga0310910_101592101 | 3300031946 | Soil | MRLQAQGRAHNGRKFREVCETMVVNAHGGLLVLQHEVDNGEL |
| Ga0307479_120917241 | 3300031962 | Hardwood Forest Soil | MRLQAQGRARDRKKFKETCETVVVNAHGGLLLLKHE |
| Ga0307471_1014735351 | 3300032180 | Hardwood Forest Soil | MRVLAQGRAHNGKKFRETCETVVVNGHGGLLFLKHEIDT |
| Ga0307471_1018333042 | 3300032180 | Hardwood Forest Soil | MRVLAQGRAHNGKKFRETCETVVVNGHGGLLFLKHEIDTGEMLAITNPETLEELECR |
| ⦗Top⦘ |