| Basic Information | |
|---|---|
| Family ID | F092775 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 42 residues |
| Representative Sequence | HYPIPSSSGDSSGVPQRRQITAEQSPQVRGSVTSSAQFGQ |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 8.41 % |
| % of genes near scaffold ends (potentially truncated) | 85.05 % |
| % of genes from short scaffolds (< 2000 bps) | 81.31 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.262 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.215 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.430 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.748 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF08241 | Methyltransf_11 | 26.17 |
| PF13520 | AA_permease_2 | 7.48 |
| PF13847 | Methyltransf_31 | 6.54 |
| PF13649 | Methyltransf_25 | 4.67 |
| PF13349 | DUF4097 | 2.80 |
| PF13470 | PIN_3 | 1.87 |
| PF00795 | CN_hydrolase | 1.87 |
| PF13180 | PDZ_2 | 1.87 |
| PF01740 | STAS | 1.87 |
| PF06537 | DHOR | 0.93 |
| PF04397 | LytTR | 0.93 |
| PF03471 | CorC_HlyC | 0.93 |
| PF03446 | NAD_binding_2 | 0.93 |
| PF01135 | PCMT | 0.93 |
| PF13650 | Asp_protease_2 | 0.93 |
| PF07676 | PD40 | 0.93 |
| PF13450 | NAD_binding_8 | 0.93 |
| PF05534 | HicB | 0.93 |
| PF00551 | Formyl_trans_N | 0.93 |
| PF13932 | GIDA_C | 0.93 |
| PF12697 | Abhydrolase_6 | 0.93 |
| PF04264 | YceI | 0.93 |
| PF08669 | GCV_T_C | 0.93 |
| PF13507 | GATase_5 | 0.93 |
| PF13545 | HTH_Crp_2 | 0.93 |
| PF16576 | HlyD_D23 | 0.93 |
| PF07228 | SpoIIE | 0.93 |
| PF13489 | Methyltransf_23 | 0.93 |
| PF05222 | AlaDh_PNT_N | 0.93 |
| PF00149 | Metallophos | 0.93 |
| PF00196 | GerE | 0.93 |
| PF00106 | adh_short | 0.93 |
| PF00072 | Response_reg | 0.93 |
| PF12847 | Methyltransf_18 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG1598 | Antitoxin component HicB of the HicAB toxin-antitoxin system | Defense mechanisms [V] | 0.93 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.93 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.93 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.93 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG4226 | Predicted nuclease of the RNAse H fold, HicB family | General function prediction only [R] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.26 % |
| Unclassified | root | N/A | 3.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000546|LJNas_1000220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9772 | Open in IMG/M |
| 3300001175|JGI12649J13570_1030412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300001593|JGI12635J15846_10169873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1474 | Open in IMG/M |
| 3300001593|JGI12635J15846_10853916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100291934 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300004091|Ga0062387_100220001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1163 | Open in IMG/M |
| 3300004633|Ga0066395_10244173 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300005167|Ga0066672_10671436 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005187|Ga0066675_11163395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 574 | Open in IMG/M |
| 3300005332|Ga0066388_102422858 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300005435|Ga0070714_100160719 | All Organisms → cellular organisms → Bacteria | 2032 | Open in IMG/M |
