| Basic Information | |
|---|---|
| Family ID | F092771 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MVNPTSLLFGGRPTARKADEMRGNGTLEKANAVL |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 67.92 % |
| % of genes near scaffold ends (potentially truncated) | 20.56 % |
| % of genes from short scaffolds (< 2000 bps) | 92.52 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.813 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.280 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.860 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.860 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.58% β-sheet: 0.00% Coil/Unstructured: 77.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13655 | RVT_N | 34.58 |
| PF13432 | TPR_16 | 0.93 |
| PF04191 | PEMT | 0.93 |
| PF00400 | WD40 | 0.93 |
| PF09982 | DUF2219 | 0.93 |
| PF13683 | rve_3 | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.81 % |
| All Organisms | root | All Organisms | 40.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_100288251 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
| 3300004152|Ga0062386_101696432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 527 | Open in IMG/M |
| 3300005526|Ga0073909_10601354 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005564|Ga0070664_101728584 | Not Available | 593 | Open in IMG/M |
| 3300005577|Ga0068857_100202223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 1811 | Open in IMG/M |
| 3300005577|Ga0068857_100501145 | Not Available | 1140 | Open in IMG/M |
| 3300005577|Ga0068857_101190627 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005578|Ga0068854_101464762 | Not Available | 619 | Open in IMG/M |
| 3300005591|Ga0070761_10250291 | Not Available | 1059 | Open in IMG/M |
| 3300005616|Ga0068852_102394343 | Not Available | 549 | Open in IMG/M |
| 3300005617|Ga0068859_100974375 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001 | 931 | Open in IMG/M |
| 3300005617|Ga0068859_101570680 | Not Available | 726 | Open in IMG/M |
| 3300005713|Ga0066905_100525493 | Not Available | 989 | Open in IMG/M |
| 3300005718|Ga0068866_11355195 | Not Available | 519 | Open in IMG/M |
| 3300005719|Ga0068861_102480793 | Not Available | 522 | Open in IMG/M |
| 3300005827|Ga0074478_1855131 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001 | 528 | Open in IMG/M |
| 3300005834|Ga0068851_10744430 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006163|Ga0070715_10700959 | Not Available | 605 | Open in IMG/M |
| 3300006358|Ga0068871_100546469 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300006844|Ga0075428_100344893 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001 | 1599 | Open in IMG/M |
| 3300006845|Ga0075421_102420727 | Not Available | 549 | Open in IMG/M |
| 3300006894|Ga0079215_10231408 | Not Available | 963 | Open in IMG/M |
| 3300006904|Ga0075424_102259275 | Not Available | 572 | Open in IMG/M |
| 3300006969|Ga0075419_10333042 | Not Available | 1029 | Open in IMG/M |
| 3300006969|Ga0075419_10744449 | Not Available | 698 | Open in IMG/M |
