Basic Information | |
---|---|
Family ID | F092755 |
Family Type | Metagenome |
Number of Sequences | 107 |
Average Sequence Length | 41 residues |
Representative Sequence | MLGLWLNDMESLEAISQDDEAKRIFLRMAAMSQDGRM |
Number of Associated Samples | 97 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 58.65 % |
% of genes near scaffold ends (potentially truncated) | 94.39 % |
% of genes from short scaffolds (< 2000 bps) | 85.05 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (58.879 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.626 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.972 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.944 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.23% β-sheet: 0.00% Coil/Unstructured: 50.77% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF02195 | ParBc | 28.97 |
PF02577 | BFN_dom | 9.35 |
PF13614 | AAA_31 | 5.61 |
PF02527 | GidB | 2.80 |
PF02096 | 60KD_IMP | 1.87 |
PF00072 | Response_reg | 0.93 |
PF01202 | SKI | 0.93 |
PF14804 | Jag_N | 0.93 |
PF08535 | KorB | 0.93 |
PF02517 | Rce1-like | 0.93 |
PF12840 | HTH_20 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
---|---|---|---|
COG1259 | Bifunctional DNase/RNase | General function prediction only [R] | 9.35 |
COG0357 | 16S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B) | Translation, ribosomal structure and biogenesis [J] | 2.80 |
COG0706 | Membrane protein insertase Oxa1/YidC/SpoIIIJ | Cell wall/membrane/envelope biogenesis [M] | 1.87 |
COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
COG1475 | Chromosome segregation protein Spo0J, contains ParB-like nuclease domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.93 |
COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 58.88 % |
All Organisms | root | All Organisms | 41.12 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_102203735 | Not Available | 1059 | Open in IMG/M |
3300001359|A3035W6_1081340 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300004480|Ga0062592_100941218 | Not Available | 783 | Open in IMG/M |
3300005164|Ga0066815_10097835 | Not Available | 548 | Open in IMG/M |
3300005343|Ga0070687_100060010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2005 | Open in IMG/M |
3300005356|Ga0070674_101525620 | Not Available | 601 | Open in IMG/M |
3300005518|Ga0070699_101515798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 615 | Open in IMG/M |
3300005553|Ga0066695_10836018 | Not Available | 529 | Open in IMG/M |
3300005569|Ga0066705_10899072 | Not Available | 526 | Open in IMG/M |
3300005575|Ga0066702_10159811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1340 | Open in IMG/M |
3300005576|Ga0066708_10655685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
3300005598|Ga0066706_10045733 | All Organisms → cellular organisms → Bacteria | 2924 | Open in IMG/M |
3300005598|Ga0066706_11225365 | Not Available | 569 | Open in IMG/M |
3300005764|Ga0066903_100522233 | All Organisms → cellular organisms → Bacteria | 2022 | Open in IMG/M |
3300005764|Ga0066903_105784130 | Not Available | 649 | Open in IMG/M |