| 3300005437|Ga0070710_10663909 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300005536|Ga0070697_100089624 | All Organisms → cellular organisms → Bacteria | 2541 | Open in IMG/M |
| 3300005538|Ga0070731_10505461 | Not Available | 805 | Open in IMG/M |
| 3300005541|Ga0070733_10497094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
| 3300005542|Ga0070732_10250647 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300005542|Ga0070732_10318224 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300005542|Ga0070732_10597422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 670 | Open in IMG/M |
| 3300005557|Ga0066704_10109663 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
| 3300005591|Ga0070761_10589351 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300005764|Ga0066903_101358517 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300005898|Ga0075276_10036023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1037 | Open in IMG/M |
| 3300005901|Ga0075274_1014285 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300005904|Ga0075280_10124066 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005994|Ga0066789_10067974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1545 | Open in IMG/M |
| 3300005995|Ga0066790_10208177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| 3300006028|Ga0070717_10099066 | All Organisms → cellular organisms → Bacteria | 2472 | Open in IMG/M |
| 3300006028|Ga0070717_11496426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 612 | Open in IMG/M |
| 3300006052|Ga0075029_101024634 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300006163|Ga0070715_10642258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300006797|Ga0066659_10225637 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300006804|Ga0079221_10402974 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300006893|Ga0073928_10306760 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300009137|Ga0066709_100640420 | All Organisms → cellular organisms → Bacteria | 1520 | Open in IMG/M |
| 3300009637|Ga0116118_1257164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300009700|Ga0116217_10633247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 664 | Open in IMG/M |
| 3300009700|Ga0116217_10739072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300009764|Ga0116134_1050743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1586 | Open in IMG/M |
| 3300009824|Ga0116219_10616196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300010341|Ga0074045_10014638 | All Organisms → cellular organisms → Bacteria | 6350 | Open in IMG/M |
| 3300010343|Ga0074044_10410283 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300010358|Ga0126370_12288508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 534 | Open in IMG/M |
| 3300011120|Ga0150983_12713543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1100 | Open in IMG/M |
| 3300012363|Ga0137390_10151601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2302 | Open in IMG/M |
| 3300012931|Ga0153915_10027250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5697 | Open in IMG/M |
| 3300012971|Ga0126369_12789524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300013832|Ga0120132_1119976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300014200|Ga0181526_10400072 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300014493|Ga0182016_10242907 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300014501|Ga0182024_11124327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 925 | Open in IMG/M |