| 3300006969|Ga0075419_10932895 | Not Available | 628 | Open in IMG/M |
| 3300009053|Ga0105095_10251800 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300009088|Ga0099830_11209205 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300009101|Ga0105247_10976717 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001 | 660 | Open in IMG/M |
| 3300009101|Ga0105247_11261913 | Not Available | 591 | Open in IMG/M |
| 3300009111|Ga0115026_10316114 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300009137|Ga0066709_100562678 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1617 | Open in IMG/M |
| 3300009148|Ga0105243_11226757 | Not Available | 764 | Open in IMG/M |
| 3300009148|Ga0105243_11495062 | Not Available | 699 | Open in IMG/M |
| 3300009156|Ga0111538_10937936 | All Organisms → cellular organisms → Bacteria → PVC group | 1095 | Open in IMG/M |
| 3300009162|Ga0075423_11715357 | Not Available | 676 | Open in IMG/M |
| 3300009506|Ga0118657_10299541 | All Organisms → cellular organisms → Bacteria | 2164 | Open in IMG/M |
| 3300009548|Ga0116107_1140522 | Not Available | 674 | Open in IMG/M |
| 3300009551|Ga0105238_10293592 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001 | 1608 | Open in IMG/M |
| 3300009553|Ga0105249_11081308 | Not Available | 872 | Open in IMG/M |
| 3300009624|Ga0116105_1069913 | Not Available | 837 | Open in IMG/M |
| 3300009678|Ga0105252_10390226 | Not Available | 636 | Open in IMG/M |
| 3300010047|Ga0126382_10638753 | Not Available | 883 | Open in IMG/M |
| 3300010336|Ga0134071_10532731 | Not Available | 609 | Open in IMG/M |
| 3300010359|Ga0126376_11576956 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300010359|Ga0126376_12361167 | Not Available | 578 | Open in IMG/M |
| 3300010362|Ga0126377_10853907 | Not Available | 971 | Open in IMG/M |
| 3300010362|Ga0126377_12245668 | Not Available | 622 | Open in IMG/M |
| 3300010375|Ga0105239_12215785 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300010392|Ga0118731_112375749 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001 | 1436 | Open in IMG/M |
| 3300010399|Ga0134127_10001955 | All Organisms → cellular organisms → Bacteria | 15039 | Open in IMG/M |
| 3300010399|Ga0134127_11165132 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001 | 836 | Open in IMG/M |
| 3300010400|Ga0134122_11944914 | Not Available | 625 | Open in IMG/M |
| 3300010401|Ga0134121_10464433 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001 | 1158 | Open in IMG/M |
| 3300011120|Ga0150983_10626969 | Not Available | 750 | Open in IMG/M |
| 3300011120|Ga0150983_10925859 | Not Available | 745 | Open in IMG/M |
| 3300011120|Ga0150983_15755434 | Not Available | 568 | Open in IMG/M |
| 3300011417|Ga0137326_1079941 | Not Available | 734 | Open in IMG/M |
| 3300011440|Ga0137433_1002670 | All Organisms → cellular organisms → Bacteria | 6665 | Open in IMG/M |
| 3300011440|Ga0137433_1011156 | All Organisms → cellular organisms → Bacteria | 2672 | Open in IMG/M |
