NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092725

Metagenome / Metatranscriptome Family F092725

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092725
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 117 residues
Representative Sequence LLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Number of Associated Samples 91
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.93 %
% of genes near scaffold ends (potentially truncated) 98.13 %
% of genes from short scaffolds (< 2000 bps) 92.52 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(24.299 % of family members)
Environment Ontology (ENVO) Unclassified
(82.243 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(82.243 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.95%    β-sheet: 22.03%    Coil/Unstructured: 61.02%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF01786AOX 64.49
PF05222AlaDh_PNT_N 7.48
PF09834DUF2061 7.48
PF00265TK 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG1435Thymidine kinaseNucleotide transport and metabolism [F] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10129352All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium778Open in IMG/M
3300000325|SI39nov09_100mDRAFT_1070164All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster538Open in IMG/M
3300000930|BpDRAFT_10016432All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster574Open in IMG/M
3300001936|GOS2220_1020653All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1333Open in IMG/M
3300001940|GOS2222_1009034All Organisms → cellular organisms → Bacteria1833Open in IMG/M
3300003271|JGI26114J46594_1041882All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium697Open in IMG/M
3300003500|JGI26242J51144_1052518All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium674Open in IMG/M
3300003596|JGI26255J51710_1089425All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria506Open in IMG/M
3300006164|Ga0075441_10185499All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria778Open in IMG/M
3300006190|Ga0075446_10226351All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria519Open in IMG/M
3300006191|Ga0075447_10052648All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1496Open in IMG/M
3300006191|Ga0075447_10255283All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria567Open in IMG/M
3300006193|Ga0075445_10241760All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster620Open in IMG/M
3300006352|Ga0075448_10220326All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria578Open in IMG/M
3300006947|Ga0075444_10227603All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium742Open in IMG/M
3300006947|Ga0075444_10227604All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium742Open in IMG/M
3300006947|Ga0075444_10311821All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria605Open in IMG/M
3300007718|Ga0102852_1100843All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster571Open in IMG/M
3300007863|Ga0105744_1027615All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster1420Open in IMG/M
3300007956|Ga0105741_1071220All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium850Open in IMG/M
3300007962|Ga0102907_1031285All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster1486Open in IMG/M
3300007962|Ga0102907_1095207All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium779Open in IMG/M
3300008956|Ga0104261_1017284All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → unclassified Rhodobiaceae → Rhodobiaceae bacterium851Open in IMG/M
3300008964|Ga0102889_1094072All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster891Open in IMG/M
3300009052|Ga0102886_1172399All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria642Open in IMG/M
3300009054|Ga0102826_1081070All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium776Open in IMG/M
3300009071|Ga0115566_10181371All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster1296Open in IMG/M
3300009141|Ga0102884_1206265All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster503Open in IMG/M
3300009172|Ga0114995_10620943All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster591Open in IMG/M
3300009422|Ga0114998_10529141All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium553Open in IMG/M
3300009425|Ga0114997_10581138All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium591Open in IMG/M
3300009425|Ga0114997_10610410All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium574Open in IMG/M
3300009437|Ga0115556_1160640All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster825Open in IMG/M
3300009438|Ga0115559_1158673All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster837Open in IMG/M
3300009445|Ga0115553_1216582All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium758Open in IMG/M
3300009495|Ga0115571_1024092All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster3062Open in IMG/M
3300009496|Ga0115570_10278735All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium730Open in IMG/M
3300009496|Ga0115570_10445334All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster546Open in IMG/M
3300009497|Ga0115569_10268865All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium760Open in IMG/M
3300009512|Ga0115003_10831244All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria537Open in IMG/M
3300009526|Ga0115004_10539824All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium690Open in IMG/M
3300009526|Ga0115004_10599603All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium653Open in IMG/M