3300006028|Ga0070717_10893013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 809 | Open in IMG/M |
3300006046|Ga0066652_100465631 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
3300006163|Ga0070715_11032861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
3300006173|Ga0070716_100656048 | Not Available | 796 | Open in IMG/M |
3300006791|Ga0066653_10435220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 669 | Open in IMG/M |
3300006806|Ga0079220_11026864 | Not Available | 658 | Open in IMG/M |
3300007004|Ga0079218_12112143 | Not Available | 650 | Open in IMG/M |
3300009012|Ga0066710_102327071 | Not Available | 778 | Open in IMG/M |
3300009088|Ga0099830_10899418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 732 | Open in IMG/M |
3300009090|Ga0099827_10129115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2045 | Open in IMG/M |
3300009098|Ga0105245_10053182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3634 | Open in IMG/M |
3300009137|Ga0066709_100209383 | All Organisms → cellular organisms → Bacteria | 2570 | Open in IMG/M |
3300009137|Ga0066709_100715787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1441 | Open in IMG/M |
3300009162|Ga0075423_12651704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
3300009551|Ga0105238_13065623 | Not Available | 501 | Open in IMG/M |
3300010320|Ga0134109_10483877 | Not Available | 508 | Open in IMG/M |
3300010323|Ga0134086_10299328 | Not Available | 624 | Open in IMG/M |
3300010329|Ga0134111_10444687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
3300010337|Ga0134062_10706390 | Not Available | 530 | Open in IMG/M |
3300010358|Ga0126370_12259805 | Not Available | 537 | Open in IMG/M |
3300010364|Ga0134066_10272982 | Not Available | 595 | Open in IMG/M |
3300010371|Ga0134125_11306976 | Not Available | 791 | Open in IMG/M |
3300010403|Ga0134123_10209886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1664 | Open in IMG/M |
3300012001|Ga0120167_1016445 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
3300012209|Ga0137379_10049823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4037 | Open in IMG/M |
3300012209|Ga0137379_11410626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
3300012356|Ga0137371_10493417 | Not Available | 945 | Open in IMG/M |
3300012361|Ga0137360_10790264 | Not Available | 817 | Open in IMG/M |
3300012897|Ga0157285_10104043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 786 | Open in IMG/M |
3300012897|Ga0157285_10308718 | Not Available | 541 | Open in IMG/M |
3300012925|Ga0137419_10147269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1695 | Open in IMG/M |
3300012925|Ga0137419_11141396 | Not Available | 650 | Open in IMG/M |
3300012971|Ga0126369_11116969 | Not Available | 877 | Open in IMG/M |
3300012976|Ga0134076_10496126 | Not Available | 557 | Open in IMG/M |
3300012977|Ga0134087_10269172 | Not Available | 788 | Open in IMG/M |
3300012984|Ga0164309_10636649 | Not Available | 838 | Open in IMG/M |
3300014166|Ga0134079_10667086 | Not Available | 526 | Open in IMG/M |
3300014326|Ga0157380_12511462 | Not Available | 581 | Open in IMG/M |