| 3300011440|Ga0137433_1014539 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001 | 2298 | Open in IMG/M |
| 3300012113|Ga0137328_1022419 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001 | 613 | Open in IMG/M |
| 3300012166|Ga0137350_1088564 | Not Available | 626 | Open in IMG/M |
| 3300012205|Ga0137362_11082295 | Not Available | 681 | Open in IMG/M |
| 3300012206|Ga0137380_11750456 | Not Available | 505 | Open in IMG/M |
| 3300012212|Ga0150985_120684841 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001 | 2017 | Open in IMG/M |
| 3300012350|Ga0137372_10470716 | Not Available | 939 | Open in IMG/M |
| 3300012362|Ga0137361_10494607 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300012582|Ga0137358_10623736 | Not Available | 723 | Open in IMG/M |
| 3300012676|Ga0137341_1051178 | Not Available | 692 | Open in IMG/M |
| 3300012882|Ga0157304_1024150 | Not Available | 795 | Open in IMG/M |
| 3300012884|Ga0157300_1025604 | Not Available | 809 | Open in IMG/M |
| 3300012891|Ga0157305_10282646 | Not Available | 513 | Open in IMG/M |
| 3300012906|Ga0157295_10214806 | Not Available | 622 | Open in IMG/M |
| 3300012910|Ga0157308_10275969 | Not Available | 605 | Open in IMG/M |
| 3300012914|Ga0157297_10290434 | Not Available | 611 | Open in IMG/M |
| 3300012922|Ga0137394_11396408 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300012923|Ga0137359_10330895 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300012923|Ga0137359_10609058 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001 | 957 | Open in IMG/M |
| 3300012929|Ga0137404_11948215 | Not Available | 547 | Open in IMG/M |
| 3300012948|Ga0126375_10315081 | Not Available | 1093 | Open in IMG/M |
| 3300012948|Ga0126375_11594057 | Not Available | 562 | Open in IMG/M |
| 3300012986|Ga0164304_11804415 | Not Available | 512 | Open in IMG/M |
| 3300013102|Ga0157371_11000074 | Not Available | 638 | Open in IMG/M |
| 3300013104|Ga0157370_11351304 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300013306|Ga0163162_10868932 | Not Available | 1016 | Open in IMG/M |
| 3300013306|Ga0163162_11431490 | Not Available | 787 | Open in IMG/M |
| 3300014154|Ga0134075_10272989 | Not Available | 733 | Open in IMG/M |
| 3300014326|Ga0157380_11453040 | Not Available | 737 | Open in IMG/M |
| 3300014489|Ga0182018_10552555 | Not Available | 606 | Open in IMG/M |
| 3300014839|Ga0182027_11662708 | Not Available | 622 | Open in IMG/M |
| 3300014870|Ga0180080_1046217 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300014882|Ga0180069_1166018 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001 | 538 | Open in IMG/M |
| 3300015201|Ga0173478_10229169 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 799 | Open in IMG/M |
| 3300015201|Ga0173478_10464948 | Not Available | 624 | Open in IMG/M |
| 3300015241|Ga0137418_10539162 | Not Available | 926 | Open in IMG/M |
| 3300015372|Ga0132256_103885551 | Not Available | 502 | Open in IMG/M |
| 3300024251|Ga0247679_1087257 | Not Available | 527 | Open in IMG/M |
