| Basic Information | |
|---|---|
| Family ID | F092761 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VNLINQISCEAILIWRGHEGRTGWELGLELQEPSPDFWGLDF |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 4.35 % |
| % of genes near scaffold ends (potentially truncated) | 20.56 % |
| % of genes from short scaffolds (< 2000 bps) | 14.95 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (78.505 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.495 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.103 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.140 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.29% β-sheet: 20.00% Coil/Unstructured: 75.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13614 | AAA_31 | 65.42 |
| PF01656 | CbiA | 16.82 |
| PF02195 | ParBc | 5.61 |
| PF02321 | OEP | 4.67 |
| PF08535 | KorB | 1.87 |
| PF13738 | Pyr_redox_3 | 1.87 |
| PF14518 | Haem_oxygenas_2 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 9.35 |
| COG1475 | Chromosome segregation protein Spo0J, contains ParB-like nuclease domain | Cell cycle control, cell division, chromosome partitioning [D] | 1.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 78.50 % |
| All Organisms | root | All Organisms | 21.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005451|Ga0066681_10140867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium | 1411 | Open in IMG/M |
| 3300005568|Ga0066703_10032911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2803 | Open in IMG/M |
| 3300006163|Ga0070715_10921603 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300009088|Ga0099830_10090175 | All Organisms → cellular organisms → Bacteria | 2268 | Open in IMG/M |
| 3300009143|Ga0099792_10836895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300009665|Ga0116135_1120184 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
| 3300010361|Ga0126378_12273403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300012096|Ga0137389_10446201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
| 3300012189|Ga0137388_10195896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1818 | Open in IMG/M |
| 3300012203|Ga0137399_11587723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300012206|Ga0137380_10123355 | All Organisms → cellular organisms → Bacteria | 2367 | Open in IMG/M |
| 3300012582|Ga0137358_10284919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
| 3300020580|Ga0210403_10556875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
| 3300021432|Ga0210384_11605326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300021478|Ga0210402_10969927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300024330|Ga0137417_1344207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2302 | Open in IMG/M |
| 3300026298|Ga0209236_1022894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3462 | Open in IMG/M |