3300015241|Ga0137418_11118068 | Not Available | 560 | Open in IMG/M |
3300015358|Ga0134089_10155529 | Not Available | 904 | Open in IMG/M |
3300015372|Ga0132256_103045187 | Not Available | 563 | Open in IMG/M |
3300018027|Ga0184605_10313304 | Not Available | 710 | Open in IMG/M |
3300018052|Ga0184638_1016961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2541 | Open in IMG/M |
3300018061|Ga0184619_10256217 | Not Available | 804 | Open in IMG/M |
3300018071|Ga0184618_10040884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1645 | Open in IMG/M |
3300018081|Ga0184625_10319633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 809 | Open in IMG/M |
3300020001|Ga0193731_1129060 | Not Available | 637 | Open in IMG/M |
3300021082|Ga0210380_10027770 | All Organisms → cellular organisms → Bacteria | 2413 | Open in IMG/M |
3300022756|Ga0222622_10563020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 820 | Open in IMG/M |
3300022898|Ga0247745_1091175 | Not Available | 519 | Open in IMG/M |
3300023072|Ga0247799_1035810 | Not Available | 796 | Open in IMG/M |
3300025900|Ga0207710_10082996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1489 | Open in IMG/M |
3300025901|Ga0207688_10361671 | Not Available | 895 | Open in IMG/M |
3300025929|Ga0207664_11321483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 641 | Open in IMG/M |
3300025938|Ga0207704_11049072 | Not Available | 691 | Open in IMG/M |
3300025940|Ga0207691_11659901 | Not Available | 518 | Open in IMG/M |
3300026023|Ga0207677_10082320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2312 | Open in IMG/M |
3300026075|Ga0207708_11957349 | Not Available | 513 | Open in IMG/M |
3300026310|Ga0209239_1369849 | Not Available | 504 | Open in IMG/M |
3300026331|Ga0209267_1124806 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
3300026527|Ga0209059_1228422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 624 | Open in IMG/M |
3300026536|Ga0209058_1298956 | Not Available | 554 | Open in IMG/M |
3300027842|Ga0209580_10509670 | Not Available | 599 | Open in IMG/M |
3300027882|Ga0209590_10473529 | Not Available | 809 | Open in IMG/M |
3300027909|Ga0209382_10810826 | Not Available | 995 | Open in IMG/M |
3300028713|Ga0307303_10010996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1615 | Open in IMG/M |
3300028715|Ga0307313_10173617 | Not Available | 667 | Open in IMG/M |
3300028716|Ga0307311_10237628 | Not Available | 540 | Open in IMG/M |
3300028719|Ga0307301_10109382 | Not Available | 879 | Open in IMG/M |
3300028771|Ga0307320_10395577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
3300028799|Ga0307284_10173529 | Not Available | 839 | Open in IMG/M |
3300028803|Ga0307281_10266955 | Not Available | 632 | Open in IMG/M |
3300028807|Ga0307305_10336016 | Not Available | 686 | Open in IMG/M |
3300028811|Ga0307292_10024880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2133 | Open in IMG/M |
3300028819|Ga0307296_10653721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
3300028824|Ga0307310_10015184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2974 | Open in IMG/M |