| 3300025930|Ga0207701_11201478 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300025938|Ga0207704_10683502 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001 | 848 | Open in IMG/M |
| 3300026304|Ga0209240_1032608 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001 | 1986 | Open in IMG/M |
| 3300027877|Ga0209293_10364875 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300028808|Ga0302228_10552828 | Not Available | 506 | Open in IMG/M |
| 3300030043|Ga0302306_10128287 | Not Available | 980 | Open in IMG/M |
| 3300031708|Ga0310686_113476565 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetes bacterium ADurb.Bin001 | 555 | Open in IMG/M |
| 3300033480|Ga0316620_11235872 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.28% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.28% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 9.35% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.80% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.87% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.87% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.93% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.93% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.93% |
| Mangrove Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment | 0.93% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.93% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005827 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBA | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009506 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8 | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
| 3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
| 3300012113 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT100_2 | Environmental | Open in IMG/M |
| 3300012166 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2 | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012676 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT433_2 | Environmental | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014870 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10D | Environmental | Open in IMG/M |
| 3300014882 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1002882515 | 3300000559 | Soil | MLFERNMVNPTSLLSGGRPTARKANGMRGNGTLEK |
| Ga0062386_1016964321 | 3300004152 | Bog Forest Soil | LLLERNMVNPTSLLSGGRPTARKVDGMRGNGTLEKANAAL* |
| Ga0073909_106013542 | 3300005526 | Surface Soil | LFERNMVNPTSFLLGGRLTARKADKMWGNGTLEKANAVL* |
| Ga0070664_1017285842 | 3300005564 | Corn Rhizosphere | MVNPTSLLFGGRPTARDAHEMRGNGTLEKANAAL* |
| Ga0068857_1002022232 | 3300005577 | Corn Rhizosphere | MVNPTSLLLGGRPTVRKVDEMRGNGTLEKANAAL* |
| Ga0068857_1005011451 | 3300005577 | Corn Rhizosphere | MVNLTSFLLRGRLTARKADKMWGNGTLEKANAVL* |
| Ga0068857_1011906272 | 3300005577 | Corn Rhizosphere | MVNPTSLLFGGRPTARDAHEMRGNGTLEKANAVL* |
| Ga0068854_1014647623 | 3300005578 | Corn Rhizosphere | MVNPTSLLFGGRPTARKAGGVRGNGTLEKANAVL* |
| Ga0070761_102502911 | 3300005591 | Soil | MVNPTSLPLGGKPTARKADGMRGNGTLEKANAAL* |
