NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F092755

Metagenome Family F092755

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092755
Family Type Metagenome
Number of Sequences 107
Average Sequence Length 41 residues
Representative Sequence MLGLWLNDMESLEAISQDDEAKRIFLRMAAMSQDGRM
Number of Associated Samples 97
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 58.65 %
% of genes near scaffold ends (potentially truncated) 94.39 %
% of genes from short scaffolds (< 2000 bps) 85.05 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (58.879 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(19.626 % of family members)
Environment Ontology (ENVO) Unclassified
(28.972 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(57.944 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.23%    β-sheet: 0.00%    Coil/Unstructured: 50.77%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF02195ParBc 28.97
PF02577BFN_dom 9.35
PF13614AAA_31 5.61
PF02527GidB 2.80
PF0209660KD_IMP 1.87
PF00072Response_reg 0.93
PF01202SKI 0.93
PF14804Jag_N 0.93
PF08535KorB 0.93
PF02517Rce1-like 0.93
PF12840HTH_20 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG1259Bifunctional DNase/RNaseGeneral function prediction only [R] 9.35
COG035716S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B)Translation, ribosomal structure and biogenesis [J] 2.80
COG0706Membrane protein insertase Oxa1/YidC/SpoIIIJCell wall/membrane/envelope biogenesis [M] 1.87
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.93
COG1475Chromosome segregation protein Spo0J, contains ParB-like nuclease domainCell cycle control, cell division, chromosome partitioning [D] 0.93
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A58.88 %
All OrganismsrootAll Organisms41.12 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_102203735Not Available1059Open in IMG/M
3300001359|A3035W6_1081340All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300004480|Ga0062592_100941218Not Available783Open in IMG/M
3300005164|Ga0066815_10097835Not Available548Open in IMG/M
3300005343|Ga0070687_100060010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2005Open in IMG/M
3300005356|Ga0070674_101525620Not Available601Open in IMG/M
3300005518|Ga0070699_101515798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium615Open in IMG/M
3300005553|Ga0066695_10836018Not Available529Open in IMG/M
3300005569|Ga0066705_10899072Not Available526Open in IMG/M
3300005575|Ga0066702_10159811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1340Open in IMG/M
3300005576|Ga0066708_10655685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria668Open in IMG/M
3300005598|Ga0066706_10045733All Organisms → cellular organisms → Bacteria2924Open in IMG/M
3300005598|Ga0066706_11225365Not Available569Open in IMG/M
3300005764|Ga0066903_100522233All Organisms → cellular organisms → Bacteria2022Open in IMG/M
3300005764|Ga0066903_105784130Not Available649Open in IMG/M
3300006028|Ga0070717_10893013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium809Open in IMG/M
3300006046|Ga0066652_100465631All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300006163|Ga0070715_11032861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300006173|Ga0070716_100656048Not Available796Open in IMG/M
3300006791|Ga0066653_10435220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium669Open in IMG/M
