Metagenome Family F092771

Basic Information
Family ID	F092771
Family Type	Metagenome
Number of Sequences	107
Average Sequence Length	36 residues
Representative Sequence	MVNPTSLLFGGRPTARKADEMRGNGTLEKANAVL
Number of Associated Samples	89
Number of Associated Scaffolds	107

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	67.92 %
% of genes near scaffold ends (potentially truncated)	20.56 %
% of genes from short scaffolds (< 2000 bps)	92.52 %
Associated GOLD sequencing projects	88
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.18

Most Common Taxonomy
Group	Unclassified (59.813 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.280 % of family members)
Environment Ontology (ENVO)	Unclassified (44.860 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (44.860 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 22.58% β-sheet: 0.00% Coil/Unstructured: 77.42%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 107 Family Scaffolds
PF13655	RVT_N	34.58
PF13432	TPR_16	0.93
PF04191	PEMT	0.93
PF00400	WD40	0.93
PF09982	DUF2219	0.93
PF13683	rve_3	0.93

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.81 %
All Organisms	root	All Organisms	40.19 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.81 %
cellular organisms	root	All Organisms → cellular organisms	40.19 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.81 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	40.19 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.81 %
Spirochaetes	phylum	All Organisms → cellular organisms → Bacteria → Spirochaetes	14.95 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	1.87 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	1.87 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.87 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.81 %
unclassified Spirochaetota	no rank	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota	14.95 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	1.87 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.87 %
Verrucomicrobia	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.81 %
Spirochaetes bacterium ADurb.Bin001	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001	14.95 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	1.87 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.87 %
unclassified Verrucomicrobia	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.81 %
Spirochaetes bacterium ADurb.Bin001	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001	14.95 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1.87 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.87 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.81 %
Spirochaetes bacterium ADurb.Bin001	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001	14.95 %
Acidisarcina	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina	1.87 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.87 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.93 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	59.81 %
Spirochaetes bacterium ADurb.Bin001	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001	14.95 %
Acidisarcina polymorpha	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha	1.87 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.87 %
Verrucomicrobia bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	0.93 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000559\|F14TC_100288251	All Organisms → cellular organisms → Bacteria	2009	Open in IMG/M
3300004152\|Ga0062386_101696432	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha	527	Open in IMG/M