| Ga0068852_1023943431 | 3300005616 | Corn Rhizosphere | MVNPTSLLFGGRPTARDADEMQGNGTLEKANAGL* |
| Ga0068859_1009743752 | 3300005617 | Switchgrass Rhizosphere | MVNPTSFLLGGRLTARKADKMWGNGTLEKANAVL* |
| Ga0068859_1015706802 | 3300005617 | Switchgrass Rhizosphere | MVNPTSLLFGGRPTARDAHEVRGNGTLEKANAVL* |
| Ga0066905_1005254932 | 3300005713 | Tropical Forest Soil | MVNPTSLLSGGRPTARKANGMRGNGTLEKAKAAL* |
| Ga0068866_113551952 | 3300005718 | Miscanthus Rhizosphere | MVNPTSLLFGGRPTARKVDGMRGSGTLEKANAVL* |
| Ga0068861_1024807932 | 3300005719 | Switchgrass Rhizosphere | LFERNMVNLTSFLLRGRLTARKADKMWGNGTLEKANAVL* |
| Ga0074478_18551311 | 3300005827 | Sediment (Intertidal) | HPSLFERNLVNPTSLLFGGRPTARKVDGMRGNGTLEKANAVL* |
| Ga0068851_107444302 | 3300005834 | Corn Rhizosphere | MVNPTSLLFGGRPTARDADEMQGNGTLEKANAVL* |
| Ga0070715_107009591 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LFERNMVNPTSFLFGGRLTARKADKVWGNGTLEKAKAVL* |
| Ga0068871_1005464692 | 3300006358 | Miscanthus Rhizosphere | MVNPTSLLFGGRPTARDAHEMRGNGTLEKANAIL* |
| Ga0075428_1003448933 | 3300006844 | Populus Rhizosphere | MVNPTSLLVGGRPTARKADEVRGNGTLEKAKAVL* |
| Ga0075421_1024207271 | 3300006845 | Populus Rhizosphere | MVNPTSLLLGGRPTARKVDGVRGNGTLEKANAVL* |
| Ga0079215_102314082 | 3300006894 | Agricultural Soil | MVNPTSLLFIGRPTARKVDGMRGNGTLEKANAVL* |
| Ga0075424_1022592751 | 3300006904 | Populus Rhizosphere | LFERNMVNPTSFLFGGRLTARKADKMWGNGTLEKANAAL* |
| Ga0075419_103330423 | 3300006969 | Populus Rhizosphere | LFERNMVNPTSLLVGGRPTARKADEVRGNGTLEKAKAVL* |
| Ga0075419_107444491 | 3300006969 | Populus Rhizosphere | MVNPTSLLFGGRPTARKVDGMRGNGTLEKANAVL* |
| Ga0075419_109328951 | 3300006969 | Populus Rhizosphere | MINPSSLLFGGKQTARKAHGMRSNGTLEKAKAIL* |
| Ga0105095_102518002 | 3300009053 | Freshwater Sediment | MVNPPSLLLGGRPTARKADGMGGNGTLEQAKAAL* |
| Ga0099830_112092052 | 3300009088 | Vadose Zone Soil | WNMVNPTSFLFGGRLTARKADKMWGNGTLEKANAVL* |
| Ga0105247_109767172 | 3300009101 | Switchgrass Rhizosphere | THHALVERNMVNLTSFLLRGRLTARKADKMWGNGTLEKANAVL* |
| Ga0105247_112619131 | 3300009101 | Switchgrass Rhizosphere | MVNPISLLLGGRPTARKADGMRGNGTLEKANAAL* |
| Ga0115026_103161142 | 3300009111 | Wetland | LLERNMVNPPSLLLGGRPTARQADGMGGNGTLEQAKAAL* |
| Ga0066709_1005626781 | 3300009137 | Grasslands Soil | MVNPTSLLLGGRPTARKADEMRGNGTLEKANAAL* |
| Ga0105243_112267571 | 3300009148 | Miscanthus Rhizosphere | MVNPISLLLGGRPTARKADGMRGNGTLEKANAVL* |
| Ga0105243_114950621 | 3300009148 | Miscanthus Rhizosphere | MVNPTSLLSGGRPTARDAHEMRGNGTLEKANAVQ* |
| Ga0111538_109379362 | 3300009156 | Populus Rhizosphere | MVNPTSLLFGGRPTAREAHEMRGNGTLAKANAVL* |
| Ga0075423_117153571 | 3300009162 | Populus Rhizosphere | MVNPTSLLFGGRPTARDAREMRGNGTLEKANAVL* |
| Ga0118657_102995411 | 3300009506 | Mangrove Sediment | MVNPASLLLGGRPTARKADGMRGNGTLEKANAAR* |
| Ga0116107_11405221 | 3300009548 | Peatland | MVNPTSLLLGGRPTARKVDGMRGNGTLEKANAAR* |
| Ga0105238_102935922 | 3300009551 | Corn Rhizosphere | MVNPTSLLAGGRPTARKADEVRGNGTLKKAKVIL* |
| Ga0105249_110813081 | 3300009553 | Switchgrass Rhizosphere | LFERNIVNPTSFLLGGRLTARKADKMWGNGTLEKANAAL* |