3300006806|Ga0079220_11026864Not Available658Open in IMG/M
3300007004|Ga0079218_12112143Not Available650Open in IMG/M
3300009012|Ga0066710_102327071Not Available778Open in IMG/M
3300009088|Ga0099830_10899418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria732Open in IMG/M
3300009090|Ga0099827_10129115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2045Open in IMG/M
3300009098|Ga0105245_10053182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3634Open in IMG/M
3300009137|Ga0066709_100209383All Organisms → cellular organisms → Bacteria2570Open in IMG/M
3300009137|Ga0066709_100715787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1441Open in IMG/M
3300009162|Ga0075423_12651704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300009551|Ga0105238_13065623Not Available501Open in IMG/M
3300010320|Ga0134109_10483877Not Available508Open in IMG/M
3300010323|Ga0134086_10299328Not Available624Open in IMG/M
3300010329|Ga0134111_10444687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium561Open in IMG/M
3300010337|Ga0134062_10706390Not Available530Open in IMG/M
3300010358|Ga0126370_12259805Not Available537Open in IMG/M
3300010364|Ga0134066_10272982Not Available595Open in IMG/M
3300010371|Ga0134125_11306976Not Available791Open in IMG/M
3300010403|Ga0134123_10209886All Organisms → cellular organisms → Bacteria → Terrabacteria group1664Open in IMG/M
3300012001|Ga0120167_1016445All Organisms → cellular organisms → Bacteria1946Open in IMG/M
3300012209|Ga0137379_10049823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4037Open in IMG/M
3300012209|Ga0137379_11410626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium600Open in IMG/M
3300012356|Ga0137371_10493417Not Available945Open in IMG/M
3300012361|Ga0137360_10790264Not Available817Open in IMG/M
3300012897|Ga0157285_10104043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria786Open in IMG/M
3300012897|Ga0157285_10308718Not Available541Open in IMG/M
3300012925|Ga0137419_10147269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1695Open in IMG/M
3300012925|Ga0137419_11141396Not Available650Open in IMG/M
3300012971|Ga0126369_11116969Not Available877Open in IMG/M
3300012976|Ga0134076_10496126Not Available557Open in IMG/M
3300012977|Ga0134087_10269172Not Available788Open in IMG/M
3300012984|Ga0164309_10636649Not Available838Open in IMG/M
3300014166|Ga0134079_10667086Not Available526Open in IMG/M
3300014326|Ga0157380_12511462Not Available581Open in IMG/M
3300015241|Ga0137418_11118068Not Available560Open in IMG/M
3300015358|Ga0134089_10155529Not Available904Open in IMG/M
3300015372|Ga0132256_103045187Not Available563Open in IMG/M
3300018027|Ga0184605_10313304Not Available710Open in IMG/M
3300018052|Ga0184638_1016961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2541Open in IMG/M
3300018061|Ga0184619_10256217Not Available804Open in IMG/M
3300018071|Ga0184618_10040884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1645Open in IMG/M
3300018081|Ga0184625_10319633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria809Open in IMG/M
3300020001|Ga0193731_1129060Not Available637Open in IMG/M
3300021082|Ga0210380_10027770All Organisms → cellular organisms → Bacteria2413Open in IMG/M
3300022756|Ga0222622_10563020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria820Open in IMG/M