3300005526\|Ga0073909_10601354	All Organisms → cellular organisms → Bacteria	543	Open in IMG/M
3300005564\|Ga0070664_101728584	Not Available	593	Open in IMG/M
3300005577\|Ga0068857_100202223	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha	1811	Open in IMG/M
3300005577\|Ga0068857_100501145	Not Available	1140	Open in IMG/M
3300005577\|Ga0068857_101190627	All Organisms → cellular organisms → Bacteria	737	Open in IMG/M
3300005578\|Ga0068854_101464762	Not Available	619	Open in IMG/M
3300005591\|Ga0070761_10250291	Not Available	1059	Open in IMG/M
3300005616\|Ga0068852_102394343	Not Available	549	Open in IMG/M
3300005617\|Ga0068859_100974375	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001	931	Open in IMG/M
3300005617\|Ga0068859_101570680	Not Available	726	Open in IMG/M
3300005713\|Ga0066905_100525493	Not Available	989	Open in IMG/M
3300005718\|Ga0068866_11355195	Not Available	519	Open in IMG/M
3300005719\|Ga0068861_102480793	Not Available	522	Open in IMG/M
3300005827\|Ga0074478_1855131	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001	528	Open in IMG/M
3300005834\|Ga0068851_10744430	All Organisms → cellular organisms → Bacteria	606	Open in IMG/M
3300006163\|Ga0070715_10700959	Not Available	605	Open in IMG/M
3300006358\|Ga0068871_100546469	All Organisms → cellular organisms → Bacteria	1049	Open in IMG/M
3300006844\|Ga0075428_100344893	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001	1599	Open in IMG/M
3300006845\|Ga0075421_102420727	Not Available	549	Open in IMG/M
3300006894\|Ga0079215_10231408	Not Available	963	Open in IMG/M
3300006904\|Ga0075424_102259275	Not Available	572	Open in IMG/M
3300006969\|Ga0075419_10333042	Not Available	1029	Open in IMG/M
3300006969\|Ga0075419_10744449	Not Available	698	Open in IMG/M
3300006969\|Ga0075419_10932895	Not Available	628	Open in IMG/M
3300009053\|Ga0105095_10251800	All Organisms → cellular organisms → Bacteria	969	Open in IMG/M
3300009088\|Ga0099830_11209205	All Organisms → cellular organisms → Bacteria	627	Open in IMG/M
3300009101\|Ga0105247_10976717	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001	660	Open in IMG/M
3300009101\|Ga0105247_11261913	Not Available	591	Open in IMG/M
3300009111\|Ga0115026_10316114	All Organisms → cellular organisms → Bacteria	1099	Open in IMG/M
3300009137\|Ga0066709_100562678	All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	1617	Open in IMG/M
3300009148\|Ga0105243_11226757	Not Available	764	Open in IMG/M
3300009148\|Ga0105243_11495062	Not Available	699	Open in IMG/M
3300009156\|Ga0111538_10937936	All Organisms → cellular organisms → Bacteria → PVC group	1095	Open in IMG/M
3300009162\|Ga0075423_11715357	Not Available	676	Open in IMG/M
3300009506\|Ga0118657_10299541	All Organisms → cellular organisms → Bacteria	2164	Open in IMG/M
3300009548\|Ga0116107_1140522	Not Available	674	Open in IMG/M
3300009551\|Ga0105238_10293592	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001	1608	Open in IMG/M
3300009553\|Ga0105249_11081308	Not Available	872	Open in IMG/M
3300009624\|Ga0116105_1069913	Not Available	837	Open in IMG/M
3300009678\|Ga0105252_10390226	Not Available	636	Open in IMG/M
3300010047\|Ga0126382_10638753	Not Available	883	Open in IMG/M
3300010336\|Ga0134071_10532731	Not Available	609	Open in IMG/M
3300010359\|Ga0126376_11576956	All Organisms → cellular organisms → Bacteria	688	Open in IMG/M
3300010359\|Ga0126376_12361167	Not Available	578	Open in IMG/M
3300010362\|Ga0126377_10853907	Not Available	971	Open in IMG/M
3300010362\|Ga0126377_12245668	Not Available	622	Open in IMG/M
3300010375\|Ga0105239_12215785	All Organisms → cellular organisms → Bacteria	639	Open in IMG/M