| 3300026356|Ga0257150_1042928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300026529|Ga0209806_1281842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300027826|Ga0209060_10032694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2604 | Open in IMG/M |
| 3300027857|Ga0209166_10667219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300027862|Ga0209701_10073418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 2163 | Open in IMG/M |
| 3300032076|Ga0306924_11853742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.67% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005877 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_404 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028021 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12637J13337_10167811 | 3300001137 | Forest Soil | NSSRCEAVLIWRGHEGRKGWELGLELIEPSQSFWGVDL* |
| Ga0066688_102637482 | 3300005178 | Soil | QKLDLVNLVNKNVSKATLIWRGHEGRTGWELGLELQDPPEDFWGLDF* |
| Ga0066688_102660373 | 3300005178 | Soil | NKVNGNSCDAILIWRGHEGRGGWELGLELQGQQDDFWGVDF* |
| Ga0066684_100502501 | 3300005179 | Soil | KLRLVNLTNQISCVAVLVWRGHEGRTGWELGLELQEPLADFWGLDF* |
| Ga0066681_101408673 | 3300005451 | Soil | AVGQKLDLVNLVNKNVSKATLIWRGHEGRTGWELGLELQDPPEDFWGLDF* |
| Ga0070730_105057713 | 3300005537 | Surface Soil | KLINLINKNECEAVLIWRGHEGRTGWELGLELQGASMDFWGLDF* |
| Ga0070733_111675851 | 3300005541 | Surface Soil | KNACEAVLIWRGHEGRTGWELGLELQEASMEFWGVEF* |
| Ga0070695_1017556952 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LVNLVNKNSVDAILIWRGYEGRTGWELGLELQGPGEEFWGVDF* |
| Ga0070704_1002522713 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LINLVNKNSVGAILIWRGHEGRAGWELGLELQDAGEEFWGVDF* |
| Ga0066670_108897122 | 3300005560 | Soil | QISCEAVLVWRGHEGRTGWELGLELQEPLADFWGLDF* |
| Ga0066699_108324721 | 3300005561 | Soil | VSKATLIWRGHEGRTGWELGLELQDPPEDFWGLDF* |
| Ga0066703_100329115 | 3300005568 | Soil | GQKLRLVNLTNQISCDAVLVWRGHEGRTGWELGLELQEPSPDFWGLDF* |
| Ga0066691_102122671 | 3300005586 | Soil | LRLVNLTNQISCEAVLVWRGHEGRTGWELGLELQEPSPDFWGLDF* |
| Ga0066903_1090564252 | 3300005764 | Tropical Forest Soil | QNACESVLVWRGHEGRAGWELGLELQKMPADFWGLDF* |
| Ga0068860_1005778631 | 3300005843 | Switchgrass Rhizosphere | KNSVDAVLIWRGHEGRTGWELGLELQDAGEEFWGVDF* |
| Ga0075296_10300792 | 3300005877 | Rice Paddy Soil | NLINQISCEATLVWRGHEGPTGWELGLELQEPSPDFWGLDF* |
| Ga0080027_101959732 | 3300005993 | Prmafrost Soil | GNISAARLIWRGHEGRTGWELGLELDNPPHDFWGLEF* |
| Ga0070715_109216032 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | QKLRLINLTNQHECDSVLVWRGHEGRSGWELGLELQKLPADFWGLDF* |
| Ga0070716_1015635111 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | KNVCKAILIWRGHEGRTGWELGLELQNPPEDYWGLDF* |
| Ga0066660_104727822 | 3300006800 | Soil | INLMNQQACDSVLIWRGHEGRSGWELGLELQNTPADFWGLDF* |