3300022898|Ga0247745_1091175Not Available519Open in IMG/M
3300023072|Ga0247799_1035810Not Available796Open in IMG/M
3300025900|Ga0207710_10082996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1489Open in IMG/M
3300025901|Ga0207688_10361671Not Available895Open in IMG/M
3300025929|Ga0207664_11321483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium641Open in IMG/M
3300025938|Ga0207704_11049072Not Available691Open in IMG/M
3300025940|Ga0207691_11659901Not Available518Open in IMG/M
3300026023|Ga0207677_10082320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2312Open in IMG/M
3300026075|Ga0207708_11957349Not Available513Open in IMG/M
3300026310|Ga0209239_1369849Not Available504Open in IMG/M
3300026331|Ga0209267_1124806All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300026527|Ga0209059_1228422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium624Open in IMG/M
3300026536|Ga0209058_1298956Not Available554Open in IMG/M
3300027842|Ga0209580_10509670Not Available599Open in IMG/M
3300027882|Ga0209590_10473529Not Available809Open in IMG/M
3300027909|Ga0209382_10810826Not Available995Open in IMG/M
3300028713|Ga0307303_10010996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1615Open in IMG/M
3300028715|Ga0307313_10173617Not Available667Open in IMG/M
3300028716|Ga0307311_10237628Not Available540Open in IMG/M
3300028719|Ga0307301_10109382Not Available879Open in IMG/M
3300028771|Ga0307320_10395577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300028799|Ga0307284_10173529Not Available839Open in IMG/M
3300028803|Ga0307281_10266955Not Available632Open in IMG/M
3300028807|Ga0307305_10336016Not Available686Open in IMG/M
3300028811|Ga0307292_10024880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2133Open in IMG/M
3300028819|Ga0307296_10653721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria575Open in IMG/M
3300028824|Ga0307310_10015184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2974Open in IMG/M
3300028824|Ga0307310_10369738Not Available707Open in IMG/M
3300028824|Ga0307310_10618593Not Available552Open in IMG/M
3300028828|Ga0307312_10437191Not Available861Open in IMG/M
3300028878|Ga0307278_10033200All Organisms → cellular organisms → Bacteria2357Open in IMG/M
3300028880|Ga0307300_10224215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria616Open in IMG/M
3300028880|Ga0307300_10322512Not Available527Open in IMG/M
3300031740|Ga0307468_101177634Not Available689Open in IMG/M
3300031939|Ga0308174_10644170Not Available880Open in IMG/M
3300031949|Ga0214473_11634207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria644Open in IMG/M
3300032205|Ga0307472_101863938Not Available599Open in IMG/M
3300032898|Ga0335072_10985876Not Available776Open in IMG/M
3300034113|Ga0364937_022039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1062Open in IMG/M