| Ga0116105_10699131 | 3300009624 | Peatland | MVNPPSLLLGGKPTVRKADGMRGNGMLEKANAAL* |
| Ga0105252_103902262 | 3300009678 | Soil | MVNPTSLLLGGRPTARKADEMRGNGTLEKANAVL* |
| Ga0126382_106387532 | 3300010047 | Tropical Forest Soil | MVNPSSLLFGGKPTARKAHGMRGNGTLEKAKAIL* |
| Ga0134071_105327311 | 3300010336 | Grasslands Soil | MVNPTSLLFGGRPTVRKVDEMRGNGTLEKANAVL* |
| Ga0126376_115769561 | 3300010359 | Tropical Forest Soil | MVNPTSLLSGGRPTARKAHGMRGNGTLEKAKAVL* |
| Ga0126376_123611671 | 3300010359 | Tropical Forest Soil | LVNPTSLLLGGRPTARKADGMRGNGTLEKANAAL* |
| Ga0126377_108539071 | 3300010362 | Tropical Forest Soil | MVNPSSLLFGGRPTARKAHGMRGNGTLEKAKAVL* |
| Ga0126377_122456681 | 3300010362 | Tropical Forest Soil | MVNPASFLLGGRLTARNADKMWGNGTLEKANAVL* |
| Ga0105239_122157851 | 3300010375 | Corn Rhizosphere | MVNPTSLLFGGRPTARKVHEVRGNGTLEKANAVL* |
| Ga0118731_1123757493 | 3300010392 | Marine | MVNPTSLLFGGRPTVRKVDEMKGNGTLEKANAVL* |
| Ga0134127_1000195511 | 3300010399 | Terrestrial Soil | MANPASLLLGGRPTARKADEMWGNGTLEKANAAL* |
| Ga0134127_111651322 | 3300010399 | Terrestrial Soil | MVNPTSPLFGGRPTARDAHEMRGNGTLEKANAVL* |
| Ga0134122_119449141 | 3300010400 | Terrestrial Soil | MVNPTSLLFGGRPTARKVDGMQGNGTLEKANAVL* |
| Ga0134121_104644332 | 3300010401 | Terrestrial Soil | MVNPTSLLFGGRPTARKAHGMRGNGTLEKAKAVL* |
| Ga0150983_106269691 | 3300011120 | Forest Soil | MVNPTSLLFGGRPTARKADGVRGNGTLEKANAAW* |
| Ga0150983_109258591 | 3300011120 | Forest Soil | MVNPTSLLLGGRPTARKAGGMRGNGTLEKANAAL* |
| Ga0150983_157554341 | 3300011120 | Forest Soil | MVNPPSLLLGGRPTVRKADGMRGNGTLEEANAAR* |
| Ga0137326_10799413 | 3300011417 | Soil | MVNPTSLLFGGRPTARKVDGMRGNGTLEKAKAVL* |
| Ga0137433_10026704 | 3300011440 | Soil | LVNPTSLLLGGRPTARKVDEMRGNGTLEKANAAL* |
| Ga0137433_10111561 | 3300011440 | Soil | LVNPTSLLFGGRPTARKADEMRGNGTLEKANAAL* |
| Ga0137433_10145392 | 3300011440 | Soil | MANPASLLLGGRPTARKADEMRGNGTLEKANVAL* |
| Ga0137328_10224192 | 3300012113 | Soil | LVNPTSLLLGGRPTARKVDGMRGNGTLEKANAAL* |
| Ga0137350_10885641 | 3300012166 | Soil | SLFEWNMVNPASLLFGGRPTARKADGVRGNGTLEKANAVL* |
| Ga0137362_110822952 | 3300012205 | Vadose Zone Soil | MVNPTSFLFGGRPTARKADKVWGNGTLEKANAVL* |
| Ga0137380_117504562 | 3300012206 | Vadose Zone Soil | HHALFERNMVNPTSFLLGGRLTARKADKMWGNGTLEKANAVL* |
| Ga0150985_1206848412 | 3300012212 | Avena Fatua Rhizosphere | MVNPTSLLFGGRPTARKVHEMRGNGSLEKANAVL* |
| Ga0137372_104707162 | 3300012350 | Vadose Zone Soil | MVNPTSLLFGGRPTARKADEMRGNGTLEKANAAL* |
| Ga0137361_104946071 | 3300012362 | Vadose Zone Soil | MVNPTSLLSGGRPTARKADGMRGNGTLEKAKATL* |
| Ga0137358_106237363 | 3300012582 | Vadose Zone Soil | MVNPTSLLSGGRPTARNANGMRGNGTLEKANAAL* |
| Ga0137341_10511781 | 3300012676 | Soil | MVNPTSLLLGGRPNARKSDGMRGNGTLEKANAAL* |
| Ga0157304_10241501 | 3300012882 | Soil | MVNPTSLLFGGRPTARDAHEMRGNGTPEKANAVL* |
| Ga0157300_10256041 | 3300012884 | Soil | MVNPTSLLLGGRPTARDAHEMRGNGSLEKANAVL* |
| Ga0157305_102826461 | 3300012891 | Soil | TFRKKFEWNMVNPTSLLFGRRPTARKVDGMRGNGTLEKAKAVL* |
| Ga0157296_103258581 | 3300012905 | Soil | AKSSPLFERNMVNPTSLLFGGRPTARKAHGMRGNGTLEKAKAVL* |