| 3300015372|Ga0132256_102039809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300016319|Ga0182033_11675269 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300017946|Ga0187879_10027016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3500 | Open in IMG/M |
| 3300017947|Ga0187785_10178655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 910 | Open in IMG/M |
| 3300017973|Ga0187780_11032758 | Not Available | 600 | Open in IMG/M |
| 3300018017|Ga0187872_10205841 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300018044|Ga0187890_10128834 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300018086|Ga0187769_10117584 | All Organisms → cellular organisms → Bacteria | 1924 | Open in IMG/M |
| 3300019789|Ga0137408_1064818 | All Organisms → cellular organisms → Bacteria | 7722 | Open in IMG/M |
| 3300020010|Ga0193749_1001019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4998 | Open in IMG/M |
| 3300020579|Ga0210407_10439194 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300020580|Ga0210403_10043909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3572 | Open in IMG/M |
| 3300020580|Ga0210403_11066913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300020582|Ga0210395_10735788 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300021170|Ga0210400_10015891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5934 | Open in IMG/M |
| 3300021170|Ga0210400_10319030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1277 | Open in IMG/M |
| 3300021178|Ga0210408_10386417 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300021405|Ga0210387_10108530 | All Organisms → cellular organisms → Bacteria | 2330 | Open in IMG/M |
| 3300021407|Ga0210383_10679501 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300021478|Ga0210402_10771358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium | 886 | Open in IMG/M |
| 3300021479|Ga0210410_11108161 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300022557|Ga0212123_10260230 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300025916|Ga0207663_10394953 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300025922|Ga0207646_10424823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1200 | Open in IMG/M |
| 3300026317|Ga0209154_1312261 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300026360|Ga0257173_1013077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 973 | Open in IMG/M |
| 3300026532|Ga0209160_1047235 | All Organisms → cellular organisms → Bacteria | 2527 | Open in IMG/M |
| 3300027565|Ga0209219_1142609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300027587|Ga0209220_1068194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 944 | Open in IMG/M |
| 3300027648|Ga0209420_1186645 | Not Available | 555 | Open in IMG/M |
| 3300027674|Ga0209118_1161503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300027701|Ga0209447_10209712 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300027729|Ga0209248_10076657 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300027842|Ga0209580_10346890 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300027855|Ga0209693_10217566 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300027867|Ga0209167_10652576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300027903|Ga0209488_10659576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300027905|Ga0209415_10224242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1734 | Open in IMG/M |