3300010392\|Ga0118731_112375749	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001	1436	Open in IMG/M
3300010399\|Ga0134127_10001955	All Organisms → cellular organisms → Bacteria	15039	Open in IMG/M
3300010399\|Ga0134127_11165132	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001	836	Open in IMG/M
3300010400\|Ga0134122_11944914	Not Available	625	Open in IMG/M
3300010401\|Ga0134121_10464433	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001	1158	Open in IMG/M
3300011120\|Ga0150983_10626969	Not Available	750	Open in IMG/M
3300011120\|Ga0150983_10925859	Not Available	745	Open in IMG/M
3300011120\|Ga0150983_15755434	Not Available	568	Open in IMG/M
3300011417\|Ga0137326_1079941	Not Available	734	Open in IMG/M
3300011440\|Ga0137433_1002670	All Organisms → cellular organisms → Bacteria	6665	Open in IMG/M
3300011440\|Ga0137433_1011156	All Organisms → cellular organisms → Bacteria	2672	Open in IMG/M
3300011440\|Ga0137433_1014539	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001	2298	Open in IMG/M
3300012113\|Ga0137328_1022419	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001	613	Open in IMG/M
3300012166\|Ga0137350_1088564	Not Available	626	Open in IMG/M
3300012205\|Ga0137362_11082295	Not Available	681	Open in IMG/M
3300012206\|Ga0137380_11750456	Not Available	505	Open in IMG/M
3300012212\|Ga0150985_120684841	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001	2017	Open in IMG/M
3300012350\|Ga0137372_10470716	Not Available	939	Open in IMG/M
3300012362\|Ga0137361_10494607	All Organisms → cellular organisms → Bacteria	1123	Open in IMG/M
3300012582\|Ga0137358_10623736	Not Available	723	Open in IMG/M
3300012676\|Ga0137341_1051178	Not Available	692	Open in IMG/M
3300012882\|Ga0157304_1024150	Not Available	795	Open in IMG/M
3300012884\|Ga0157300_1025604	Not Available	809	Open in IMG/M
3300012891\|Ga0157305_10282646	Not Available	513	Open in IMG/M
3300012906\|Ga0157295_10214806	Not Available	622	Open in IMG/M
3300012910\|Ga0157308_10275969	Not Available	605	Open in IMG/M
3300012914\|Ga0157297_10290434	Not Available	611	Open in IMG/M
3300012922\|Ga0137394_11396408	All Organisms → cellular organisms → Bacteria → Proteobacteria	561	Open in IMG/M
3300012923\|Ga0137359_10330895	All Organisms → cellular organisms → Bacteria	1355	Open in IMG/M
3300012923\|Ga0137359_10609058	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001	957	Open in IMG/M
3300012929\|Ga0137404_11948215	Not Available	547	Open in IMG/M
3300012948\|Ga0126375_10315081	Not Available	1093	Open in IMG/M
3300012948\|Ga0126375_11594057	Not Available	562	Open in IMG/M
3300012986\|Ga0164304_11804415	Not Available	512	Open in IMG/M
3300013102\|Ga0157371_11000074	Not Available	638	Open in IMG/M
3300013104\|Ga0157370_11351304	All Organisms → cellular organisms → Bacteria	642	Open in IMG/M
3300013306\|Ga0163162_10868932	Not Available	1016	Open in IMG/M
3300013306\|Ga0163162_11431490	Not Available	787	Open in IMG/M
3300014154\|Ga0134075_10272989	Not Available	733	Open in IMG/M
3300014326\|Ga0157380_11453040	Not Available	737	Open in IMG/M
3300014489\|Ga0182018_10552555	Not Available	606	Open in IMG/M
3300014839\|Ga0182027_11662708	Not Available	622	Open in IMG/M
3300014870\|Ga0180080_1046217	All Organisms → cellular organisms → Bacteria	709	Open in IMG/M
3300014882\|Ga0180069_1166018	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001	538	Open in IMG/M
3300015201\|Ga0173478_10229169	All Organisms → cellular organisms → Bacteria → Proteobacteria	799	Open in IMG/M
3300015201\|Ga0173478_10464948	Not Available	624	Open in IMG/M