| Ga0075433_105414772 | 3300006852 | Populus Rhizosphere | NKNSVDAILIWRGHEGRTGWELGLELQDAGDEFWGVDF* |
| Ga0099794_101549842 | 3300007265 | Vadose Zone Soil | VNLINQISCEAVLIWRGHEGRTGWELGLELQEPSPDFWGLDF* |
| Ga0099830_100901754 | 3300009088 | Vadose Zone Soil | FPVGQKLRLVNLINQISCEAILIWRGHEGRTGWELGLELLEPSRDFWGLDF* |
| Ga0099830_103634951 | 3300009088 | Vadose Zone Soil | HISCEAILVWRGHEGRAGWELGLELQQPSPDFWGLDF* |
| Ga0099830_104657302 | 3300009088 | Vadose Zone Soil | LVNLINQISCEAVLVWRGHEGRTGWELGLELQEPSPGFWGLDI* |
| Ga0099828_102928621 | 3300009089 | Vadose Zone Soil | TNKKTSDAILIWRGHEGRAGWELGLEIQDKPEDFWGIQF* |
| Ga0099792_108368952 | 3300009143 | Vadose Zone Soil | GVGQKLRLVNLLNQISCEATLVWRGHEGRAGWELGLELQDPSPDFWGLDF* |
| Ga0116135_11201842 | 3300009665 | Peatland | TVGQRLNLVNLTNQSVCEAVLVWRGHEGRSGWELGLELQRMPSDFWGVDF* |
| Ga0126380_102533363 | 3300010043 | Tropical Forest Soil | GNVADAVLIWRGHEGRAGWELGIELQGFQEEFWGIDF* |
| Ga0126382_104159251 | 3300010047 | Tropical Forest Soil | LVNLVNKNSVDAVLIWRGHEGRTGWELGLELQGPGDEFWGVDF* |
| Ga0126378_122734031 | 3300010361 | Tropical Forest Soil | LGQKLELVNLVNKNVSKAILIWRGHEGRTGWELGLELENPPDDFWGLDF* |
| Ga0126379_100079111 | 3300010366 | Tropical Forest Soil | KNASNQKESDATLIWRGHEGRTGWELGLELLNPPADFWGLEF* |
| Ga0105239_122844711 | 3300010375 | Corn Rhizosphere | HLINLTNQNVCEAILVWRGHEGRSGWELGLELQHATEEFWGVDF* |
| Ga0126381_1023053182 | 3300010376 | Tropical Forest Soil | ESDATLIWRGHEGRTGWELGLELLNPPADFWGLEF* |
| Ga0126383_104117311 | 3300010398 | Tropical Forest Soil | KNSVDAILVWRGHEGRTGWELGLELQGPGEEFWGVDL* |
| Ga0137389_104462012 | 3300012096 | Vadose Zone Soil | GQKLRLVNLINQISCEAVLVWRGHEGRAGWELGLELQQPSPDFWGLDF* |
| Ga0137388_101958963 | 3300012189 | Vadose Zone Soil | FTVGQKLRLVNLINQISCEAILIWRGHEGRTGWELGLELQEPSADFWGLDF* |
| Ga0137399_115877232 | 3300012203 | Vadose Zone Soil | GQRLRLVNKVNGNSCDAILIWRGHEGRSGWELGLELQGQQDDFWGVDF* |
| Ga0137362_103437611 | 3300012205 | Vadose Zone Soil | VNKNVAKAILIWRGHEGRTGWELGLELVNPPDDYWGLDF* |
| Ga0137380_101233551 | 3300012206 | Vadose Zone Soil | RLVNLINQISCEAVLVWRGHEGRTGWELGLELQEPSPDFWGLDF* |
| Ga0137378_105882091 | 3300012210 | Vadose Zone Soil | NKNVSKATLIWRGHEGRTGWELGLELQDPPEVFWGLDF* |
| Ga0137361_105759521 | 3300012362 | Vadose Zone Soil | VNLVNKNVSKATLIWRGHEGRTGWELGLELQDPPEDFWGLDF* |
| Ga0137358_102849192 | 3300012582 | Vadose Zone Soil | VGQKLDLVNLVNKNVSKATLIWRGHEGRTGWELGLELQDPPEDFWGLDF* |
| Ga0137413_106578112 | 3300012924 | Vadose Zone Soil | ACEAILVWRGHEGRAGWELGLELQDPSPDFWGLDF* |
| Ga0137413_107196501 | 3300012924 | Vadose Zone Soil | NSCDAILIWRGHEGRSGWELGLELQGQQDDFWGVDF* |
| Ga0137419_113466122 | 3300012925 | Vadose Zone Soil | NVAKAILIWRGHEGRAGWELGLELVNPPDDYWGLDF* |
| Ga0137416_104483441 | 3300012927 | Vadose Zone Soil | NQNSCEAVLVWRGHEGRKGWELGLELQDATRDFWGLDV* |