| 3300027905|Ga0209415_10626351 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300029999|Ga0311339_11208560 | Not Available | 692 | Open in IMG/M |
| 3300031236|Ga0302324_100578104 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
| 3300031469|Ga0170819_17412742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300031525|Ga0302326_10010698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 19866 | Open in IMG/M |
| 3300031708|Ga0310686_104159233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1945 | Open in IMG/M |
| 3300031708|Ga0310686_115238525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300031716|Ga0310813_11164554 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300031718|Ga0307474_10106375 | All Organisms → cellular organisms → Bacteria | 2100 | Open in IMG/M |
| 3300031718|Ga0307474_11591324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300031754|Ga0307475_10034255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3715 | Open in IMG/M |
| 3300031823|Ga0307478_10778055 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300031962|Ga0307479_11740800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300032160|Ga0311301_11482158 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300032783|Ga0335079_10048696 | All Organisms → cellular organisms → Bacteria | 4856 | Open in IMG/M |
| 3300032805|Ga0335078_10000023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 306151 | Open in IMG/M |
| 3300032829|Ga0335070_10000085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 102254 | Open in IMG/M |
| 3300033807|Ga0314866_108012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300033977|Ga0314861_0495055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.21% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.41% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 6.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.54% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.74% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.80% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.80% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.80% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.87% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.87% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.87% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.87% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.93% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.93% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300001175 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005898 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 | Environmental | Open in IMG/M |
| 3300005901 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 | Environmental | Open in IMG/M |
| 3300005904 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LJNas_100022010 | 3300000546 | Quercus Rhizosphere | GVEFIYPIPSSSEDSSAVPQRRQITDEQSPQVKGSFTSSAQFGQ* |
| JGI12649J13570_10304122 | 3300001175 | Forest Soil | LALHPMANSSEDSSGVPQRRQITEEQSPQVSGSLTSAAHTGQ* |
| JGI12635J15846_101698731 | 3300001593 | Forest Soil | ERSIGGRSGHPMPNSSDVSSGVPQRRHMTDEQSPQVSGSITSAAQTGQ* |