3300015241\|Ga0137418_10539162	Not Available	926	Open in IMG/M
3300015372\|Ga0132256_103885551	Not Available	502	Open in IMG/M
3300024251\|Ga0247679_1087257	Not Available	527	Open in IMG/M
3300025930\|Ga0207701_11201478	All Organisms → cellular organisms → Bacteria	625	Open in IMG/M
3300025938\|Ga0207704_10683502	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001	848	Open in IMG/M
3300026304\|Ga0209240_1032608	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001	1986	Open in IMG/M
3300027877\|Ga0209293_10364875	All Organisms → cellular organisms → Bacteria	743	Open in IMG/M
3300028808\|Ga0302228_10552828	Not Available	506	Open in IMG/M
3300030043\|Ga0302306_10128287	Not Available	980	Open in IMG/M
3300031708\|Ga0310686_113476565	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001	555	Open in IMG/M
3300033480\|Ga0316620_11235872	All Organisms → cellular organisms → Bacteria	733	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	67.29%
Host-Associated	Host-Associated	32.71%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	49.53%
Plants	Host-Associated → Plants	32.71%
Aquatic	Environmental → Aquatic	17.76%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	47.66%
Rhizosphere	Host-Associated → Plants → Rhizosphere	18.69%
Rhizoplane	Host-Associated → Plants → Rhizoplane	13.08%
Sediment	Environmental → Aquatic → Sediment	10.28%
Freshwater	Environmental → Aquatic → Freshwater	5.61%
Marine	Environmental → Aquatic → Marine	1.87%
Peat	Environmental → Terrestrial → Peat	1.87%
Roots	Host-Associated → Plants → Roots	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	38.32%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	16.82%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	12.15%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	10.28%
Loam	Environmental → Terrestrial → Soil → Loam	6.54%
Sediment	Environmental → Aquatic → Freshwater → Sediment	2.80%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	2.80%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.80%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.87%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.87%
Coastal	Environmental → Aquatic → Marine → Coastal	0.93%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.93%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.93%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	33.64%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	16.82%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	12.15%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	10.28%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	4.67%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	2.80%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.80%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.87%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.87%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.87%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.87%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.93%
Sediment	Environmental → Aquatic → Marine → Coastal → Sediment	0.93%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.93%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.93%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.93%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.93%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.93%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.93%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.93%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.93%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	