3300028824|Ga0307310_10369738 | Not Available | 707 | Open in IMG/M |
3300028824|Ga0307310_10618593 | Not Available | 552 | Open in IMG/M |
3300028828|Ga0307312_10437191 | Not Available | 861 | Open in IMG/M |
3300028878|Ga0307278_10033200 | All Organisms → cellular organisms → Bacteria | 2357 | Open in IMG/M |
3300028880|Ga0307300_10224215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 616 | Open in IMG/M |
3300028880|Ga0307300_10322512 | Not Available | 527 | Open in IMG/M |
3300031740|Ga0307468_101177634 | Not Available | 689 | Open in IMG/M |
3300031939|Ga0308174_10644170 | Not Available | 880 | Open in IMG/M |
3300031949|Ga0214473_11634207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 644 | Open in IMG/M |
3300032205|Ga0307472_101863938 | Not Available | 599 | Open in IMG/M |
3300032898|Ga0335072_10985876 | Not Available | 776 | Open in IMG/M |
3300034113|Ga0364937_022039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1062 | Open in IMG/M |
3300034820|Ga0373959_0125688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.21% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.35% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.41% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.67% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.74% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.80% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.80% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.87% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.87% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.87% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.87% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.87% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.93% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.93% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.93% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001359 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-35cm)- 6 month illumina | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300034113 | Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17 | Environmental | Open in IMG/M |
3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1022037352 | 3300000956 | Soil | MVVMLGLWLDDMESLEAISQDDEAKRIFLRMAAMSRDGRMNNF |
A3035W6_10813404 | 3300001359 | Permafrost | MLGLWLNDMESLEAISQDDEARKIFLRMAAMSRDGRMNNFL |
Ga0062592_1009412182 | 3300004480 | Soil | MLGLWLNDMESLEAISQDDEARRIFLRMAAMSRDGRMNNFL |
Ga0066815_100978352 | 3300005164 | Soil | MFGEWLDDLESLEAISQDVEARQIFSHMAAMSQEGRLGTFLVE |
Ga0070687_1000600103 | 3300005343 | Switchgrass Rhizosphere | MLGLWLNDMESLEAICQDDEAKRIFLRMAAMSRDGNMGNF |
Ga0070674_1015256202 | 3300005356 | Miscanthus Rhizosphere | MMFGEWIEDLESLEAISQDAEARQIFLRMAAMSQEGRIGSFLVELAGTNEL |
Ga0070699_1015157983 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDGVDVAPSMLQPWLQDLESLEAITRSDDARKIFLKMAALSRTGRIP |
Ga0066695_108360182 | 3300005553 | Soil | MVSLWLNDIESLEAISQDAEAKQIFLRMAAMSRDGQIGTFL |
Ga0066705_108990721 | 3300005569 | Soil | MLGLWLHEMESLEAISQDDEAKRIFLRMAALSRDGQMGNFLTE |
Ga0066702_101598113 | 3300005575 | Soil | MLGVWVHDIESLEAISQDDEAKRIFLRMAALSRDGQM |