| Ga0137404_103905172 | 3300012929 | Vadose Zone Soil | NSCEAVLVWRGHEGRKGWELGLELQDATLDFWGLDV* |
| Ga0126375_111111201 | 3300012948 | Tropical Forest Soil | TLINLVNQKSSDAILIWRGHEGHTGWELGLELQGPSEDFWGLDF* |
| Ga0157372_132705422 | 3300013307 | Corn Rhizosphere | VCDSILVWRGHEGRSGWELGLELQKMPADFWGLDF* |
| Ga0182024_105288601 | 3300014501 | Permafrost | QSACESVLVWRGHEGRSGWELGLELQKMPADFWGVDF* |
| Ga0182038_100857974 | 3300016445 | Soil | LVNQANKNSVDAILVWRGQEGRTGWEVGLELQGAGEEFWGMDF |
| Ga0182038_101783531 | 3300016445 | Soil | EAADAILIWRGHEGRAGWELGIELQNAAEAFWGVEF |
| Ga0187802_100682941 | 3300017822 | Freshwater Sediment | NGSNARQSEAVLIWRGHEGRSGWELGLELVNPPEEFWGVDF |
| Ga0187780_101561971 | 3300017973 | Tropical Peatland | MRLINLTNQISTEATVIWRGHEGPTGWELGVELLEPSPDFWGLDF |
| Ga0066669_105529521 | 3300018482 | Grasslands Soil | QKLDLVNLVNKNVSKATLIWRGHEGRTGWELGLELQDPPEDFWGLDF |
| Ga0210407_111763822 | 3300020579 | Soil | QSEAVLIWRGHEGRTGWELGLELRDPSPEFWGPDL |
| Ga0210403_105568752 | 3300020580 | Soil | QRLRLVNLVNSSQSEAVLIWRGHEGRTGWELGLELRDPSPEFWGPDL |
| Ga0210399_106065722 | 3300020581 | Soil | KLRLINLINQNACNSVLVWRGHEGRSGWELGLELESIPSDFWGLDF |
| Ga0210405_110845662 | 3300021171 | Soil | INKNASEAVLIWRGHEGRAGWELGLELQEASMDFWGVEF |
| Ga0210393_113345502 | 3300021401 | Soil | INKNACEAILIWRGHENRTGWELGLELQGASMDFWGVDF |
| Ga0210389_107186112 | 3300021404 | Soil | LVNLINKNACEAILIWRGHENRTGWELGLELQGAPMDFWGVDF |
| Ga0210387_111859751 | 3300021405 | Soil | VNLVNKNVAQALLVWRGHEGRTGWELGLELQDPPEDFWGLDF |
| Ga0210394_109589642 | 3300021420 | Soil | LLNQISCEAVLVWRGHEGRKGWELGLELQEPTADFWGLDF |
| Ga0210384_116053261 | 3300021432 | Soil | VGQRLRVINLTNQSACEAVLVWRGHEGRSGWELGLELQKMPAEFWGVDF |
| Ga0210391_103019023 | 3300021433 | Soil | LINQISCEAVLVWRGHEGRKGWELGLELQEPPLDFWGLDF |
| Ga0210398_114319151 | 3300021477 | Soil | ACEAVLIWRGHEGRTGWELGLQLQDASMDFWGLDF |
| Ga0210402_100302881 | 3300021478 | Soil | NVAQALLVWRGHEGRTGWELGLELQDPPEDFWGLDF |
| Ga0210402_109699271 | 3300021478 | Soil | GQKLRLVNLTNQNACSSVLVWRGHEGRSGWELGLELESIPSDFWGLDF |
| Ga0126371_127815861 | 3300021560 | Tropical Forest Soil | NACESVLVWRGHEGRAGWELGLELQKMPADFWGLDF |
| Ga0137417_13442073 | 3300024330 | Vadose Zone Soil | VGQKLRLVNLINQISCEAVLIWRGHEGRAGWELGLELQEPSPDFWGLDF |
| Ga0207671_115446431 | 3300025914 | Corn Rhizosphere | TNQHVCDSILVWRGHEGRSGWELGLELQKMPADFWGLDF |
| Ga0209236_10228945 | 3300026298 | Grasslands Soil | VGQKLRLVNLINQISCEAILIWRGHEGRTGWELGLELQEPSPDFWGLDF |
| Ga0209647_10604963 | 3300026319 | Grasslands Soil | VNKVNGNSCDAILIWRGHEGRSGWELGLELQGQQDDFWGVDF |
| Ga0209647_12083621 | 3300026319 | Grasslands Soil | INQISCEAILIWRGHEGRAGWELGLELREPSPDFWGLDF |
| Ga0209158_10990441 | 3300026333 | Soil | LVNLTNQISCEAVLVWRGHEGRTGWELGLELQEPSPDFWGLDF |
| Ga0257150_10429281 | 3300026356 | Soil | QKLRLVNLINQISCEAVLIWRGHEGRAGWELGLELQEPSPDFWGLDF |