3300034820|Ga0373959_0125688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria631Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil19.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.21%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.35%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil8.41%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.74%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.80%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.87%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.87%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.87%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.93%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.93%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.93%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.93%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001359Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-35cm)- 6 month illuminaEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012001Permafrost microbial communities from Nunavut, Canada - A24_80cm_12MEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300023072Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026527Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300034113Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10220373523300000956SoilMVVMLGLWLDDMESLEAISQDDEAKRIFLRMAAMSRDGRMNNF
A3035W6_108134043300001359PermafrostMLGLWLNDMESLEAISQDDEARKIFLRMAAMSRDGRMNNFL
Ga0062592_10094121823300004480SoilMLGLWLNDMESLEAISQDDEARRIFLRMAAMSRDGRMNNFL
Ga0066815_1009783523300005164SoilMFGEWLDDLESLEAISQDVEARQIFSHMAAMSQEGRLGTFLVE
Ga0070687_10006001033300005343Switchgrass RhizosphereMLGLWLNDMESLEAICQDDEAKRIFLRMAAMSRDGNMGNF
Ga0070674_10152562023300005356Miscanthus RhizosphereMMFGEWIEDLESLEAISQDAEARQIFLRMAAMSQEGRIGSFLVELAGTNEL
Ga0070699_10151579833300005518Corn, Switchgrass And Miscanthus RhizosphereMDGVDVAPSMLQPWLQDLESLEAITRSDDARKIFLKMAALSRTGRIP
Ga0066695_1083601823300005553SoilMVSLWLNDIESLEAISQDAEAKQIFLRMAAMSRDGQIGTFL
Ga0066705_1089907213300005569SoilMLGLWLHEMESLEAISQDDEAKRIFLRMAALSRDGQMGNFLTE
Ga0066702_1015981133300005575SoilMLGVWVHDIESLEAISQDDEAKRIFLRMAALSRDGQM
Ga0066708_1065568523300005576SoilMLGLWLQDLESLEAISQNDEARQIFLRMAALTQTGQ
Ga0066706_1004573313300005598SoilMLGLWLHAMESLEAISQDDEAKRIFLRMAALSRDGQMGSFLTE
Ga0066706_1122536523300005598SoilMLSEWMQDLESLEAISQDEEARKIFLRMAAMSQEGRL
Ga0066903_10052223313300005764Tropical Forest SoilMFPEWLEDLESLEAISQDAEARTIFTRMAEMSQEGR
Ga0066903_10578413023300005764Tropical Forest SoilMHGHWLQDLESLEAISQDADAKRIFLRMAAISQTGQMSTF
Ga0070717_1089301313300006028Corn, Switchgrass And Miscanthus RhizosphereMLNLWLQDLESLEAISQDADARQIFLRMAAMSQTGRTSTLVTEIARD
Ga0066652_10046563113300006046SoilMFGEWLDDLESLEAISQDAEARQIFSRMAAMSQEGRLGTFLVELAGT
Ga0070715_1103286123300006163Corn, Switchgrass And Miscanthus RhizosphereMLNLWLQDLESLEAISQDADARQIFLRMAAMSQTGRTS
Ga0070716_10065604823300006173Corn, Switchgrass And Miscanthus RhizosphereMLGLWLSDMESLEAISQDDEAKRIFLRMAAMSRDGQMKSFLNEV
Ga0066653_1043522013300006791SoilMFAEWLEDLESLEAISQDAEARTIFSRMAAMSQEGRLGTFLVELA
Ga0079220_1102686423300006806Agricultural SoilMLGLWLQHDMESLEAISQDDDAKRIFLRMAALSRDG
Ga0079220_1137017413300006806Agricultural SoilMLGLWLQDLESLEAISQNDDARRIFLKMAAMSHDGRLPNFLLE
Ga0075428_10116918823300006844Populus RhizosphereMLGLSHHDIEWLEAISQDADARELFLRMAALSQEG
Ga0079218_1211214313300007004Agricultural SoilMFGEWMEDLESLEAISQDAEARQIFLRMAAMSQEGRLGSFLIELAGTPEL
Ga0066710_10232707123300009012Grasslands SoilMLGLWMQEMESLEAISQDDEAKRIFLRMAALSRDGQMGSFLTEL
Ga0099830_1089941823300009088Vadose Zone SoilVSEWLQDIETLEAISQDEDAREIFLRMAAMAHQGVTRL*
Ga0099827_1012911513300009090Vadose Zone SoilMLGLWLDDMESLEAISQDDEAKRIFLRMAAMSRDGQMKSFLNEVARDE
Ga0105245_1005318213300009098Miscanthus RhizosphereMFGEWMEDRESLEAISQDAEARQIFLRMAAMSQEGRIGSFLVELA