| JGI12635J15846_108539161 | 3300001593 | Forest Soil | NSSEDSRGVPQRRQITAEQSPQVSGSLTSXAQTGQ* |
| JGIcombinedJ26739_1002919341 | 3300002245 | Forest Soil | IPSSSDDSRAVPQRLQITEEQSPQVRGSVTSSAQLGQ* |
| Ga0062387_1002200011 | 3300004091 | Bog Forest Soil | HQPIPSSSGDSSGVPQRRQMMEEQSPQVSGSFTSLAQFGQ* |
| Ga0066395_102441731 | 3300004633 | Tropical Forest Soil | HYPIPSSSGDSSGVPQRRQITAEQSPQVRGSVTSSAQFGQ* |
| Ga0066672_106714361 | 3300005167 | Soil | PYPIPSSSGDSSGVPQRRQMTAEQSPQVRGSVISSPQVGQ* |
| Ga0066675_111633952 | 3300005187 | Soil | IINYPMPKSAEDSRGVPQTRQITEEQSPQISGSETSRAQLGQ* |
| Ga0066388_1024228581 | 3300005332 | Tropical Forest Soil | YPIPRSEDDSSGVPQTRQITAEQSPQVSGSVTSRAQLGQ* |
| Ga0070714_1001607193 | 3300005435 | Agricultural Soil | LGEFIRYPIPSSSGDSNGEPQTRQMTAAQSPQVSGSVTSRAHCGQ* |
| Ga0070710_106639092 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | FRCGSLSGSVHYPIPSSSEDSKAVPHRRQMTEEQSPQVKGSFTSSAQFGQ* |
| Ga0070697_1000896241 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | ETVGTLIPYPIPSSSGDSSGVPQRRQMTAEQSPQVRGSVISSPQVGQ* |
| Ga0070731_105054612 | 3300005538 | Surface Soil | THPIPKSAADSSGVPQTRQITAEQSPQVRGSFTSRAQFGQ* |
| Ga0070733_104970941 | 3300005541 | Surface Soil | FMDYPMPNSSGDSRGVPQTRQITAEQSPQVSGSVTSRAQLGQ* |
| Ga0070732_102506472 | 3300005542 | Surface Soil | ATLGEFIRYPIPSSSGDSNGEPQTRQMTAAQSPQVSGSVTSRAHCGQ* |
| Ga0070732_103182242 | 3300005542 | Surface Soil | AVSFNWANAGVFMDYPIPSSSGDSSGVPQRRQMTAEQSPQIRGSATSMAHFGQ* |
| Ga0070732_105974221 | 3300005542 | Surface Soil | PGRGFMNYPMPSSSGDSRGVPQTRQMTAEQSPQLSGSVTSRAQLGQ* |
| Ga0066704_101096631 | 3300005557 | Soil | AGCETVGTLIPYPIPSSSGDSSGVPQRRQMTAEQSPQVRGSVISSPQVGQ* |
| Ga0070761_105893512 | 3300005591 | Soil | TGISMNHPIPNSSADSSGVPQRRQMTAEQSPHVRGSETSTAHFGQ* |
| Ga0066903_1013585173 | 3300005764 | Tropical Forest Soil | SSSGDSSGVPQRRHITAEQSPQINGSVTSSAQLGQ* |
| Ga0075276_100360232 | 3300005898 | Rice Paddy Soil | SSGDSSGVPQTRQMTAEQSPQVRGSVTSREQLGQ* |
| Ga0075274_10142852 | 3300005901 | Rice Paddy Soil | LDWRHPGAVHQPIPSSSGDSSGVPQIRQITAEQSPQVSGSLTSCAHWGQ* |
| Ga0075280_101240662 | 3300005904 | Rice Paddy Soil | GFRGLLSSLDWRHPGAVHQPIPSSSGDSSGVPQIRQITAEQSPQVSGSLTSCAHWGQ* |
| Ga0066789_100679742 | 3300005994 | Soil | MPSSSDDSSAVPQRRQITEEQSPHVSGSVTSSAQFGQ* |
| Ga0066790_102081771 | 3300005995 | Soil | VFYPIANSSEFSNGVPQRRQITDEQSPQVSGSLTS |
| Ga0070717_100990662 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRSAEDSSGVPQTRQITAEQSPQVSGSVISRAQLGQ* |
| Ga0070717_114964261 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RSEEDSSGVPQTRQITAEQSPQVSGSVISRAQFGQ* |
| Ga0075029_1010246342 | 3300006052 | Watersheds | HYPMPSSSDDSSAVPQRRQITEEQSPQVSGSVTSSAQFGQ* |
| Ga0070715_106422582 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | RQPMPSSSAASTGVPQRRQINAPQSPQVSGSETATAHFAQ* |
| Ga0066659_102256373 | 3300006797 | Soil | AGCETVGTLIPYPIPSSSGDSSGVPQRRQMTAEQSPQVSGSVISSPQVGQ* |
| Ga0079221_104029741 | 3300006804 | Agricultural Soil | GEFIDYPIPSSSGDSSGVPHRGQITDPQSPQVNGSGTSWAQLGQ* |
| Ga0073928_103067601 | 3300006893 | Iron-Sulfur Acid Spring | SSSGDSSGVPQLRQMTAEQSPQVRGSFTSLAQFGQ* |
| Ga0066709_1006404203 | 3300009137 | Grasslands Soil | AMVLLLLLSYPIPRSPADSSGVPHTRQITAEQSPQVNGSITSFAQLGQ* |
| Ga0116118_12571642 | 3300009637 | Peatland | MPNSSEDSSGVPQRRQMTAEQSPQVSGSLTSTAQIGQ* |
| Ga0116217_106332471 | 3300009700 | Peatlands Soil | SSSGDSSGVPQRRQMTAEQSPHVRGSFTSSAQFGQ* |
| Ga0116217_107390721 | 3300009700 | Peatlands Soil | IPSSSGFSSGVPQRRQITAEQSPQVNGSLASWAQFGQ* |