Ga0066708_106556852 | 3300005576 | Soil | MLGLWLQDLESLEAISQNDEARQIFLRMAALTQTGQ |
Ga0066706_100457331 | 3300005598 | Soil | MLGLWLHAMESLEAISQDDEAKRIFLRMAALSRDGQMGSFLTE |
Ga0066706_112253652 | 3300005598 | Soil | MLSEWMQDLESLEAISQDEEARKIFLRMAAMSQEGRL |
Ga0066903_1005222331 | 3300005764 | Tropical Forest Soil | MFPEWLEDLESLEAISQDAEARTIFTRMAEMSQEGR |
Ga0066903_1057841302 | 3300005764 | Tropical Forest Soil | MHGHWLQDLESLEAISQDADAKRIFLRMAAISQTGQMSTF |
Ga0070717_108930131 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLNLWLQDLESLEAISQDADARQIFLRMAAMSQTGRTSTLVTEIARD |
Ga0066652_1004656311 | 3300006046 | Soil | MFGEWLDDLESLEAISQDAEARQIFSRMAAMSQEGRLGTFLVELAGT |
Ga0070715_110328612 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MLNLWLQDLESLEAISQDADARQIFLRMAAMSQTGRTS |
Ga0070716_1006560482 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGLWLSDMESLEAISQDDEAKRIFLRMAAMSRDGQMKSFLNEV |
Ga0066653_104352201 | 3300006791 | Soil | MFAEWLEDLESLEAISQDAEARTIFSRMAAMSQEGRLGTFLVELA |
Ga0079220_110268642 | 3300006806 | Agricultural Soil | MLGLWLQHDMESLEAISQDDDAKRIFLRMAALSRDG |
Ga0079220_113701741 | 3300006806 | Agricultural Soil | MLGLWLQDLESLEAISQNDDARRIFLKMAAMSHDGRLPNFLLE |
Ga0075428_1011691882 | 3300006844 | Populus Rhizosphere | MLGLSHHDIEWLEAISQDADARELFLRMAALSQEG |
Ga0079218_121121431 | 3300007004 | Agricultural Soil | MFGEWMEDLESLEAISQDAEARQIFLRMAAMSQEGRLGSFLIELAGTPEL |
Ga0066710_1023270712 | 3300009012 | Grasslands Soil | MLGLWMQEMESLEAISQDDEAKRIFLRMAALSRDGQMGSFLTEL |
Ga0099830_108994182 | 3300009088 | Vadose Zone Soil | VSEWLQDIETLEAISQDEDAREIFLRMAAMAHQGVTRL* |
Ga0099827_101291151 | 3300009090 | Vadose Zone Soil | MLGLWLDDMESLEAISQDDEAKRIFLRMAAMSRDGQMKSFLNEVARDE |
Ga0105245_100531821 | 3300009098 | Miscanthus Rhizosphere | MFGEWMEDRESLEAISQDAEARQIFLRMAAMSQEGRIGSFLVELA |
Ga0066709_1002093835 | 3300009137 | Grasslands Soil | MLDPRLQDLESLEAISQDDVARKIFLKMAAMSHDGRLPGFLAEI |
Ga0066709_1007157873 | 3300009137 | Grasslands Soil | MLGLWLNDMESLEAISQDDEAKRIFLRMAALSRDGQMNNFLTEL |
Ga0075423_126517041 | 3300009162 | Populus Rhizosphere | MLGLWLHDLESLEAISQNDDARRIFLKMAAMSHDGRLPNFIA |
Ga0105238_130656231 | 3300009551 | Corn Rhizosphere | MFGEWMEDLESLEAISQDAEARQIFLRMAAMSQEGRIGSFLVE |
Ga0126306_101053901 | 3300010166 | Serpentine Soil | MLGLWQQDIEWLEAISQDADARALFLRMAALSQEG |
Ga0134109_104838771 | 3300010320 | Grasslands Soil | MLGLWLNHDVESLEAISQDDEAKRIFLRMAALSRDGHMGS |
Ga0134086_102993282 | 3300010323 | Grasslands Soil | MLGLWLNDLESLEAISQDDEARQIFLRMAAMSRDGQ |
Ga0134111_104446873 | 3300010329 | Grasslands Soil | MLGLWLQELESLEAISQDADTRRIFLKMAAMSHDG |
Ga0134062_107063901 | 3300010337 | Grasslands Soil | MLGLWLNHDIESLEAISQDDEAKRIFLRMAALSRDGQMGNFLTELA |
Ga0126370_122598052 | 3300010358 | Tropical Forest Soil | MFPEWLEDLESLEAISQDAEARTIFTRMAAMSQEGRLGTFLIELAGTPEL |
Ga0134066_102729821 | 3300010364 | Grasslands Soil | MLWLQQDMESLEAISQDDEAKRIFLRMAALSRDGQMGS |
Ga0134125_113069761 | 3300010371 | Terrestrial Soil | VLGLWLQDIDALEAISQNDDARRIFLRMAAMSHDGRLPSFL |
Ga0134123_102098863 | 3300010403 | Terrestrial Soil | VHGVWIHDLESLEAISQDDEARTIFLRMAALSQEGRLDSFLIELADR* |