| Ga0157295_102148062 | 3300012906 | Soil | MVNPTSLLFGGRPTARKVHEMWGNGTLEKANAVL* |
| Ga0157308_102759691 | 3300012910 | Soil | MVNPTSLLFGGRPTTRNVDGMRGNGTLEKANAVL* |
| Ga0157297_102904341 | 3300012914 | Soil | MVNPTSLLFGGRPTARKAHEMRGNGTLEKANAVL* |
| Ga0137394_113964082 | 3300012922 | Vadose Zone Soil | MANPTSLLLGGRPTARKADEMRGNGTLEKANAAL* |
| Ga0137359_103308952 | 3300012923 | Vadose Zone Soil | MANPTSLLSGGRPTARNADGMRGNGTLEKAKAVL* |
| Ga0137359_106090582 | 3300012923 | Vadose Zone Soil | MVNPTSFLLRGRLTARKADKMWGNGTLEKANAVL* |
| Ga0137404_119482151 | 3300012929 | Vadose Zone Soil | MVNPTSLLSGGRPTARKADGVRVNGTLEKANAAL* |
| Ga0126375_103150812 | 3300012948 | Tropical Forest Soil | MVNPTSLLLGGRPTARKAHEMRGNGTLEKANAAL* |
| Ga0126375_115940571 | 3300012948 | Tropical Forest Soil | MVNPTSFLFEGRLTARKADKMGGNGTLEKANAVL* |
| Ga0164304_118044151 | 3300012986 | Soil | MVNPTSLLLGGRPTARKVDGMRGNGTLEKANAVL* |
| Ga0157371_110000741 | 3300013102 | Corn Rhizosphere | MVNPTSLLFGGRPTARDAHEMGGNGTLEKANAVL* |
| Ga0157370_113513041 | 3300013104 | Corn Rhizosphere | ERNMVNPTSLLFGGRPTARDAHEMRGNGTLEKANAVL* |
| Ga0163162_108689321 | 3300013306 | Switchgrass Rhizosphere | MVNPTSLLFGGRPTARKAHGMRGNGTLEKAKAIL* |
| Ga0163162_114314901 | 3300013306 | Switchgrass Rhizosphere | MVNPTSLLSGGRPTARKAHGMRGNGTLEKAKAAL* |
| Ga0134075_102729891 | 3300014154 | Grasslands Soil | MVNPTSLLFGGRPTARKADEMRGNGTLEKANAVL* |
| Ga0157380_114530402 | 3300014326 | Switchgrass Rhizosphere | MVNPTSLLFGGRPTARKAQGMRGNGTLEKANAVL* |
| Ga0182018_105525552 | 3300014489 | Palsa | MVNPTSLPLGGKPTARKADGMRGNGTLEKAKAAL* |
| Ga0182027_116627081 | 3300014839 | Fen | MVNPTSLLFGGRPTARKVDGMWGNGTLEKANAAR* |
| Ga0180080_10462171 | 3300014870 | Soil | LYERNMVNPTSLLFGGRPTARKVDGMRGNGTLEKANAVL* |
| Ga0180069_11660181 | 3300014882 | Soil | NLVNPTSLLLGGRPTARKVDGMRGNGTLEKANAAL* |
| Ga0173478_102291691 | 3300015201 | Soil | MVNPTSFLLRGRLTARKAEKMWGNGTLEKANAVL* |
| Ga0173478_104649482 | 3300015201 | Soil | MVNPTSLPFGGRPTARKAQGMRGNGTLEKAKAAL* |
| Ga0137418_105391622 | 3300015241 | Vadose Zone Soil | NMVNPTSFLLGGRLTARKADKMWGNGTLEKANAVL* |
| Ga0132256_1038855511 | 3300015372 | Arabidopsis Rhizosphere | MVNPTSLLSGGRPTERKVYEMRGNGTLEKANAVL* |
| Ga0247679_10872571 | 3300024251 | Soil | PLLERNMVNPPSLLFEGKPTARKADGMRGNGTPEKANAAR |
| Ga0207701_112014782 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | NMVNPTSLLFGGRPTARKAHGMRGNGTLEKANAVL |
| Ga0207704_106835022 | 3300025938 | Miscanthus Rhizosphere | RNMVNPTSLLGGRPTARKVDGMRGNGTLEKANAVL |
| Ga0209240_10326081 | 3300026304 | Grasslands Soil | ALFERNMVNPTSFLLPGGRLTARKADKVLGNGTLEKANAVL |
| Ga0209293_103648752 | 3300027877 | Wetland | NMVNPPSLLLGGRPTARQADGMGGNGTLEQAKAAL |
| Ga0302228_105528281 | 3300028808 | Palsa | NMVNPTSLLLGGKPTARKADGMRGNGTLEKANAAL |
| Ga0302306_101282872 | 3300030043 | Palsa | HPSLFERNMVNPTSLLLGGKPTARKADGMRGNGTLEKANAAL |
| Ga0310686_1134765651 | 3300031708 | Soil | NHSSLFERNMVNPTSLLLEGRPTARKADGMRGNGTLEKANAVL |
| Ga0316620_112358721 | 3300033480 | Soil | ERNMVNPPSLLLGGRPTARQADGMGGNGTLEQAKAAL |
| ⦗Top⦘ |