| Ga0116134_10507432 | 3300009764 | Peatland | MPNSSEDSNGVPQRRQMTAEQSPQVNGSLTSTAQTGQ* |
| Ga0116219_106161962 | 3300009824 | Peatlands Soil | HPMPNSSEDSSGVPQRRQMTAEQSPQVSGSLTSTAQTGQ* |
| Ga0074045_100146385 | 3300010341 | Bog Forest Soil | MPSSSGDSSGVPQRRQMTAEQSPQVSGSLTSTAQIGQ* |
| Ga0074044_104102832 | 3300010343 | Bog Forest Soil | LHQPIPSSSGDSSGVPQRRQMMEEQSPQVSGSFTSLAQFGQ* |
| Ga0126370_122885082 | 3300010358 | Tropical Forest Soil | PSSSGDSSGVPHFRQMTDEQSPQVSGSVTSSAQLGQ* |
| Ga0150983_127135431 | 3300011120 | Forest Soil | IPSSSGDSSGVPQRLQITAEQSPQVSGSVTSSAQFGQ* |
| Ga0137390_101516011 | 3300012363 | Vadose Zone Soil | SSEDSSGFPQRRQITAEQSPQVSGSLTSTAQTGQ* |
| Ga0153915_100272506 | 3300012931 | Freshwater Wetlands | MPRSAADSNGVPHARQITAEQSPHVSGSVTSTAQAGQ* |
| Ga0126369_127895242 | 3300012971 | Tropical Forest Soil | FHYPIPSSSGDSSGVPQRRHITAEQSPQINGSVTSSAQLGQ* |
| Ga0120132_11199762 | 3300013832 | Permafrost | LHPIPSSLADSSGLPHCRQITAEQSPQVSGSGTATAHSGQ* |
| Ga0181526_104000722 | 3300014200 | Bog | KPSDGGVRHPIPNSSGDSSGVPQRRQITAEQSPQVSGSFTSLAQFGQ* |
| Ga0182016_102429071 | 3300014493 | Bog | GFGRQPMPRTSGISSGVPQTRQITAEQSPQVSGSSTSRAQTGQ* |
| Ga0182024_111243271 | 3300014501 | Permafrost | DRHYPIPSSSDDSRAVPQRLQITEEQSPQVRGSVTSSAQLGQ* |
| Ga0132256_1020398091 | 3300015372 | Arabidopsis Rhizosphere | ETEDEDMSYPMPSSSGDSSGVPHRRQITAAQSPQVRGSVTSSAHCGQ* |
| Ga0182033_116752691 | 3300016319 | Soil | RSSGISSGVPQMRQMTAEQSPQVSGSSTSRAQLGQ |
| Ga0187879_100270163 | 3300017946 | Peatland | MPNSSEDSSGVPQRRQMTAEQSPQVSGSLTSTAQIGQ |
| Ga0187785_101786551 | 3300017947 | Tropical Peatland | MGYPIPNSSGDSSGVPQRRQMMAEQSPQMSGSGTSVAQRG |
| Ga0187780_110327582 | 3300017973 | Tropical Peatland | VAGVTDEVVMSYPIPNSSGDSSGVPQRRQMMAEQSPQMSGSATSVAQRGQ |
| Ga0187872_102058412 | 3300018017 | Peatland | GFDVGRRGGGVHYPIPSSSGDSSGVPQRRQMTAEQSPQVRGSFTSWAQIGQ |
| Ga0187890_101288341 | 3300018044 | Peatland | RYPMPRSSGISSGVPQTRQITAEQSPQVSGSSTSRAQTGQ |
| Ga0187769_101175841 | 3300018086 | Tropical Peatland | YPIPSSSGDSSGVPQRRQIPAEQSPQVSGSVTSAAHLGQ |
| Ga0137408_106481811 | 3300019789 | Vadose Zone Soil | IPKSEEDSSGVPQTRQMTAEQSPQVSGSGTSRTQFGQ |
| Ga0193749_10010191 | 3300020010 | Soil | MRRDYPIPNSSAASSGVPQFRQMTAPQSPQVSGSETSTAHFGQ |
| Ga0210407_104391942 | 3300020579 | Soil | MAYPIPNSPADSSGVPQRRQMMAEQSPQHSGSETSAAHFGQ |
| Ga0210403_100439091 | 3300020580 | Soil | MDHPIPSSSADSTGVPQRRQMTAEQSPQVSGSETSTAHF |
| Ga0210403_110669131 | 3300020580 | Soil | FDGGCDGRFHYPIPSSSLDSSGVPHRRQMTAEQSPQVSGSVTSSAQLGQ |
| Ga0210395_107357881 | 3300020582 | Soil | DWDVHLHQSPIPNSSDDSSGVPQRRQMTAEQSPQVSGSEASAAHFGQ |
| Ga0210400_100158919 | 3300021170 | Soil | RGIHYPIPSSSADSSGVPHRRQMTAEQSPQVSGSVTSLAQVGQ |
| Ga0210400_103190301 | 3300021170 | Soil | RRVVIRQNRDGLHYPIPSSSEDSSAVPQRRQITEEQSPQVSGSVTSSAQFGQ |
| Ga0210408_103864172 | 3300021178 | Soil | MVYPIPNSSADSSGVPQRRQMMAEQSPQDSGSETSAAHFGQ |
| Ga0210387_101085301 | 3300021405 | Soil | IPSSSADSSGVPHRRQMTAEQSPQVSGSVTSLAQVGQ |
| Ga0210383_106795011 | 3300021407 | Soil | SSSGDSSGVPQRRQITEEQSPQVSGSLISSAQFGQ |
| Ga0210402_107713581 | 3300021478 | Soil | GGIHYPIPSSSGDSSGVPQRRQITEEQSPQVIGSLTSSAQLGQ |
| Ga0210410_111081611 | 3300021479 | Soil | MNYPIPNSSDDSSALPQRRQMTAEQSPQVSGSETSTAHFGQ |
| Ga0212123_102602301 | 3300022557 | Iron-Sulfur Acid Spring | GVHYPIPSSSGDSSGVPQRRQITEEQSPQVSGSLTSSAQFGQ |