Ga0120167_10164454 | 3300012001 | Permafrost | MLRLWLQDIESLEAISQNDEAKQIFLRMAAMSQAGRL |
Ga0137379_100498231 | 3300012209 | Vadose Zone Soil | MLGLWLHEMESLEAISQDDEAKRIFLRMAALSRDGRMGSFLTELA |
Ga0137379_114106262 | 3300012209 | Vadose Zone Soil | MLDPRLQDLESLEAISQDDVARKIFLKMAAMSHAGRLPGFL |
Ga0137371_104934172 | 3300012356 | Vadose Zone Soil | MLGLWLNDMESLEAISQDDEAKRIFLRMAALSRDGQ |
Ga0137360_107902642 | 3300012361 | Vadose Zone Soil | MLGLWLSDMESLEAISQDDEAKRIFLRMAAMSRDGQMKSFLNEVARDE* |
Ga0157285_101040431 | 3300012897 | Soil | MLGLWQSDDLESLEAISQNDEAKRIFLRMAALSQDGRLPQFLT |
Ga0157285_103087182 | 3300012897 | Soil | MFGEWLEDLESLEAISQDAEARQIFLRMAAMSQEGRIGSFLVELAGT |
Ga0137419_101472691 | 3300012925 | Vadose Zone Soil | MLGLWLNDMESLEAISQDAEAKRIFLRMAAMSRDGQMKNFLNE |
Ga0137419_111413963 | 3300012925 | Vadose Zone Soil | MLGLWLQELESLEAISQNADTRRIFLKMAAMSHDGRLPNFLA |
Ga0126369_111169692 | 3300012971 | Tropical Forest Soil | MFPEWLEDLESLEAISQDAEARTIFTRMAEMSQEGRLGTFLVELAGT |
Ga0134076_104961261 | 3300012976 | Grasslands Soil | MFAEWLDDLESLEAISQDAEARQIFSHMAAMSQEG |
Ga0134087_102691722 | 3300012977 | Grasslands Soil | MLGQWLQDLESLEAISQDDDAKRIFLRMAAISQTGGMSTFLTELAED |
Ga0164309_106366491 | 3300012984 | Soil | MLGSWLHDLESLEAISQDADAKAIFLRMAAMSREGQMGSFLTE |
Ga0134079_106670862 | 3300014166 | Grasslands Soil | MLGDWLQDLESLEAISQDDDAKRIFLRMAAISQTGQ |
Ga0157380_125114622 | 3300014326 | Switchgrass Rhizosphere | MFGEWIEDLESLEAISQDDEARQIFLRMAEMSQEGRIGSFLVELAG |
Ga0137418_111180681 | 3300015241 | Vadose Zone Soil | MLGLWLNDMESLEAISQDDEAKRIFLRMAAMSRDGQM |
Ga0134089_101555291 | 3300015358 | Grasslands Soil | MLGLWLQELESLEAISQDADTRRIFLKMAAMSHDGRLPN |
Ga0132256_1030451872 | 3300015372 | Arabidopsis Rhizosphere | MFGEWLDDLESLEAISQDVEARQIFSRMAAMSKEGQLGTFLVEL |
Ga0184605_103133041 | 3300018027 | Groundwater Sediment | MLGLWLNDMESLEAISQDDEAKRIFLRMAALSRDGQM |
Ga0184638_10169614 | 3300018052 | Groundwater Sediment | MLGLWLNDMESLEAISQDDEAKRIFLRMAAMSRDGQMKNF |
Ga0184619_102562171 | 3300018061 | Groundwater Sediment | MQDLESLEAISQDEEARKIFLRMAALSREGRLGSFLIELADTPELDE |
Ga0184618_100408843 | 3300018071 | Groundwater Sediment | MFGDWMQDLESLEAISQDEETRQIFLRMAALSQEGRLGSFLLELA |
Ga0184625_103196331 | 3300018081 | Groundwater Sediment | MLGLWAHDDLESLEAISQNDDTRRIFLRMAAMSQNGGLPQ |
Ga0193731_11290602 | 3300020001 | Soil | MLGLWLNDMESLEAISQDDEAKRIFLRMAALSRDG |
Ga0210380_100277704 | 3300021082 | Groundwater Sediment | MLGLWQNDDLESLEAISQNDEARRIFLRMAAMSQDGRLPQFLTELNY |
Ga0222622_105630202 | 3300022756 | Groundwater Sediment | MFGEWMHDLESFEAISQDDEARTIFLRMAALSQEGRLDSF |
Ga0247745_10911751 | 3300022898 | Soil | MFGEWMEDLESLEAISQDAEARQIFLRMAAMSQEGR |
Ga0247799_10358101 | 3300023072 | Soil | MFGEWLEDLESLEAISQDAEARQIFLRMAAMSQEGRIG |
Ga0207710_100829963 | 3300025900 | Switchgrass Rhizosphere | MLGLWLNDMESLEAICQDDEAKRIFLRMAAMSRDGNM |
Ga0207688_103616711 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGLWLNDMESLEAICQDDEAKRIFLRMAAMSRDGNMGNFLSE |
Ga0207664_113214833 | 3300025929 | Agricultural Soil | MLTPWLQDLESLEAISQNDDARKIFLRMAAMSHDGRLPNFIA |
Ga0207704_110490722 | 3300025938 | Miscanthus Rhizosphere | MFGEWIEDLESLEAISQDAEARQIFLRMAAMSQEGRIGSFL |