| Ga0257179_10208182 | 3300026371 | Soil | NLISCEATLIWRGHEGRAGWELGLELQEPSPDFWGLDF |
| Ga0257165_10894831 | 3300026507 | Soil | ISCEAILIWRGHEGRTGWELGLELQEPSPDFWGLDF |
| Ga0209806_12818421 | 3300026529 | Soil | FNVGQKLRLVNLTNQISCDAVLVWRGHEGRTGWELGLELQEPSPDFWGLDF |
| Ga0209807_12457051 | 3300026530 | Soil | LINLTNQHVCDSILVWRGHEGRSGWELGLELQKMPADFWGLDF |
| Ga0179587_102436251 | 3300026557 | Vadose Zone Soil | VNLINSSKSEAVLIWRGHEGRTGWELGLELHDPSPEFWGLDF |
| Ga0208365_10259962 | 3300027070 | Forest Soil | QFSSDASVIWRGHEGPAGWELGVELLEPSPDFWGLDF |
| Ga0209004_10296802 | 3300027376 | Forest Soil | DLVNLVNKNVCKAILIWRGHEGRTGWELGLELQNPPEDYWGLDF |
| Ga0209117_11377652 | 3300027645 | Forest Soil | NLVNKNVAKAILIWRGHEGRTGWELGLELVNPPDDYWGLDF |
| Ga0209060_100326941 | 3300027826 | Surface Soil | VGQRLHLVNLTNQNVCEAILVWRGHEGRSGWELGLELQHATEEFWGVDF |
| Ga0209693_100794443 | 3300027855 | Soil | AVCEAILVWRGHEGRSGWEIGLELQHATEEFWGMDF |
| Ga0209166_106672191 | 3300027857 | Surface Soil | GFAVGQRLKLINLINKNECEAVLIWRGHEGRTGWELGLELQEASMEFWGLDF |
| Ga0209701_100734181 | 3300027862 | Vadose Zone Soil | FPVGQKLRLVNLINQISCEAILIWRGHEGRTGWELGLELLEPSRDFWGLDF |
| Ga0209488_103185691 | 3300027903 | Vadose Zone Soil | INQISCEAILIWRGHEGRTGWELGLELQEPSADFWGLDF |
| Ga0265352_10024811 | 3300028021 | Soil | LINKNACEAILIWRGHEGRTGWELGLQLQEASMDFWGLDF |
| Ga0209526_100578541 | 3300028047 | Forest Soil | LINLTNQSTCAAILVWRGHEGRSGWELGLELQKMPVDFWGVDF |
| Ga0268264_100457725 | 3300028381 | Switchgrass Rhizosphere | SVDAVLIWRGHEGRTGWELGLELQDAGEEFWGVDF |
| Ga0302233_101999301 | 3300028746 | Palsa | NKISEATLIWRGHEGRQGWELGLELLNPPDGFWAIDL |
| Ga0170834_1023374191 | 3300031057 | Forest Soil | LVNKNVCKAVLIWRGHEGRTGWELGLELQHPPDDYWGLDF |
| Ga0170823_131402841 | 3300031128 | Forest Soil | NVAKAILIWRGHEGRTGWELGLELVNPPDDYWGLDF |
| Ga0170824_1276714302 | 3300031231 | Forest Soil | VNLINQISCEAILIWRGHEGRTGWELGLELQEPSPDFWGLDF |
| Ga0318538_104149071 | 3300031546 | Soil | VLNMVNKEAADAILIWRGHEGRAGWELGIELQNAAEAFWGVEF |
| Ga0307468_1013908931 | 3300031740 | Hardwood Forest Soil | VSEATLIWRGHEGRTGWELGLELQNAPAEFWGVDF |
| Ga0307468_1016675721 | 3300031740 | Hardwood Forest Soil | AADAVLIWRGHEGRTGWELGLELREPPAEFWGVEF |
| Ga0307479_105419811 | 3300031962 | Hardwood Forest Soil | KLRLVNLTNQISCEAVLVWRGHQGRTGWELGLELREPSADFWGLDF |
| Ga0310911_103193391 | 3300032035 | Soil | VNRETADAILIWRGHEGRTGWELGLELQDAGQAFWGVEF |
| Ga0318505_103855751 | 3300032060 | Soil | ANKNSVDAILVWRGQEGRTGWEVGLELQGAGEEFWGMDF |
| Ga0306924_118537422 | 3300032076 | Soil | FALGQRLNLVNLLNSNRSVVVLIWRGHEGRAGWELGLELQEPPADFWGVEF |
| Ga0318540_104492732 | 3300032094 | Soil | VNKQTADAILIWRGHEGRAGWELGVELQDAGEEFWGVEF |
| Ga0335085_114755352 | 3300032770 | Soil | NLVNKHQCEAIVVWRGHEGRKGWELGIELQNPSVEFWEVDF |
| Ga0335083_105062662 | 3300032954 | Soil | QSVCEAILVWRGHEGRSGWELGLELQHATEEFWGLDF |
| ⦗Top⦘ |