| Ga0207663_103949531 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ERSTHPMPRSAEDSSGVPQTRQITAEQSPQVRGSVIWRAQLGQ |
| Ga0207646_104248233 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | NSSDDSSGVPQRRQITAEQSPQVSGSLTSTAQTGQ |
| Ga0209154_13122611 | 3300026317 | Soil | GRGIHHPIPSSSGDSSGVPQRRQITDEQSPQVSGSLTSSAQFGQ |
| Ga0257173_10130771 | 3300026360 | Soil | NSSEDSSGVPQRRQITAEQSPQVSGSLTSTAQTGQ |
| Ga0209160_10472351 | 3300026532 | Soil | ESSAVVAAGCETVGTLIPYPIPSSSGDSSGVPQRRQMTAEQSPQVRGSVISSPQVGQ |
| Ga0209219_11426091 | 3300027565 | Forest Soil | MPSSSDDSNAVPHRRQITEEQSPQVSGSVTSSAQFG |
| Ga0209220_10681941 | 3300027587 | Forest Soil | REGDSLSSQSVLHPIPNSSEDSSGVPQRRQMTAEQSPQVRGSLTSTAQTGQ |
| Ga0209420_11866451 | 3300027648 | Forest Soil | GGGGGYRVHYPIPSSSEDSSGVPQRRQITEEQSPQVSGSVTSSAQFGQ |
| Ga0209118_11615031 | 3300027674 | Forest Soil | PMPSSSDDSNAVPHRRQITEEQSPQVSGSVTSSAQFGQ |
| Ga0209447_102097121 | 3300027701 | Bog Forest Soil | FHYPIPSSSEDSSAVPQRRHITDEQSPQVSGSFTSSPQFGQ |
| Ga0209248_100766572 | 3300027729 | Bog Forest Soil | PSSSADSSGVPQRRQMIEEQSPQVSGSFTSLAQFGQ |
| Ga0209580_103468901 | 3300027842 | Surface Soil | YPIPSSSGDSSGVPQRRQITAEQSPQVSGSETSWAQLGQ |
| Ga0209693_102175662 | 3300027855 | Soil | GGRGVHYPIPSSSGDSSGVPQRRQITEEQSPQLSGSLTSSAQFGQ |
| Ga0209167_106525761 | 3300027867 | Surface Soil | FMDYPMPNSSGDSRGVPQTRQITAEQSPQVSGSVTSRAQLGQ |
| Ga0209488_106595761 | 3300027903 | Vadose Zone Soil | DWGSDRPVFHPIASSSEDSSGVPQRRQMTAEQSPQVSGSLTGMAQTGQ |
| Ga0209415_102242421 | 3300027905 | Peatlands Soil | FHYPIPSSSGDSSGVPQRRQITAEQSRQIKGSFTSSAQLGQ |
| Ga0209415_106263512 | 3300027905 | Peatlands Soil | GIHQPIPSSSDDSNAVPQRRQITDEQSPQVSGSVTSSAQFGQ |
| Ga0311339_112085601 | 3300029999 | Palsa | YWVHYPIPSSSEDSSGVPQRRQITEEQSPQVSGSVTSSAQFGQ |
| Ga0302324_1005781041 | 3300031236 | Palsa | GLFGGWRGGVHYPIPSSSGDSSGVPQRRQMTAEQSPQVRGSVTSSAQFGQ |
| Ga0170819_174127421 | 3300031469 | Forest Soil | RPIFHPIASSSEDSSGVPQRRQMTAEQSPQVSGSLTGMAQTGQ |
| Ga0302326_1001069819 | 3300031525 | Palsa | MPSSSDDSSAVPQRRQITEEQSPQVSGSVTSSAQFGQ |
| Ga0310686_1041592332 | 3300031708 | Soil | MPSSSEDSSGVPQRLQMMEEQSPQVSGSFTSLAQFGQ |
| Ga0310686_1152385251 | 3300031708 | Soil | SGVHYPIPSSSGDSSGVPQRRQITEEQSPQVSGSFTSSAQFGQ |
| Ga0310813_111645541 | 3300031716 | Soil | SYPIPRSEEDSSGVPQTRQITAEQSPQVSGSAISRAQLGQ |
| Ga0307474_101063754 | 3300031718 | Hardwood Forest Soil | SVRDRWNNDGLHYPIPSSSEDSKGVPQRRQMTDEQSPQVSGSFTSSAHVGQ |
| Ga0307474_115913242 | 3300031718 | Hardwood Forest Soil | IGGKSRDGFHYPIPSSSEDSSAVPQRRQMTEEQSPQVSGSVTSSAQLGQ |
| Ga0307475_100342551 | 3300031754 | Hardwood Forest Soil | RVVIRQNRDGLHYPIPSSSEDSSAVPQRRQITEEQSPQVSGSVTSSAQFGQ |
| Ga0307478_107780551 | 3300031823 | Hardwood Forest Soil | PAGVRVHHPIPSSSDDSRAVPQRRQITDEQSPQVSGSVTSSAQFGQ |
| Ga0307479_117408001 | 3300031962 | Hardwood Forest Soil | TGTGSIYPIPSSSDDSSAVPQRRQITDEQSPQVSGSVTSSAQFGQ |
| Ga0311301_114821581 | 3300032160 | Peatlands Soil | DYPIPNSSGDSSGVPQRRQITAEQSPQVSGSVTSAAHLGQ |
| Ga0335079_100486962 | 3300032783 | Soil | MAHPIPNSSGDSSGVPQRRQITAEQSPQISGSATSAAHLGQ |
| Ga0335078_1000002380 | 3300032805 | Soil | MAQPIPNSSGDSSGVPQRRQMMAEQSPQVRGSATSMAQVGQ |
| Ga0335070_1000008536 | 3300032829 | Soil | MRYPIPSSSGDSSGVPQRRQITAEQSPQVSGSVTSSAQLGQ |
| Ga0314866_108012_389_505 | 3300033807 | Peatland | MASSSEDSSGVPQLRQMTAEQSPQVNGSVTSFAHTGQYN |
| Ga0314861_0495055_95_208 | 3300033977 | Peatland | MPSSSGFSSGVPQRRQMTEEQSPQISGSATSWAQLGQ |
| ⦗Top⦘ |