10.28%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	10.28%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	9.35%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	7.48%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	6.54%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	5.61%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.74%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	2.80%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.80%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.80%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	1.87%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	1.87%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.87%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.87%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	1.87%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.87%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.87%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.87%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.87%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.87%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.93%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.93%
Marine	Environmental → Aquatic → Marine → Coastal → Sediment → Marine	0.93%
Mangrove Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment	0.93%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.93%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.93%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.93%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.93%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	0.93%
Palsa	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa	0.93%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.93%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.93%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.93%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.93%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.93%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.93%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300004152	Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3	Environmental	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005591	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1	Environmental	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005827	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBA	Environmental	Open in IMG/M
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300009053	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009111	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009506	Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8	Environmental	Open in IMG/M
3300009548	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100	Environmental	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009624	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10	Environmental	Open in IMG/M
3300009678	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010336	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010392	Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300011417	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2	Environmental	Open in IMG/M
3300011440	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2	Environmental	Open in IMG/M
3300012113	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT100_2	Environmental	Open in IMG/M
3300012166	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012676	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT433_2	Environmental	Open in IMG/M
3300012882	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2	Environmental	Open in IMG/M
3300012884	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2	Environmental	Open in IMG/M
3300012891	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2	Environmental	Open in IMG/M
3300012905	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2	Environmental	Open in IMG/M
3300012906	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1	Environmental	Open in IMG/M
3300012910	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2	Environmental	Open in IMG/M
3300012914	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014154	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014489	Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG	Environmental	Open in IMG/M
3300014839	Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014870	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D	Environmental	Open in IMG/M
3300014882	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D	Environmental	Open in IMG/M
3300015201	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)	Environmental	Open in IMG/M
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300024251	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20	Environmental	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)	Environmental	Open in IMG/M
3300027877	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300028808	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2	Environmental	Open in IMG/M
3300030043	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1	Environmental	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
F14TC_1002882515	3300000559	Soil	MLFERNMVNPTSLLSGGRPTARKANGMRGNGTLEK
Ga0062386_1016964321	3300004152	Bog Forest Soil	LLLERNMVNPTSLLSGGRPTARKVDGMRGNGTLEKANAAL*
Ga0073909_106013542	3300005526	Surface Soil	LFERNMVNPTSFLLGGRLTARKADKMWGNGTLEKANAVL*
Ga0070664_1017285842	3300005564	Corn Rhizosphere	MVNPTSLLFGGRPTARDAHEMRGNGTLEKANAAL*
Ga0068857_1002022232	3300005577	Corn Rhizosphere	MVNPTSLLLGGRPTVRKVDEMRGNGTLEKANAAL*
Ga0068857_1005011451	3300005577	Corn Rhizosphere	MVNLTSFLLRGRLTARKADKMWGNGTLEKANAVL*
Ga0068857_1011906272	3300005577	Corn Rhizosphere	MVNPTSLLFGGRPTARDAHEMRGNGTLEKANAVL*
Ga0068854_1014647623	3300005578	Corn Rhizosphere	MVNPTSLLFGGRPTARKAGGVRGNGTLEKANAVL*
Ga0070761_102502911	3300005591	Soil	MVNPTSLPLGGKPTARKADGMRGNGTLEKANAAL*
Ga0068852_1023943431	3300005616	Corn Rhizosphere	MVNPTSLLFGGRPTARDADEMQGNGTLEKANAGL*
Ga0068859_1009743752	3300005617	Switchgrass Rhizosphere	MVNPTSFLLGGRLTARKADKMWGNGTLEKANAVL*
Ga0068859_1015706802	3300005617	Switchgrass Rhizosphere	MVNPTSLLFGGRPTARDAHEVRGNGTLEKANAVL*
Ga0066905_1005254932	3300005713	Tropical Forest Soil	MVNPTSLLSGGRPTARKANGMRGNGTLEKAKAAL*
Ga0068866_113551952	3300005718	Miscanthus Rhizosphere	MVNPTSLLFGGRPTARKVDGMRGSGTLEKANAVL*
Ga0068861_1024807932	3300005719	Switchgrass Rhizosphere	LFERNMVNLTSFLLRGRLTARKADKMWGNGTLEKANAVL*
Ga0074478_18551311	3300005827	Sediment (Intertidal)	HPSLFERNLVNPTSLLFGGRPTARKVDGMRGNGTLEKANAVL*
Ga0068851_107444302	3300005834	Corn Rhizosphere	MVNPTSLLFGGRPTARDADEMQGNGTLEKANAVL*
Ga0070715_107009591	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	LFERNMVNPTSFLFGGRLTARKADKVWGNGTLEKAKAVL*
Ga0068871_1005464692	3300006358	Miscanthus Rhizosphere	MVNPTSLLFGGRPTARDAHEMRGNGTLEKANAIL*
Ga0075428_1003448933	3300006844	Populus Rhizosphere	MVNPTSLLVGGRPTARKADEVRGNGTLEKAKAVL*
Ga0075421_1024207271	3300006845	Populus Rhizosphere	MVNPTSLLLGGRPTARKVDGVRGNGTLEKANAVL*
Ga0079215_102314082	3300006894	Agricultural Soil	MVNPTSLLFIGRPTARKVDGMRGNGTLEKANAVL*