3300009706|Ga0115002_10798546All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium659Open in IMG/M
3300009785|Ga0115001_10460629All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria788Open in IMG/M
3300020169|Ga0206127_1268008All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster582Open in IMG/M
3300020317|Ga0211688_1041525All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria940Open in IMG/M
3300020335|Ga0211690_1021250All Organisms → cellular organisms → Bacteria → Proteobacteria1662Open in IMG/M
3300020347|Ga0211504_1049582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → unclassified Rhodobiaceae → Rhodobiaceae bacterium1004Open in IMG/M
3300020358|Ga0211689_1087263All Organisms → cellular organisms → Bacteria → Proteobacteria889Open in IMG/M
3300020431|Ga0211554_10112585All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A1374Open in IMG/M
3300021185|Ga0206682_10262355All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium764Open in IMG/M
(restricted) 3300022931|Ga0233433_10004831All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria10195Open in IMG/M
3300024343|Ga0244777_10667132All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster625Open in IMG/M
3300024346|Ga0244775_11015252All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster654Open in IMG/M
3300025621|Ga0209504_1157278All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster536Open in IMG/M
3300025622|Ga0209264_1026260All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1734Open in IMG/M
3300025681|Ga0209263_1149969All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium668Open in IMG/M
3300025688|Ga0209140_1173657All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium617Open in IMG/M
3300025699|Ga0209715_1133193All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium863Open in IMG/M
3300025722|Ga0209660_1144530All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium796Open in IMG/M
3300025729|Ga0209558_1185732All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium674Open in IMG/M
3300025869|Ga0209308_10093132All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster1473Open in IMG/M
3300025869|Ga0209308_10100934All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster1396Open in IMG/M
3300025870|Ga0209666_1383586All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster528Open in IMG/M
3300025894|Ga0209335_10325581All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster645Open in IMG/M
3300026511|Ga0233395_1016835All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2597Open in IMG/M
3300027048|Ga0208962_1054389All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster558Open in IMG/M
3300027233|Ga0208678_1110361All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster507Open in IMG/M
3300027506|Ga0208973_1095915All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium676Open in IMG/M
3300027522|Ga0209384_1050940All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1117Open in IMG/M
3300027522|Ga0209384_1062087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → unclassified Rhodobiaceae → Rhodobiaceae bacterium973Open in IMG/M
3300027571|Ga0208897_1070896All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → unclassified Rhodobiaceae → Rhodobiaceae bacterium907Open in IMG/M
3300027668|Ga0209482_1036953All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1904Open in IMG/M
3300027672|Ga0209383_1038843All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1865Open in IMG/M
3300027672|Ga0209383_1200705All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria581Open in IMG/M
3300027672|Ga0209383_1217551All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria545Open in IMG/M
3300027704|Ga0209816_1168722All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria760Open in IMG/M
3300027714|Ga0209815_1027151All Organisms → cellular organisms → Bacteria → Proteobacteria2287Open in IMG/M
3300027714|Ga0209815_1150761All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria742Open in IMG/M
3300027714|Ga0209815_1256192All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria527Open in IMG/M
3300027751|Ga0208304_10072309All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A1319Open in IMG/M
3300027753|Ga0208305_10012542All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3525Open in IMG/M
3300027780|Ga0209502_10069045All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A1877Open in IMG/M
3300027788|Ga0209711_10053959All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2196Open in IMG/M
3300027788|Ga0209711_10425750All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria537Open in IMG/M
3300027801|Ga0209091_10259858All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster840Open in IMG/M
3300028194|Ga0257106_1295439All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster531Open in IMG/M
3300028397|Ga0228639_1084155All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium824Open in IMG/M
3300028418|Ga0228615_1027024All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1889Open in IMG/M
3300031142|Ga0308022_1158780All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium648Open in IMG/M
3300031594|Ga0302131_1047536All Organisms → cellular organisms → Bacteria1617Open in IMG/M
3300031596|Ga0302134_10279447All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium643Open in IMG/M
3300031596|Ga0302134_10368641All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria531Open in IMG/M
3300031612|Ga0308009_10208283All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria732Open in IMG/M