Ga0066709_10020938353300009137Grasslands SoilMLDPRLQDLESLEAISQDDVARKIFLKMAAMSHDGRLPGFLAEI
Ga0066709_10071578733300009137Grasslands SoilMLGLWLNDMESLEAISQDDEAKRIFLRMAALSRDGQMNNFLTEL
Ga0075423_1265170413300009162Populus RhizosphereMLGLWLHDLESLEAISQNDDARRIFLKMAAMSHDGRLPNFIA
Ga0105238_1306562313300009551Corn RhizosphereMFGEWMEDLESLEAISQDAEARQIFLRMAAMSQEGRIGSFLVE
Ga0126306_1010539013300010166Serpentine SoilMLGLWQQDIEWLEAISQDADARALFLRMAALSQEG
Ga0134109_1048387713300010320Grasslands SoilMLGLWLNHDVESLEAISQDDEAKRIFLRMAALSRDGHMGS
Ga0134086_1029932823300010323Grasslands SoilMLGLWLNDLESLEAISQDDEARQIFLRMAAMSRDGQ
Ga0134111_1044468733300010329Grasslands SoilMLGLWLQELESLEAISQDADTRRIFLKMAAMSHDG
Ga0134062_1070639013300010337Grasslands SoilMLGLWLNHDIESLEAISQDDEAKRIFLRMAALSRDGQMGNFLTELA
Ga0126370_1225980523300010358Tropical Forest SoilMFPEWLEDLESLEAISQDAEARTIFTRMAAMSQEGRLGTFLIELAGTPEL
Ga0134066_1027298213300010364Grasslands SoilMLWLQQDMESLEAISQDDEAKRIFLRMAALSRDGQMGS
Ga0134125_1130697613300010371Terrestrial SoilVLGLWLQDIDALEAISQNDDARRIFLRMAAMSHDGRLPSFL
Ga0134123_1020988633300010403Terrestrial SoilVHGVWIHDLESLEAISQDDEARTIFLRMAALSQEGRLDSFLIELADR*
Ga0120167_101644543300012001PermafrostMLRLWLQDIESLEAISQNDEAKQIFLRMAAMSQAGRL
Ga0137379_1004982313300012209Vadose Zone SoilMLGLWLHEMESLEAISQDDEAKRIFLRMAALSRDGRMGSFLTELA
Ga0137379_1141062623300012209Vadose Zone SoilMLDPRLQDLESLEAISQDDVARKIFLKMAAMSHAGRLPGFL
Ga0137371_1049341723300012356Vadose Zone SoilMLGLWLNDMESLEAISQDDEAKRIFLRMAALSRDGQ
Ga0137360_1079026423300012361Vadose Zone SoilMLGLWLSDMESLEAISQDDEAKRIFLRMAAMSRDGQMKSFLNEVARDE*
Ga0157285_1010404313300012897SoilMLGLWQSDDLESLEAISQNDEAKRIFLRMAALSQDGRLPQFLT
Ga0157285_1030871823300012897SoilMFGEWLEDLESLEAISQDAEARQIFLRMAAMSQEGRIGSFLVELAGT
Ga0137419_1014726913300012925Vadose Zone SoilMLGLWLNDMESLEAISQDAEAKRIFLRMAAMSRDGQMKNFLNE
Ga0137419_1114139633300012925Vadose Zone SoilMLGLWLQELESLEAISQNADTRRIFLKMAAMSHDGRLPNFLA
Ga0126369_1111696923300012971Tropical Forest SoilMFPEWLEDLESLEAISQDAEARTIFTRMAEMSQEGRLGTFLVELAGT
Ga0134076_1049612613300012976Grasslands SoilMFAEWLDDLESLEAISQDAEARQIFSHMAAMSQEG
Ga0134087_1026917223300012977Grasslands SoilMLGQWLQDLESLEAISQDDDAKRIFLRMAAISQTGGMSTFLTELAED
Ga0164309_1063664913300012984SoilMLGSWLHDLESLEAISQDADAKAIFLRMAAMSREGQMGSFLTE
Ga0134079_1066708623300014166Grasslands SoilMLGDWLQDLESLEAISQDDDAKRIFLRMAAISQTGQ
Ga0157380_1251146223300014326Switchgrass RhizosphereMFGEWIEDLESLEAISQDDEARQIFLRMAEMSQEGRIGSFLVELAG
Ga0137418_1111806813300015241Vadose Zone SoilMLGLWLNDMESLEAISQDDEAKRIFLRMAAMSRDGQM
Ga0134089_1015552913300015358Grasslands SoilMLGLWLQELESLEAISQDADTRRIFLKMAAMSHDGRLPN
Ga0132256_10304518723300015372Arabidopsis RhizosphereMFGEWLDDLESLEAISQDVEARQIFSRMAAMSKEGQLGTFLVEL
Ga0184605_1031330413300018027Groundwater SedimentMLGLWLNDMESLEAISQDDEAKRIFLRMAALSRDGQM
Ga0184638_101696143300018052Groundwater SedimentMLGLWLNDMESLEAISQDDEAKRIFLRMAAMSRDGQMKNF
Ga0184619_1025621713300018061Groundwater SedimentMQDLESLEAISQDEEARKIFLRMAALSREGRLGSFLIELADTPELDE
Ga0184618_1004088433300018071Groundwater SedimentMFGDWMQDLESLEAISQDEETRQIFLRMAALSQEGRLGSFLLELA
Ga0184625_1031963313300018081Groundwater SedimentMLGLWAHDDLESLEAISQNDDTRRIFLRMAAMSQNGGLPQ
Ga0193731_112906023300020001SoilMLGLWLNDMESLEAISQDDEAKRIFLRMAALSRDG
Ga0210380_1002777043300021082Groundwater SedimentMLGLWQNDDLESLEAISQNDEARRIFLRMAAMSQDGRLPQFLTELNY
Ga0222622_1056302023300022756Groundwater SedimentMFGEWMHDLESFEAISQDDEARTIFLRMAALSQEGRLDSF