Ga0075424_1022592751	3300006904	Populus Rhizosphere	LFERNMVNPTSFLFGGRLTARKADKMWGNGTLEKANAAL*
Ga0075419_103330423	3300006969	Populus Rhizosphere	LFERNMVNPTSLLVGGRPTARKADEVRGNGTLEKAKAVL*
Ga0075419_107444491	3300006969	Populus Rhizosphere	MVNPTSLLFGGRPTARKVDGMRGNGTLEKANAVL*
Ga0075419_109328951	3300006969	Populus Rhizosphere	MINPSSLLFGGKQTARKAHGMRSNGTLEKAKAIL*
Ga0105095_102518002	3300009053	Freshwater Sediment	MVNPPSLLLGGRPTARKADGMGGNGTLEQAKAAL*
Ga0099830_112092052	3300009088	Vadose Zone Soil	WNMVNPTSFLFGGRLTARKADKMWGNGTLEKANAVL*
Ga0105247_109767172	3300009101	Switchgrass Rhizosphere	THHALVERNMVNLTSFLLRGRLTARKADKMWGNGTLEKANAVL*
Ga0105247_112619131	3300009101	Switchgrass Rhizosphere	MVNPISLLLGGRPTARKADGMRGNGTLEKANAAL*
Ga0115026_103161142	3300009111	Wetland	LLERNMVNPPSLLLGGRPTARQADGMGGNGTLEQAKAAL*
Ga0066709_1005626781	3300009137	Grasslands Soil	MVNPTSLLLGGRPTARKADEMRGNGTLEKANAAL*
Ga0105243_112267571	3300009148	Miscanthus Rhizosphere	MVNPISLLLGGRPTARKADGMRGNGTLEKANAVL*
Ga0105243_114950621	3300009148	Miscanthus Rhizosphere	MVNPTSLLSGGRPTARDAHEMRGNGTLEKANAVQ*
Ga0111538_109379362	3300009156	Populus Rhizosphere	MVNPTSLLFGGRPTAREAHEMRGNGTLAKANAVL*
Ga0075423_117153571	3300009162	Populus Rhizosphere	MVNPTSLLFGGRPTARDAREMRGNGTLEKANAVL*
Ga0118657_102995411	3300009506	Mangrove Sediment	MVNPASLLLGGRPTARKADGMRGNGTLEKANAAR*
Ga0116107_11405221	3300009548	Peatland	MVNPTSLLLGGRPTARKVDGMRGNGTLEKANAAR*
Ga0105238_102935922	3300009551	Corn Rhizosphere	MVNPTSLLAGGRPTARKADEVRGNGTLKKAKVIL*
Ga0105249_110813081	3300009553	Switchgrass Rhizosphere	LFERNIVNPTSFLLGGRLTARKADKMWGNGTLEKANAAL*
Ga0116105_10699131	3300009624	Peatland	MVNPPSLLLGGKPTVRKADGMRGNGMLEKANAAL*
Ga0105252_103902262	3300009678	Soil	MVNPTSLLLGGRPTARKADEMRGNGTLEKANAVL*
Ga0126382_106387532	3300010047	Tropical Forest Soil	MVNPSSLLFGGKPTARKAHGMRGNGTLEKAKAIL*
Ga0134071_105327311	3300010336	Grasslands Soil	MVNPTSLLFGGRPTVRKVDEMRGNGTLEKANAVL*
Ga0126376_115769561	3300010359	Tropical Forest Soil	MVNPTSLLSGGRPTARKAHGMRGNGTLEKAKAVL*
Ga0126376_123611671	3300010359	Tropical Forest Soil	LVNPTSLLLGGRPTARKADGMRGNGTLEKANAAL*
Ga0126377_108539071	3300010362	Tropical Forest Soil	MVNPSSLLFGGRPTARKAHGMRGNGTLEKAKAVL*
Ga0126377_122456681	3300010362	Tropical Forest Soil	MVNPASFLLGGRLTARNADKMWGNGTLEKANAVL*
Ga0105239_122157851	3300010375	Corn Rhizosphere	MVNPTSLLFGGRPTARKVHEVRGNGTLEKANAVL*
Ga0118731_1123757493	3300010392	Marine	MVNPTSLLFGGRPTVRKVDEMKGNGTLEKANAVL*
Ga0134127_1000195511	3300010399	Terrestrial Soil	MANPASLLLGGRPTARKADEMWGNGTLEKANAAL*
Ga0134127_111651322	3300010399	Terrestrial Soil	MVNPTSPLFGGRPTARDAHEMRGNGTLEKANAVL*
Ga0134122_119449141	3300010400	Terrestrial Soil	MVNPTSLLFGGRPTARKVDGMQGNGTLEKANAVL*
Ga0134121_104644332	3300010401	Terrestrial Soil	MVNPTSLLFGGRPTARKAHGMRGNGTLEKAKAVL*
Ga0150983_106269691	3300011120	Forest Soil	MVNPTSLLFGGRPTARKADGVRGNGTLEKANAAW*
Ga0150983_109258591	3300011120	Forest Soil	MVNPTSLLLGGRPTARKAGGMRGNGTLEKANAAL*
Ga0150983_157554341	3300011120	Forest Soil	MVNPPSLLLGGRPTVRKADGMRGNGTLEEANAAR*
Ga0137326_10799413	3300011417	Soil	MVNPTSLLFGGRPTARKVDGMRGNGTLEKAKAVL*
Ga0137433_10026704	3300011440	Soil	LVNPTSLLLGGRPTARKVDEMRGNGTLEKANAAL*
Ga0137433_10111561	3300011440	Soil	LVNPTSLLFGGRPTARKADEMRGNGTLEKANAAL*
Ga0137433_10145392	3300011440	Soil	MANPASLLLGGRPTARKADEMRGNGTLEKANVAL*
Ga0137328_10224192	3300012113	Soil	LVNPTSLLLGGRPTARKVDGMRGNGTLEKANAAL*
Ga0137350_10885641	3300012166	Soil	SLFEWNMVNPASLLFGGRPTARKADGVRGNGTLEKANAVL*
Ga0137362_110822952	3300012205	Vadose Zone Soil	MVNPTSFLFGGRPTARKADKVWGNGTLEKANAVL*
Ga0137380_117504562	3300012206	Vadose Zone Soil	HHALFERNMVNPTSFLLGGRLTARKADKMWGNGTLEKANAVL*