Ga0207691_116599011 | 3300025940 | Miscanthus Rhizosphere | MLGLWLNDIESLEAISQDDEAKRIFLRMAAMSRDGRM |
Ga0207677_100823201 | 3300026023 | Miscanthus Rhizosphere | MLGLWLNDMESLEAICQDDEAKRIFLRMAAMSRDGN |
Ga0207708_119573491 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MFGEWIDDLESLEAISQDAEARQIFLRMAAMSQEGRIGTFLV |
Ga0209239_13698491 | 3300026310 | Grasslands Soil | MHGQWLQDLESLEAISQDDDAKRIFLRMAAISQTGG |
Ga0209267_11248061 | 3300026331 | Soil | MLGLWLSDMESLEAISQDDEAKRIFLRMAAMSRDGQMGSFLNE |
Ga0209059_12284222 | 3300026527 | Soil | MLGLWLQDLESFEAISQNDEARQIFLRMAAMSQTGRTGSL |
Ga0209058_12989563 | 3300026536 | Soil | MLGLWLQELESLEAISQDADTRRIFLKMAAMSHDGRLPNFLAELAL |
Ga0209580_105096702 | 3300027842 | Surface Soil | MLGPWLQDLDALEAISQDADTRKIFLKMAAMSHAGRLPNFIAE |
Ga0209590_104735291 | 3300027882 | Vadose Zone Soil | LNGCMLGLWLNDMESLEAISQDDEAKRIFLRMAALSRDGQMGSFL |
Ga0209382_108108261 | 3300027909 | Populus Rhizosphere | MLGQWLDDMESLEAISQDGDAKRIFLRMAAMSRDGQIGAFLTALAR |
Ga0307303_100109961 | 3300028713 | Soil | MLGLWLNDMESLEAISQDDEAKRIFLRMAAMSRDGRMNNFLTELAH |
Ga0307313_101736172 | 3300028715 | Soil | MLGLWLTHDMESLEAISQDDEAKRIFLRMAALSRDGQMGS |
Ga0307311_102376282 | 3300028716 | Soil | MLGLWLTHDMESLEAISQDDEAKRIFLRMAALSRDGQM |
Ga0307301_101093821 | 3300028719 | Soil | MLGLWLNDMESLEAITQDHEARRIFLRMAAMSRDGQMNSF |
Ga0307320_103955772 | 3300028771 | Soil | MLGLWLQDLESFEAISQNDDARQIFLRMAAMSQAGRMGSFL |
Ga0307284_101735292 | 3300028799 | Soil | MLGLWLDDMESLEAISQDDEAKRIFLRMAAMSRDG |
Ga0307281_102669551 | 3300028803 | Soil | MLGLWLNEMESLEAISQDDEARRIFLRMAAMSRDG |
Ga0307305_103360161 | 3300028807 | Soil | MFGEWLQDLESFEAISQDAEARTIFMRMAAMSQEGRLDSFLI |
Ga0307292_100248804 | 3300028811 | Soil | MLGLWLTHDMESLEAISQDDEAKRIFLRMAALSRD |
Ga0307296_106537211 | 3300028819 | Soil | MFGEWMQDLESLEAISQDEETRQIFLRMAALSQEGRLGSFLIELADTSELDE |
Ga0307310_100151841 | 3300028824 | Soil | MFAEWLEDLESLEAISQDAEARTIFSRMAAMSQEGRLGTFL |
Ga0307310_103697381 | 3300028824 | Soil | MLVQWLQHDMESLEAISQDDEAKQIFLRMAALSRDGQMGSFLTELAR |
Ga0307310_106185931 | 3300028824 | Soil | MLGLWLHHDMESLEAISQDDEAKQIFLRMDAMSRD |
Ga0307312_104371912 | 3300028828 | Soil | MLGLWLNDMESLEAISQDDEAKRIFLRMAAMSQDGRM |
Ga0307278_100332004 | 3300028878 | Soil | MFGEWLDDLESLEAISQDAEARQIFSHMAAMSQEGRLATFLVEL |
Ga0307300_102242151 | 3300028880 | Soil | MLGLWQNDDLESLEAISQNDEAKRIFLRMAAMSQDGRLPQ |
Ga0307300_103225122 | 3300028880 | Soil | MLGLWLNDMESLEAISQDDEARRIFLRMAAMSRDGQMSSF |
Ga0307468_1011776342 | 3300031740 | Hardwood Forest Soil | MFAEWLEDLESLEAISQDAEARTIFSRMAAMSQEGRLGTFLIELAGTPDL |
Ga0308174_106441701 | 3300031939 | Soil | VTGGRFNDLEGFEAISQDDDARRIFLRMAAMSQQG |
Ga0214473_116342071 | 3300031949 | Soil | MLGLWPHDDLESLEAISQNADAKQIFLRMAAMSQDGRLPQFL |
Ga0307472_1018639381 | 3300032205 | Hardwood Forest Soil | MLRHWHQDLESFEAISQDVDAKRIFLRMAAISQTGQMST |
Ga0335072_109858762 | 3300032898 | Soil | VRCTGVSGLWLHDIESLEAISQDSETRRIFLRMADLAR |
Ga0364937_022039_2_106 | 3300034113 | Sediment | MLGLWQNDDLESLEAISQNDEAKRIFLRMAAMSQD |
Ga0373959_0125688_511_630 | 3300034820 | Rhizosphere Soil | MLGLWTHEDLESLEAISQNADAKRIFLRMAAMSQNGGLPQ |
⦗Top⦘ |