3300031621|Ga0302114_10097730All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A1355Open in IMG/M
3300031625|Ga0302135_10122111All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86A1218Open in IMG/M
3300031626|Ga0302121_10076296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → unclassified Rhodobiaceae → Rhodobiaceae bacterium1006Open in IMG/M
3300031627|Ga0302118_10440996All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster579Open in IMG/M
3300031644|Ga0308001_10264626All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria658Open in IMG/M
3300031646|Ga0302133_10176384All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodobiaceae → unclassified Rhodobiaceae → Rhodobiaceae bacterium1069Open in IMG/M
3300031675|Ga0302122_10003771All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria9089Open in IMG/M
3300031676|Ga0302136_1025400All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2150Open in IMG/M
3300031676|Ga0302136_1116003All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium853Open in IMG/M
3300031700|Ga0302130_1030572All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1806Open in IMG/M
3300031766|Ga0315322_10650755All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium668Open in IMG/M
3300031851|Ga0315320_10745575All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium622Open in IMG/M
3300032151|Ga0302127_10212625All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster848Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine24.30%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine24.30%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine11.21%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine11.21%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine10.28%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.80%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater2.80%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.80%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.87%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.87%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.93%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.93%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.93%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.93%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.93%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.93%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.93%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000325Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 100mEnvironmentalOpen in IMG/M
3300000930Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16mEnvironmentalOpen in IMG/M
3300001936Marine microbial communities from Halifax, Nova Scotia, Canada - GS004EnvironmentalOpen in IMG/M
3300001940Marine microbial communities from Bay of Fundy, Nova Scotia, Canada - GS006EnvironmentalOpen in IMG/M
3300003271Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10EnvironmentalOpen in IMG/M
3300003500Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_100m_DNAEnvironmentalOpen in IMG/M
3300003596Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI073_LV_135m_DNAEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006190Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNAEnvironmentalOpen in IMG/M
3300006191Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNAEnvironmentalOpen in IMG/M
3300006193Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNAEnvironmentalOpen in IMG/M
3300006352Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNAEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300007718Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3EnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300007956Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2umEnvironmentalOpen in IMG/M
3300007962Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02EnvironmentalOpen in IMG/M
3300008956Marine microbial communities from eastern North Pacific Ocean - P8 free-living McLaneEnvironmentalOpen in IMG/M
3300008964Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02EnvironmentalOpen in IMG/M
3300009052Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02EnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009141Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009437Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414EnvironmentalOpen in IMG/M
3300009438Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009706Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300020169Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1EnvironmentalOpen in IMG/M
3300020317Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555998-ERR599027)EnvironmentalOpen in IMG/M
3300020335Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX556030-ERR599035)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020358Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009)EnvironmentalOpen in IMG/M
3300020431Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983)EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300022931 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MGEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025621Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes)EnvironmentalOpen in IMG/M
3300025622Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_150m (SPAdes)EnvironmentalOpen in IMG/M
3300025681Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100m (SPAdes)EnvironmentalOpen in IMG/M
3300025688Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_120m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025722Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025729Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_150m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025870Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300026511Seawater microbial communities from Monterey Bay, California, United States - 27DEnvironmentalOpen in IMG/M
3300027048Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C43A7_80 (SPAdes)EnvironmentalOpen in IMG/M
3300027233Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027506Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027522Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027571Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes)EnvironmentalOpen in IMG/M
3300027668Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027672Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027704Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027751Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027788Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300028194Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10mEnvironmentalOpen in IMG/M
3300028397Seawater microbial communities from Monterey Bay, California, United States - 50DEnvironmentalOpen in IMG/M
3300028418Seawater microbial communities from Monterey Bay, California, United States - 16DEnvironmentalOpen in IMG/M
3300031142Marine microbial communities from water near the shore, Antarctic Ocean - #353EnvironmentalOpen in IMG/M
3300031594Marine microbial communities from Western Arctic Ocean, Canada - CB9_20mEnvironmentalOpen in IMG/M
3300031596Marine microbial communities from Western Arctic Ocean, Canada - CB9_SCMEnvironmentalOpen in IMG/M
3300031612Marine microbial communities from water near the shore, Antarctic Ocean - #127EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031625Marine microbial communities from Western Arctic Ocean, Canada - CBN3_surfaceEnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031627Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1EnvironmentalOpen in IMG/M
3300031644Marine microbial communities from water near the shore, Antarctic Ocean - #5EnvironmentalOpen in IMG/M
3300031646Marine microbial communities from Western Arctic Ocean, Canada - CB9_33.1EnvironmentalOpen in IMG/M
3300031675Marine microbial communities from Western Arctic Ocean, Canada - CB21_SCMEnvironmentalOpen in IMG/M
3300031676Marine microbial communities from Western Arctic Ocean, Canada - CBN3_20mEnvironmentalOpen in IMG/M
3300031700Marine microbial communities from Western Arctic Ocean, Canada - CB9_surfaceEnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032151Marine microbial communities from Western Arctic Ocean, Canada - CB4_SCMEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1012935213300000115MarineLHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
SI39nov09_100mDRAFT_107016423300000325MarineHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRAYTEDGETFKVLDCSHNN*
BpDRAFT_1001643223300000930Freshwater And MarineAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRAYTEDGETFKVLDCSHNN*
GOS2220_102065323300001936MarineTLFLYQEQTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
GOS2222_100903413300001940MarineVLLRSKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
JGI26114J46594_104188213300003271MarineMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
JGI26242J51144_105251823300003500MarineMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRAYTEDGETFKVLDCSHNN
JGI26255J51710_108942513300003596MarineLHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0075441_1018549923300006164MarineIHEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDITEHKQGLLDDGDYRLYFPDAEDPMGDEQDEEGYLCDLPLTVKDTHYNIQEFEQILDEILTFEGAADESYYVEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0075446_1022635113300006190MarineHDVTEHKQGLLDDGDYRLYFPDAEDPMGDEQDEEGYLCDLPLTVKDTHYNIQEFEQILDEILTFEGAADESYYVEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0075447_1005264833300006191MarineQGLLDDGDYRLYFPNSEDPIGDEQEEEGYLCDLPLTVKDSHFKIDEFEQILDEILNFEGASHESYYVEELIDHGRTYTEDGEIFKVLDCSHNN*
Ga0075447_1025528313300006191MarineHDVTEHKQGLLDDGDYRLYFPNAEDPMGDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDEILTFEGAADESYYVEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0075445_1024176023300006193MarineKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMGDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDEILTFEGAADESYYVEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0075448_1022032613300006352MarineTHALHDVTEHKQGLLDDGDYRLYFPNAEDPMGDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDEILTFEGAADESYYVEELIDNGRTYTEDGETFNVLDCSHNN*
Ga0075444_1022760313300006947MarineLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEEGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0075444_1022760413300006947MarineLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0075444_1031182113300006947MarineTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMGDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDEILTFEGAADESYYVEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0102852_110084323300007718EstuarineLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0105744_102761533300007863Estuary WaterHALHDISEHKQGLLDDGDYRLYFEGAEGPTEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0105741_107122023300007956Estuary WaterFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEEEQGYLCDLPLNVRNGHFDIEEFEQILDEIMIFEGAAEESYYIEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0102907_103128513300007962EstuarineNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPTEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0102907_109520713300007962EstuarineKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRAYTEDGETFKVLDCSHNN*
Ga0104261_101728413300008956Ocean WaterGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0102889_109407223300008964EstuarineLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFKIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0102886_117239913300009052EstuarineLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRAYTEDGETFKVLDCSHNN*
Ga0102826_108107013300009054EstuarineNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0115566_1018137113300009071Pelagic MarineHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEGEQGYLCDLPLNVRNGYFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0102884_120626513300009141EstuarineAITKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0114995_1062094313300009172MarineNDDTLFFYETKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILEEIMTFEGAIEDTYYIEELIDNGRTYSEDGETFKVLDCSHNN*
Ga0114998_1052914113300009422MarineEHKQGLLDDGDYRLYFEGAEGPIEEEEEEGYLCDLPLNVRNGRFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0114997_1058113813300009425MarineWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0114997_1061041013300009425MarineHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYSEDGETFKVLDCSHNN*
Ga0115556_116064023300009437Pelagic MarineKERPFHFSMLLLNKQYADLDFWVCTTHALHDVSEHKQGLLEDGDYRLYFDGAEGPIEEGEEQGYLCDLPLNVRNGHFDIDEFEQILDEIMTFEGALEETYFIEELIDHGRTYTEDGETFKVLDCSHNN*
Ga0115559_115867313300009438Pelagic MarineKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0115553_121658213300009445Pelagic MarineHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0115571_102409233300009495Pelagic MarineVGKDNTLFFYKERPFHFSMLLLNKQYADLDFWVCTTHALHDVSEHKQGLLEDGDYRLYFDGAEGPIEEGEEQGYLCDLPLNVRNGHFDIDEFEQILDEIMTFEGALEETYFIEELIDHGRTYTEDGETFKVLDCSHNN*
Ga0115570_1027873513300009496Pelagic MarineLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0115570_1044533423300009496Pelagic MarineLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0115569_1026886523300009497Pelagic MarineADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0115003_1083124413300009512MarineTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVKNGHFNIEEFEQILDEIMTFEGAIEDSYYIEELIDNGRTYKEDGETFKVLDCSHNN*
Ga0115004_1053982413300009526MarineTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVKNGHFNIEEFEQILDEIMTFEGAIEDSYYIEELIDNGRTYKEDGETFKVLDCSHNN*
Ga0115004_1059960313300009526MarineLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYSEDGETFKVLDCSHNN*
Ga0115002_1079854623300009706MarineDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYSEDGETFKVLDCSHNN*
Ga0115001_1046062923300009785MarineLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMGGEQDEEGYLCDLPLTVKDSYYNIYEFEQILDEILTFEGAADESYYVEELIDNGRTYTEDGETFKVLDCSHNN*
Ga0206127_126800813300020169SeawaterLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0211688_104152513300020317MarineDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPNAEDPMGDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDEILTFEGAADESYYVEELIDNGRTYTEDGETFNVLDCSHNN
Ga0211690_102125013300020335MarineQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPNAEDPMGDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDEILTFEGAADESYYVEELIDNGRTYTEDGETFNVLDCSHNN
Ga0211504_104958213300020347MarineMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYVCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0211689_108726333300020358MarineAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILEEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0211554_1011258533300020431MarineDLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0206682_1026235513300021185SeawaterALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
(restricted) Ga0233433_1000483113300022931SeawaterFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0244777_1066713213300024343EstuarineQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPTEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0244775_1101525213300024346EstuarineERPFHFSMLLLNKQYADLDFWVCTTHALHDVSEHKQGLLEDGDYRLYFDGAEGPIEEGEEQGYLCDLPLNVRNGHFDIDEFEQILDEIMTFEGALEETYFIEELIDHGRTYTEDGETFKVLDCSHNN
Ga0209504_115727813300025621Pelagic MarineKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGYFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0209264_102626013300025622MarineLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRAYTEDGETFKVLDCSHNN
Ga0209263_114996913300025681MarineVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0209140_117365713300025688MarineTHALHDISEHKQGLLDDGDYRLYFEGAEGPTEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0209715_113319323300025699Pelagic MarineEQTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0209660_114453023300025722MarineWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0209558_118573213300025729MarineLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPTEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0209308_1009313233300025869Pelagic MarineDETLFLYQEQTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0209308_1010093433300025869Pelagic MarineDLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0209666_138358623300025870MarineKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0209335_1032558113300025894Pelagic MarineTLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLEDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGYFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0233395_101683513300026511SeawaterNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0208962_105438923300027048MarineHALHDISEHKQGLLDDGDYRLYFEGAEGPTEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0208678_111036123300027233EstuarineLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRAYTEDGETFKVLDCSHNN
Ga0208973_109591513300027506MarineLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPTEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0209384_105094013300027522MarineVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMEDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDEILTFEGAADESYYVEELIDNGRTYTEDGETFKVLDCSHNN
Ga0209384_106208713300027522MarineQGLLYDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0208897_107089623300027571EstuarineDLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPTEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0209482_103695313300027668MarineDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMGDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDEILTFEGAADESYYVEELIDNGRTYTEDGETFNVLDCSHNN
Ga0209383_103884333300027672MarineEKAIQEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMGDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDEILTFEGAADESYYVEELIDNGRTYTEDGETFKVLDCSHNN
Ga0209383_120070523300027672MarineALHDVTEHKQGLLDDGDYRLYFPNAEDPMGDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDEILTFEGAADESYYVEELIDNGRTYTEDGETFNVLDCSHNN
Ga0209383_121755123300027672MarineALHDVTEHKQGLLDDGDYRLYFPNAEDPMGDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDEILTFEGAADESYYVEELIDNGRTYTEDGETFKVLDCSHNN
Ga0209816_116872213300027704MarineQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMGDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDEILTFEGAADESYYVEELIDNGRTYTEDGETFKVLDCSHNN
Ga0209815_102715113300027714MarineKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPNAEDPMGDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDEILTFEGAADESYYVEELIDNGRTYTEDGETFNVLDCSHNN
Ga0209815_115076123300027714MarineIQEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMGDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDEILTFEGAADESYYVEELIDNGRTYTEDGETFKVLDCSHNN
Ga0209815_125619223300027714MarineTEHKQGLLDDGDYRLYFPDAEDPVGDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDEILTFEGAADESYYVEELIDNGRTYTEDGETFKVLDCSHNN
Ga0208304_1007230933300027751EstuarineHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRAYTEDGETFKVLDCSHNN
Ga0208305_1001254213300027753EstuarineDLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0209502_1006904543300027780MarineDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYSEDGETFKVLDCSHNN
Ga0209711_1005395943300027788MarineLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYSEDGETFKVLDCSHNN
Ga0209711_1042575023300027788MarineTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVKNGHFNIEEFEQILDEIMTFEGAIEDSYYIEELIDNGRTYKEDGETFKVLDCSHNN
Ga0209091_1025985813300027801MarineFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYSEDGETFKVLDCSHNN
Ga0257106_129543913300028194MarineYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYSEDGETFKVLDCSHNN
Ga0228639_108415513300028397SeawaterNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0228615_102702443300028418SeawaterDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0308022_115878023300031142MarineTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0302131_104753643300031594MarineEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYSEDGETFKVLDCSHNN
Ga0302134_1027944713300031596MarineFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYSEDGETFKVLDCSHNN
Ga0302134_1036864123300031596MarineALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVKNGHFNIEEFEQILDEIMTFEGAIEDSYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0308009_1020828323300031612MarineMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPNAEDPMGDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDEILTFEGAADESYYVEELIDNGRTYTEDGETFKVLDCSHN
Ga0302114_1009773013300031621MarineFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYSEDGETFKVLDCSHNN
Ga0302135_1012211113300031625MarineALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYSEDGETFKVLDCSHNN
Ga0302121_1007629613300031626MarineEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYSEDGETFKVLDCSHNN
Ga0302118_1044099613300031627MarineFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGDIEDTYYIEELIDNGRTYSEDGETFKVLDCSHNN
Ga0308001_1026462623300031644MarineKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMGDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDEILTFEGAADESYYVEELIDNGRTYTEDGETFKVLDCSHNN
Ga0302133_1017638413300031646MarineTEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYSEDGETFKVLDCSHNN
Ga0302122_10003771103300031675MarineTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYSEDGETFKVLDCSHNN
Ga0302136_102540043300031676MarineLHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYSEDGETFKVLDCSHNN
Ga0302136_111600313300031676MarineITEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYSEDGETFKVLDCSHNN
Ga0302130_103057213300031700MarineQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYSEDGETFKVLDCSHNN
Ga0315322_1065075513300031766SeawaterFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGEIFKVLDCSHNN
Ga0315320_1074557513300031851SeawaterNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPTEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAMEDTYYIEELIDNGRTYTEDGETFKVLDCSHNN
Ga0302127_1021262523300032151MarineNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTFEGAIEDTYYIEELIDNGRTYSEDGETFKVLDCSHNN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.