Ga0247745_109117513300022898SoilMFGEWMEDLESLEAISQDAEARQIFLRMAAMSQEGR
Ga0247799_103581013300023072SoilMFGEWLEDLESLEAISQDAEARQIFLRMAAMSQEGRIG
Ga0207710_1008299633300025900Switchgrass RhizosphereMLGLWLNDMESLEAICQDDEAKRIFLRMAAMSRDGNM
Ga0207688_1036167113300025901Corn, Switchgrass And Miscanthus RhizosphereMLGLWLNDMESLEAICQDDEAKRIFLRMAAMSRDGNMGNFLSE
Ga0207664_1132148333300025929Agricultural SoilMLTPWLQDLESLEAISQNDDARKIFLRMAAMSHDGRLPNFIA
Ga0207704_1104907223300025938Miscanthus RhizosphereMFGEWIEDLESLEAISQDAEARQIFLRMAAMSQEGRIGSFL
Ga0207691_1165990113300025940Miscanthus RhizosphereMLGLWLNDIESLEAISQDDEAKRIFLRMAAMSRDGRM
Ga0207677_1008232013300026023Miscanthus RhizosphereMLGLWLNDMESLEAICQDDEAKRIFLRMAAMSRDGN
Ga0207708_1195734913300026075Corn, Switchgrass And Miscanthus RhizosphereMFGEWIDDLESLEAISQDAEARQIFLRMAAMSQEGRIGTFLV
Ga0209239_136984913300026310Grasslands SoilMHGQWLQDLESLEAISQDDDAKRIFLRMAAISQTGG
Ga0209267_112480613300026331SoilMLGLWLSDMESLEAISQDDEAKRIFLRMAAMSRDGQMGSFLNE
Ga0209059_122842223300026527SoilMLGLWLQDLESFEAISQNDEARQIFLRMAAMSQTGRTGSL
Ga0209058_129895633300026536SoilMLGLWLQELESLEAISQDADTRRIFLKMAAMSHDGRLPNFLAELAL
Ga0209580_1050967023300027842Surface SoilMLGPWLQDLDALEAISQDADTRKIFLKMAAMSHAGRLPNFIAE
Ga0209590_1047352913300027882Vadose Zone SoilLNGCMLGLWLNDMESLEAISQDDEAKRIFLRMAALSRDGQMGSFL
Ga0209382_1081082613300027909Populus RhizosphereMLGQWLDDMESLEAISQDGDAKRIFLRMAAMSRDGQIGAFLTALAR
Ga0307303_1001099613300028713SoilMLGLWLNDMESLEAISQDDEAKRIFLRMAAMSRDGRMNNFLTELAH
Ga0307313_1017361723300028715SoilMLGLWLTHDMESLEAISQDDEAKRIFLRMAALSRDGQMGS
Ga0307311_1023762823300028716SoilMLGLWLTHDMESLEAISQDDEAKRIFLRMAALSRDGQM
Ga0307301_1010938213300028719SoilMLGLWLNDMESLEAITQDHEARRIFLRMAAMSRDGQMNSF
Ga0307320_1039557723300028771SoilMLGLWLQDLESFEAISQNDDARQIFLRMAAMSQAGRMGSFL
Ga0307284_1017352923300028799SoilMLGLWLDDMESLEAISQDDEAKRIFLRMAAMSRDG
Ga0307281_1026695513300028803SoilMLGLWLNEMESLEAISQDDEARRIFLRMAAMSRDG
Ga0307305_1033601613300028807SoilMFGEWLQDLESFEAISQDAEARTIFMRMAAMSQEGRLDSFLI
Ga0307292_1002488043300028811SoilMLGLWLTHDMESLEAISQDDEAKRIFLRMAALSRD
Ga0307296_1065372113300028819SoilMFGEWMQDLESLEAISQDEETRQIFLRMAALSQEGRLGSFLIELADTSELDE
Ga0307310_1001518413300028824SoilMFAEWLEDLESLEAISQDAEARTIFSRMAAMSQEGRLGTFL
Ga0307310_1036973813300028824SoilMLVQWLQHDMESLEAISQDDEAKQIFLRMAALSRDGQMGSFLTELAR
Ga0307310_1061859313300028824SoilMLGLWLHHDMESLEAISQDDEAKQIFLRMDAMSRD
Ga0307312_1043719123300028828SoilMLGLWLNDMESLEAISQDDEAKRIFLRMAAMSQDGRM
Ga0307278_1003320043300028878SoilMFGEWLDDLESLEAISQDAEARQIFSHMAAMSQEGRLATFLVEL
Ga0307300_1022421513300028880SoilMLGLWQNDDLESLEAISQNDEAKRIFLRMAAMSQDGRLPQ
Ga0307300_1032251223300028880SoilMLGLWLNDMESLEAISQDDEARRIFLRMAAMSRDGQMSSF
Ga0307468_10117763423300031740Hardwood Forest SoilMFAEWLEDLESLEAISQDAEARTIFSRMAAMSQEGRLGTFLIELAGTPDL
Ga0308174_1064417013300031939SoilVTGGRFNDLEGFEAISQDDDARRIFLRMAAMSQQG
Ga0214473_1163420713300031949SoilMLGLWPHDDLESLEAISQNADAKQIFLRMAAMSQDGRLPQFL
Ga0307472_10186393813300032205Hardwood Forest SoilMLRHWHQDLESFEAISQDVDAKRIFLRMAAISQTGQMST
Ga0335072_1098587623300032898SoilVRCTGVSGLWLHDIESLEAISQDSETRRIFLRMADLAR
Ga0364937_022039_2_1063300034113SedimentMLGLWQNDDLESLEAISQNDEAKRIFLRMAAMSQD
Ga0373959_0125688_511_6303300034820Rhizosphere SoilMLGLWTHEDLESLEAISQNADAKRIFLRMAAMSQNGGLPQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.