Ga0150985_1206848412	3300012212	Avena Fatua Rhizosphere	MVNPTSLLFGGRPTARKVHEMRGNGSLEKANAVL*
Ga0137372_104707162	3300012350	Vadose Zone Soil	MVNPTSLLFGGRPTARKADEMRGNGTLEKANAAL*
Ga0137361_104946071	3300012362	Vadose Zone Soil	MVNPTSLLSGGRPTARKADGMRGNGTLEKAKATL*
Ga0137358_106237363	3300012582	Vadose Zone Soil	MVNPTSLLSGGRPTARNANGMRGNGTLEKANAAL*
Ga0137341_10511781	3300012676	Soil	MVNPTSLLLGGRPNARKSDGMRGNGTLEKANAAL*
Ga0157304_10241501	3300012882	Soil	MVNPTSLLFGGRPTARDAHEMRGNGTPEKANAVL*
Ga0157300_10256041	3300012884	Soil	MVNPTSLLLGGRPTARDAHEMRGNGSLEKANAVL*
Ga0157305_102826461	3300012891	Soil	TFRKKFEWNMVNPTSLLFGRRPTARKVDGMRGNGTLEKAKAVL*
Ga0157296_103258581	3300012905	Soil	AKSSPLFERNMVNPTSLLFGGRPTARKAHGMRGNGTLEKAKAVL*
Ga0157295_102148062	3300012906	Soil	MVNPTSLLFGGRPTARKVHEMWGNGTLEKANAVL*
Ga0157308_102759691	3300012910	Soil	MVNPTSLLFGGRPTTRNVDGMRGNGTLEKANAVL*
Ga0157297_102904341	3300012914	Soil	MVNPTSLLFGGRPTARKAHEMRGNGTLEKANAVL*
Ga0137394_113964082	3300012922	Vadose Zone Soil	MANPTSLLLGGRPTARKADEMRGNGTLEKANAAL*
Ga0137359_103308952	3300012923	Vadose Zone Soil	MANPTSLLSGGRPTARNADGMRGNGTLEKAKAVL*
Ga0137359_106090582	3300012923	Vadose Zone Soil	MVNPTSFLLRGRLTARKADKMWGNGTLEKANAVL*
Ga0137404_119482151	3300012929	Vadose Zone Soil	MVNPTSLLSGGRPTARKADGVRVNGTLEKANAAL*
Ga0126375_103150812	3300012948	Tropical Forest Soil	MVNPTSLLLGGRPTARKAHEMRGNGTLEKANAAL*
Ga0126375_115940571	3300012948	Tropical Forest Soil	MVNPTSFLFEGRLTARKADKMGGNGTLEKANAVL*
Ga0164304_118044151	3300012986	Soil	MVNPTSLLLGGRPTARKVDGMRGNGTLEKANAVL*
Ga0157371_110000741	3300013102	Corn Rhizosphere	MVNPTSLLFGGRPTARDAHEMGGNGTLEKANAVL*
Ga0157370_113513041	3300013104	Corn Rhizosphere	ERNMVNPTSLLFGGRPTARDAHEMRGNGTLEKANAVL*
Ga0163162_108689321	3300013306	Switchgrass Rhizosphere	MVNPTSLLFGGRPTARKAHGMRGNGTLEKAKAIL*
Ga0163162_114314901	3300013306	Switchgrass Rhizosphere	MVNPTSLLSGGRPTARKAHGMRGNGTLEKAKAAL*
Ga0134075_102729891	3300014154	Grasslands Soil	MVNPTSLLFGGRPTARKADEMRGNGTLEKANAVL*
Ga0157380_114530402	3300014326	Switchgrass Rhizosphere	MVNPTSLLFGGRPTARKAQGMRGNGTLEKANAVL*
Ga0182018_105525552	3300014489	Palsa	MVNPTSLPLGGKPTARKADGMRGNGTLEKAKAAL*
Ga0182027_116627081	3300014839	Fen	MVNPTSLLFGGRPTARKVDGMWGNGTLEKANAAR*
Ga0180080_10462171	3300014870	Soil	LYERNMVNPTSLLFGGRPTARKVDGMRGNGTLEKANAVL*
Ga0180069_11660181	3300014882	Soil	NLVNPTSLLLGGRPTARKVDGMRGNGTLEKANAAL*
Ga0173478_102291691	3300015201	Soil	MVNPTSFLLRGRLTARKAEKMWGNGTLEKANAVL*
Ga0173478_104649482	3300015201	Soil	MVNPTSLPFGGRPTARKAQGMRGNGTLEKAKAAL*
Ga0137418_105391622	3300015241	Vadose Zone Soil	NMVNPTSFLLGGRLTARKADKMWGNGTLEKANAVL*
Ga0132256_1038855511	3300015372	Arabidopsis Rhizosphere	MVNPTSLLSGGRPTERKVYEMRGNGTLEKANAVL*
Ga0247679_10872571	3300024251	Soil	PLLERNMVNPPSLLFEGKPTARKADGMRGNGTPEKANAAR
Ga0207701_112014782	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	NMVNPTSLLFGGRPTARKAHGMRGNGTLEKANAVL
Ga0207704_106835022	3300025938	Miscanthus Rhizosphere	RNMVNPTSLLGGRPTARKVDGMRGNGTLEKANAVL
Ga0209240_10326081	3300026304	Grasslands Soil	ALFERNMVNPTSFLLPGGRLTARKADKVLGNGTLEKANAVL
Ga0209293_103648752	3300027877	Wetland	NMVNPPSLLLGGRPTARQADGMGGNGTLEQAKAAL
Ga0302228_105528281	3300028808	Palsa	NMVNPTSLLLGGKPTARKADGMRGNGTLEKANAAL
Ga0302306_101282872	3300030043	Palsa	HPSLFERNMVNPTSLLLGGKPTARKADGMRGNGTLEKANAAL
Ga0310686_1134765651	3300031708	Soil	NHSSLFERNMVNPTSLLLEGRPTARKADGMRGNGTLEKANAVL
Ga0316620_112358721	3300033480	Soil	ERNMVNPPSLLLGGRPTARQADGMGGNGTLEQAKAAL

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.18
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.18
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F092771

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign