NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F092697

Metagenome Family F092697

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092697
Family Type Metagenome
Number of Sequences 107
Average Sequence Length 80 residues
Representative Sequence MDKKTNFPDLEILPPHNHFKHFLGWLISKPRMIIEDYVRKNFPDKNLELKILKLNLELKEYELTLLKKEIQELRKYSNLL
Number of Associated Samples 70
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 34.58 %
% of genes near scaffold ends (potentially truncated) 32.71 %
% of genes from short scaffolds (< 2000 bps) 85.98 %
Associated GOLD sequencing projects 67
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.065 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(46.729 % of family members)
Environment Ontology (ENVO) Unclassified
(79.439 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(97.196 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 61.11%    β-sheet: 0.00%    Coil/Unstructured: 38.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF02646RmuC 38.32
PF00929RNase_T 14.95
PF08411Exonuc_X-T_C 7.48
PF00579tRNA-synt_1b 0.93
PF00275EPSP_synthase 0.93
PF00290Trp_syntA 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG1322DNA anti-recombination protein (rearrangement mutator) RmuCReplication, recombination and repair [L] 38.32
COG2925Exonuclease I (degrades ssDNA)Replication, recombination and repair [L] 7.48
COG0159Tryptophan synthase alpha chainAmino acid transport and metabolism [E] 0.93
COG0162Tyrosyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.93
COG0180Tryptophanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.07 %
UnclassifiedrootN/A0.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001354|JGI20155J14468_10055765All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1633Open in IMG/M
3300001943|GOS2226_1005185All Organisms → cellular organisms → Bacteria1453Open in IMG/M
3300001974|GOS2246_10042222All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300005430|Ga0066849_10033518All Organisms → cellular organisms → Bacteria2082Open in IMG/M
3300005430|Ga0066849_10330311All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300005432|Ga0066845_10341603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii579Open in IMG/M
3300005432|Ga0066845_10365984All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii558Open in IMG/M
3300005522|Ga0066861_10136081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii851Open in IMG/M
3300005523|Ga0066865_10091083All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300005523|Ga0066865_10413910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii513Open in IMG/M
3300005523|Ga0066865_10432280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii501Open in IMG/M
3300005837|Ga0078893_10211975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii612Open in IMG/M
3300006166|Ga0066836_10440270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales787Open in IMG/M
3300009077|Ga0115552_1184934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii860Open in IMG/M
3300009550|Ga0115013_10064280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii2035Open in IMG/M
3300009593|Ga0115011_11293650All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii634Open in IMG/M
3300009790|Ga0115012_10987061All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii695Open in IMG/M
3300009790|Ga0115012_11700254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii550Open in IMG/M
3300012919|Ga0160422_10923819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii563Open in IMG/M
3300012928|Ga0163110_10188370All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales1455Open in IMG/M
3300012928|Ga0163110_10218569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii1359Open in IMG/M
3300012928|Ga0163110_10229337All Organisms → cellular organisms → Bacteria1329Open in IMG/M
3300012928|Ga0163110_10234871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii1315Open in IMG/M
3300012936|Ga0163109_10301169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii1174Open in IMG/M
3300012953|Ga0163179_11714344All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii571Open in IMG/M
3300012954|Ga0163111_10114756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2232Open in IMG/M
3300012954|Ga0163111_10417968All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales1220Open in IMG/M
3300012954|Ga0163111_11118989All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales766Open in IMG/M
3300012954|Ga0163111_11138313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii759Open in IMG/M
3300012954|Ga0163111_11369442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii696Open in IMG/M
3300012954|Ga0163111_11677373All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii633Open in IMG/M
3300012954|Ga0163111_11787702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii615Open in IMG/M
3300012954|Ga0163111_11974590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales587Open in IMG/M
3300012954|Ga0163111_12122142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii567Open in IMG/M
3300017710|Ga0181403_1060857All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii787Open in IMG/M
3300017717|Ga0181404_1174335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii515Open in IMG/M
3300017732|Ga0181415_1086483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii707Open in IMG/M
3300017738|Ga0181428_1124644All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii604Open in IMG/M
3300017739|Ga0181433_1068963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii882Open in IMG/M
3300017759|Ga0181414_1059535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii1018Open in IMG/M
3300017759|Ga0181414_1185718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii539Open in IMG/M
3300017762|Ga0181422_1089661All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii966Open in IMG/M
3300017762|Ga0181422_1217847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales571Open in IMG/M
3300017763|Ga0181410_1096534All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii860Open in IMG/M
3300017765|Ga0181413_1107646All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii848Open in IMG/M
3300017767|Ga0181406_1071177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii1063Open in IMG/M
3300017771|Ga0181425_1086346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales1008Open in IMG/M
3300017781|Ga0181423_1112445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii1062Open in IMG/M
3300017781|Ga0181423_1384587All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales508Open in IMG/M
3300017782|Ga0181380_1190940All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales689Open in IMG/M
3300017786|Ga0181424_10116356All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii1152Open in IMG/M
3300017786|Ga0181424_10368053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii589Open in IMG/M
3300020374|Ga0211477_10129158All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii913Open in IMG/M
3300020379|Ga0211652_10046491All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii1301Open in IMG/M
3300020379|Ga0211652_10062996All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300020379|Ga0211652_10188611All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii629Open in IMG/M
3300020380|Ga0211498_10054180All Organisms → cellular organisms → Bacteria → Proteobacteria1495Open in IMG/M
3300020381|Ga0211476_10130962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii920Open in IMG/M
3300020388|Ga0211678_10082268All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii1448Open in IMG/M
3300020391|Ga0211675_10073746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii1598Open in IMG/M
3300020391|Ga0211675_10224459All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii813Open in IMG/M
3300020391|Ga0211675_10311523All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales664Open in IMG/M
3300020392|Ga0211666_10231155All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii704Open in IMG/M
3300020393|Ga0211618_10027548All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2362Open in IMG/M
3300020400|Ga0211636_10133838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii987Open in IMG/M
3300020401|Ga0211617_10449205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales531Open in IMG/M
3300020401|Ga0211617_10469675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii517Open in IMG/M
3300020404|Ga0211659_10159465All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii1022Open in IMG/M
3300020404|Ga0211659_10268669All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii754Open in IMG/M
3300020404|Ga0211659_10403455All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii593Open in IMG/M
3300020406|Ga0211668_10089080All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales1306Open in IMG/M
3300020413|Ga0211516_10122322All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1230Open in IMG/M
3300020417|Ga0211528_10212968All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii739Open in IMG/M
3300020417|Ga0211528_10396617All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii506Open in IMG/M
3300020421|Ga0211653_10017233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales3454Open in IMG/M
3300020431|Ga0211554_10388396Not Available647Open in IMG/M
3300020431|Ga0211554_10544788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii526Open in IMG/M
3300020433|Ga0211565_10023002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii2626Open in IMG/M
3300020438|Ga0211576_10136753All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii1333Open in IMG/M
3300020440|Ga0211518_10009289All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae6834Open in IMG/M
3300020445|Ga0211564_10002898All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae8596Open in IMG/M
3300020448|Ga0211638_10112011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales1222Open in IMG/M
3300020451|Ga0211473_10381055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii722Open in IMG/M
3300020451|Ga0211473_10682762All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales515Open in IMG/M
3300020452|Ga0211545_10170339All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii1010Open in IMG/M
3300020454|Ga0211548_10248713All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales865Open in IMG/M
3300020455|Ga0211664_10482006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii568Open in IMG/M
3300020457|Ga0211643_10505287All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii594Open in IMG/M
3300020462|Ga0211546_10546880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales584Open in IMG/M
3300020463|Ga0211676_10011045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria7707Open in IMG/M
3300020463|Ga0211676_10070761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae2388Open in IMG/M
3300020463|Ga0211676_10231991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii1094Open in IMG/M
3300020463|Ga0211676_10288406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii942Open in IMG/M
3300020463|Ga0211676_10445760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii697Open in IMG/M
3300020463|Ga0211676_10621012All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales550Open in IMG/M
3300020465|Ga0211640_10527229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii642Open in IMG/M
3300020468|Ga0211475_10047216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2354Open in IMG/M
3300020468|Ga0211475_10131515All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii1287Open in IMG/M
3300020469|Ga0211577_10064068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales2631Open in IMG/M
3300020470|Ga0211543_10566896All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii535Open in IMG/M
3300020472|Ga0211579_10684259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii572Open in IMG/M
3300020473|Ga0211625_10000680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter39624Open in IMG/M
3300025830|Ga0209832_1062415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii1285Open in IMG/M
3300026257|Ga0208407_1088144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales993Open in IMG/M
3300032011|Ga0315316_10082775All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii2604Open in IMG/M
3300032073|Ga0315315_10001587All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter20882Open in IMG/M
3300032073|Ga0315315_10410006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1260Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine46.73%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater16.82%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine13.08%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater13.08%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater2.80%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.87%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.87%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.93%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.93%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.93%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300001943Marine microbial communities from Cape May, New Jersey, USA - GS010EnvironmentalOpen in IMG/M
3300001974Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031EnvironmentalOpen in IMG/M
3300005430Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69EnvironmentalOpen in IMG/M
3300005432Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78EnvironmentalOpen in IMG/M
3300005522Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257EnvironmentalOpen in IMG/M
3300005523Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265EnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300006166Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012936Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaGEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300020374Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618)EnvironmentalOpen in IMG/M
3300020379Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168)EnvironmentalOpen in IMG/M
3300020380Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058)EnvironmentalOpen in IMG/M
3300020381Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620)EnvironmentalOpen in IMG/M
3300020388Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)EnvironmentalOpen in IMG/M
3300020391Marine microbial communities from Tara Oceans - TARA_B100000989 (ERX556130-ERR598967)EnvironmentalOpen in IMG/M
3300020392Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163)EnvironmentalOpen in IMG/M
3300020393Marine microbial communities from Tara Oceans - TARA_B100000161 (ERX556105-ERR599054)EnvironmentalOpen in IMG/M
3300020400Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992)EnvironmentalOpen in IMG/M
3300020401Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020406Marine microbial communities from Tara Oceans - TARA_B100000886 (ERX555926-ERR599024)EnvironmentalOpen in IMG/M
3300020413Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092)EnvironmentalOpen in IMG/M
3300020417Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082)EnvironmentalOpen in IMG/M
3300020421Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007)EnvironmentalOpen in IMG/M
3300020431Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983)EnvironmentalOpen in IMG/M
3300020433Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020440Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043)EnvironmentalOpen in IMG/M
3300020445Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087)EnvironmentalOpen in IMG/M
3300020448Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954)EnvironmentalOpen in IMG/M
3300020451Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996)EnvironmentalOpen in IMG/M
3300020452Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078)EnvironmentalOpen in IMG/M
3300020454Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170)EnvironmentalOpen in IMG/M
3300020455Marine microbial communities from Tara Oceans - TARA_B100000965 (ERX555917-ERR599081)EnvironmentalOpen in IMG/M
3300020457Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014)EnvironmentalOpen in IMG/M
3300020462Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986)EnvironmentalOpen in IMG/M
3300020463Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050)EnvironmentalOpen in IMG/M
3300020465Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961)EnvironmentalOpen in IMG/M
3300020468Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300020470Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053)EnvironmentalOpen in IMG/M
3300020472Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995)EnvironmentalOpen in IMG/M
3300020473Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948)EnvironmentalOpen in IMG/M
3300025830Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes)EnvironmentalOpen in IMG/M
3300026257Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes)EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20155J14468_1005576523300001354Pelagic MarineMMMRIKTMDKKTNFPDLEILPPHNHFKHFLDWLISKPRNIIEDYFRKNFPDKNLELELLKMNLELKEYELTLLKKEIQEIRKYSNLL*
GOS2226_100518513300001943MarineMDKKTNFPDLERLPPHNHFKHFLDWVITKPRMIIENYIIKNFTSKNLELETLKLNLELKEYELTVLKKEIQELRKYPNFL*
GOS2246_1004222223300001974MarineMKMMRIKTMDKKTNFPDLEILPPHNHFKHFLNWLRNKPRMIIENYVRKNFTDKNLELEILKFNLKLKEYELTVLKKEIQDLRNNQ*
Ga0066849_1003351823300005430MarineMNKKTNFPDLEILPPHNHFKHFLDWLVNKPHWIIKDYIRKNFLDKNIELEVLKMNLEIKEIELTLLKNEINILKKSKQKV*
Ga0066849_1033031123300005430MarineMDKKTNFPDLEILPPHNHFKHFLNWLINKPRMIIENYVRKNFPDKNLELEILKLNLELKKYELTVLKKEIQELRNNQ*
Ga0066845_1034160323300005432MarineMDKKTNFPDLEILPPHNHLKHFLDWLINKPRMIIENYVRKNFTDKNLELEFLKLNLELKEYELTLLKKEIQELKRYSNLL*
Ga0066845_1036598423300005432MarineMDKKTNFPDLEILPPHNHFKHFFDWLISKPRMIIEDYVRKNFPDKNLELEILKLNLELKEHELTLLKKEIQELRKYSSFL*
Ga0066861_1013608123300005522MarineMDKKTNFPDLEILPPHNHFKHFLDWMISKPRMIIKDYVRKNFPDENLELENLKLDLQLKEYELTLLKKEIQELRKYSNLL*
Ga0066865_1009108323300005523MarineIKIMDKKTNFPDLEKLPPHNHLKHFFEWLISKPRMIIEDYVRKNFTNKHLELELLKLDLELKEYELKLLKKEIQELRKYSYFL*
Ga0066865_1041391013300005523MarineMDKKTNFPDLERLPPHNHLKHFLDWLINKPRIKLKDYIKKNLINENLELEVLKLDLQLKEYELTLLKKEIQELRKYS
Ga0066865_1043228013300005523MarineMDKKTNFPDLEILPPHNHFKHFLDWMISKPRMIIKDYVRKNFPDENLELENLKLDLQLKEYELTLLKKE
Ga0078893_1021197523300005837Marine Surface WaterMDKKTNFPELERLPSHNHFKHFLDWLINKPRIIIENYVRKNFLNENLELEVLKLNLELKEYELTVLKKEIQELRNYSNLL*
Ga0066836_1044027013300006166MarinePHNHFKHFLNWLWNKPRWILENFFKENFLDKNIELEVLKMNLEIKEIELTLLKNEINILKKSKQKV*
Ga0115552_118493413300009077Pelagic MarineMRIKTMDKKTNFPDLEILPPHNHFKHFLDWLISKPRNIIEDYFRKNFPDKNLELELLKMNLELKEYELTLLKKEIQEIRKYSNLL*
Ga0115013_1006428023300009550MarineMDKKTNFPDLERLPPHNHFKHFLNWLINKPKMIFKDYIIKNFPDKNLELDILKLNLELKEYELTLLKKEMQEIRKYSNFL*
Ga0115011_1129365023300009593MarineMRIKTMDKKTNFPDLEILPPHNHLKHFLDWLINKPRMIIEDYVRKNFPDKNLELEILKLNLELKKYELTVLKKEIQELRNNN*
Ga0115012_1098706123300009790MarineMRIKIMDKKTNFPDLEILPPHNHFKHFLNWLISKPRIIIEDYVRKNFSNKNLEQEVLKLNLELKEYELTLLKKEIQELRKYSNFL*
Ga0115012_1170025423300009790MarineMDKKTNFPDLERLPPHNHFKHFLNWLTNKPKMIFKDYIIKNFPDKNLELDILKLNLELKEYELTLLKKEMQEIRKYSNFL*
Ga0160422_1092381913300012919SeawaterMDKKTNFPDLERLPPHNHLKHFLEWLINKPKMIIEDYVKKNFPDKNLELELLKLDLELKEYELKLLKKEMKEIRKKSYFF*
Ga0163110_1018837023300012928Surface SeawaterMRIKIMDKKTNFPDLERLPPHNHLKHFLDWLINKPRIKLKDYIRENFTNKNLELEVLKLDLQLKEYELTLLKKEIQELRKYSKFL*
Ga0163110_1021856923300012928Surface SeawaterMRIKTMDKKTNFPDLEILPPHNHFKHFLNWLISKPRVIIEDYVRKNFSNENLELEVLKLNLELKEYELTVLKKEIQDLRNYSNLL*
Ga0163110_1022933723300012928Surface SeawaterMRTKTMDKKTNFPDLERLPPHNHFKHFLNWLINKPRMIIKDSIIKNFPDKNLELEILKLNLELKEYELTLLKKEMQEIRKYSNFL*
Ga0163110_1023487123300012928Surface SeawaterMDKKTNFPDLERLPPHNHLKHFLEWLINKPKMMIENYVKKNFPNKNLELEILKQKLELKEFELALLKKEIQELRKYSNLLLK*
Ga0163109_1030116923300012936Surface SeawaterMRIKTMDKKTNFPDLEILPPHNHFKHFFDWLISKPRMIIEDYVRKNFPDKNLELEILKLNLELKEHELTLLKKEIQELRKYSNFL*
Ga0163179_1171434413300012953SeawaterMDKKTNFPDLERLPPHNHFKHFLNWLINKPKMIFKDYIIKNFPDKNLELEILKLNLELKEYELTLL
Ga0163111_1011475613300012954Surface SeawaterMDKKTNFPDLERLPPHNHFKHFLDWLINKPRMIIENYVRKNFTDKNLELEILKLNLELKEYELILLKKEIQELRKY*
Ga0163111_1041796823300012954Surface SeawaterLERLPPHNHFKHFLNWLINKPKMIIKDYIIKNFLDKNLELEILKLNLELKEYELTLLKKEMQEIRKYSNFL*
Ga0163111_1111898923300012954Surface SeawaterMDKKTNFPDLEILPPHNHFKHFLNWLRNKPRMIIENYVRKNFTNKNLEIEILKFNLKLKEYELTVLKNEIQDLRNNQ*
Ga0163111_1113831323300012954Surface SeawaterMRIKTMSKKTNFPDLERLPPHNHIKHFLDWLINNPRMIIETYIIKNFPSKNLELETLKLNLELKEYELIVLKKEIQELRNYSNLL*
Ga0163111_1136944223300012954Surface SeawaterMDKKTNFPDLERLPPHNHFKHFLNWLINKPKMIFKDYIIKNFPDKNLELEILKLNLELKEYELTLLKKEMQEIRKYSNFL*
Ga0163111_1167737323300012954Surface SeawaterMRIKTMDKKTNFPDLEILPTHNHFKHFLDWMISKPRMIIKDYVRKNFPDENLELENLKLDLQLKEYELTLLKKEIQEL
Ga0163111_1178770213300012954Surface SeawaterMDKKTNFPDLEILPPHNHLKHFLDWMISKPRMIIEDYVRKNFPDKNLELELLKLNLELKEYELTLLKKEIQELRKYSNLL*
Ga0163111_1197459023300012954Surface SeawaterEILPPHNHFKHFLNWLISKPRTIIEDYIRKNFPDKNLELELLKLNLELKEYELTLLKKEIQELRKYSNLL*
Ga0163111_1212214223300012954Surface SeawaterMRIKIMDKKTNFPDLERLPSHNHFKHFFDWLISKPRMIIEDYVRKNFPDKNFELEILKLNLELKEYELTVLKKEIQELRSNQ*
Ga0181403_106085723300017710SeawaterMDKKTNFPDLEISPKHNHFKHFLDWLINKPRIVIENYVRKNFSNENLELEVLKLNLELKEYELTVLKKEIQELRNYSNLL
Ga0181404_117433513300017717SeawaterMKMMRIKTMDKKTNFPDLEILPPHNHFKHFLNWLINKPRMIIENYARKNFPDKNLELEILKLNLELKEYELTLLKKEIQELRK
Ga0181415_108648323300017732SeawaterMDKKTNFPDLEILPPHNHFKHFLDWLINKPRIVIENYVRKNFSNENLELEILKLNLELKEYELTVLKKEIQEFKNNQ
Ga0181428_112464423300017738SeawaterMKIKTMDKKTNFPDLKILPPHNHFKHFFDWLISKPRIIIENYVRKNFPDKNLELELLKLNLKLKEYELTLLKKEIQELRKYSNFS
Ga0181433_106896313300017739SeawaterIMDKKTNFPDLERLPPHNHFKHFFVSLIGKPRMIIEDYLRKNFPNKNLELEILKLNLELKEYELTVLKKEIQELRKYSNFS
Ga0181414_105953523300017759SeawaterMDKKTNFPDLEILPPHNHFKHFLDWLINKPRIVIENYVRKNFSNENLELEILKLNLELKEYELTVLKKEIQELRKYSNFS
Ga0181414_118571813300017759SeawaterMDKKTNFPDLERLPPHNHFKHFLDWVITKPRMIIENYIIKNFPSKNLELETLKLNLELKEYELTVLKKEIQELRNYSN
Ga0181422_108966113300017762SeawaterMKMMRIKTMDKKTNFPDLEILPPHNHFKHFLNWLINKPRMIIENYVRKNFPDKNLELEILKLNLELKEYELTVLKKEIQELRNYSNLL
Ga0181422_121784723300017762SeawaterFPDLEISPKHNHFKHFLDWLINKPRMIIRDYVRKNFSNENLELEVLKLNLELKEYELTVLKKEIQELRNYSNLL
Ga0181410_109653423300017763SeawaterMDKKTNFPDLERLPPHNHFKHFLDWVITKPRMIIENYIIKNFPSKNLELETLKLNLELKEYELTVLKKEIQELRKYPNFL
Ga0181413_110764623300017765SeawaterMDKKTNFPDLEILPPHNHFKHFLNWLINKPRMIIENYVRKNFPDKNLELELLKMNLELKEYELTLLKKEIQEI
Ga0181406_107117723300017767SeawaterMDKKTNFPDLERLPPHNHFKHFLDWVITKPRMIIENYIIKNFTSKNLELETLKLNLELKEYELTVLKKEIQELRNYSNLL
Ga0181425_108634623300017771SeawaterMDKKTNFPDLEILPPHNHFKHFLNWLINKPRMIIENYVRKNFPDKNLELEILKLNLELKEYELTVLKKEIQELRNNQ
Ga0181423_111244513300017781SeawaterMNKKTNFPDLERLPPHNHIKHFLVWLINKPRIIIENYIIKNFTSKNLELETLKLNLELKEYELTVLKKEIQEVRKYSNFS
Ga0181423_138458713300017781SeawaterNFPDLEILPPHNHFKHFLDWLISKPRMIIEDYVRKNFPDKNLELELLKLNLKLKEYELTLLKKEIQELRKYSNL
Ga0181380_119094013300017782SeawaterRMIIMKMMRIKTMDKKTNFPDLKILPPHNHFKHFFDWLISKPRIIIENYVRKNFPDKNLELEILKLNLELKEYELTVLKKEIQELRNNQ
Ga0181424_1011635613300017786SeawaterMDKKTNFPDLERLPPHNHFKHFFVSLISKPRMMIEDYLRKNFPDKNLELEILKLNLELKEYELTVLKKEIQELRKYSNFS
Ga0181424_1036805323300017786SeawaterMDKKTNFPDLERLPPHNHFKHFFVSLIGKPRMIIEDYVRKNFTDRNLELEILKLNLELKEYELTVLKKEIQELRKYSNFS
Ga0211477_1012915813300020374MarineMMKIKTMDKKTNFPDLEILPPHNHFKHFLNWLISKPRIIIEDYVKKNFPDKDLELEILKLNLELKEYELTLLKKEIQELRKYSNF
Ga0211652_1004649113300020379MarineMDKKTNFPDLERLPPHNHFKHFLDWLINKPRMIIENYVRKNFTDKNLELEILKLNLELKEYELILLKK
Ga0211652_1006299623300020379MarineMDKKTNFPDLERLPPHNHFKHFLDWLINKPRIVIEDYVRKNFSNENLEFEVLKLNLELKEYELTALKKEIQELRNYSNLL
Ga0211652_1018861113300020379MarineRMVMRIKTMDKKTNFPDLEILPPHNHFKHFLDWLISKPRMIIEDYVRKNFPDKNLELELLKLNLELKEYELTLLKKEIQDLRKYSNLL
Ga0211498_1005418023300020380MarineMDKKTNFPDLERLPPHNHLKHFLEWLINKPKMIIEDYVKKNFPDKNLELELLKLDLELKEYELKLLKKEMKEIRKKSYFF
Ga0211476_1013096213300020381MarineKTMDKKTNFPDLEILPPHNHFKHFLNWLISKPRIIIEDYVKKNFPDKDLELEILKLNLELKEYELTLLKKEIQELRKYSNFS
Ga0211678_1008226823300020388MarineMMEIKIMDKKTNFPDLERLPPHNHFKHFFVSLISKPRMIIEDYLRKNFPNKNLELEILKLNLELKEYELTVLKKEIQELRKYFNFS
Ga0211675_1007374633300020391MarineMDKKTNFPDLEILSPHNHFKHFLDWLISKPRIIIEDYVRKNFPDKNLELELLKLNLELKEYELTLLKKEIQELRKYSNLL
Ga0211675_1022445923300020391MarineMDKKTNFPDLERLPPHNHLKHFLEWLINKPKMMIENYVKKNFPNKNLELEILKQKLELKEFELALLKKEIQELRKYSNLLLK
Ga0211675_1031152323300020391MarineMNKKTNFPDLEILPPHNHLKHFLDWLINKPRMIIENYVRKKFPDKNSELEILKLNLELRDYELKLLKIEIQELRKHSNLL
Ga0211666_1023115523300020392MarineMDKKTNFPDLERLPPHNHFKHFLNWLINKPKVFFKDYIIKNFLDKNLELEILKLNLELKEYELTLLKKEMQEIRKYSNFL
Ga0211618_1002754823300020393MarineMDKKTNFPDLERLPPHNHLKHFLEWLINKPKMIIEDYVKKNFPDKNLELELLKLDLELKEYELKLLKKEMKEIRKYSYFL
Ga0211636_1013383823300020400MarineMKTTKMKTTKMTMRIKIMDKKTNFPDLERLPPHNHLKHFLEWLINKPKMMIENYVKKNFPNKNLELEILKQKLELKEFELALLKKEIQELRKYSNLLLK
Ga0211617_1044920523300020401MarineHNHLKHFLEWLINKPKMIIEDYVKKNFPDKNLELELLKLDLELKEYELKLLKKEMKEIRKKSYFF
Ga0211617_1046967523300020401MarineMRTKTMDKKTNFPDLERLPPHNHLKHFLEWLINKPKMMIEDYVKKNFPNKNLELEILKQKLELKEFELVLLKKEIQELRKYSNLLLK
Ga0211659_1015946513300020404MarineTKMRMIIMKMMRIKTMDKKTNFPDLEILPPHNHYKHFLDWMISKPRMIIKDYVRKNFPDENLELENLKLDLQLKEYELTLLKKEIQELRKYSNLL
Ga0211659_1026866923300020404MarineMRIKTMDKKTNFPDLEILPPHNHFKHFLYWLISKPKNIIEDYVKKNFSDKNLELELLKLNLELKEYELTLLKKEIQEIKKYSNLL
Ga0211659_1040345523300020404MarineMRIKIMDKKTNFPDLERLPSHNHFEHFLKWLINKPKMIIKDYIIKNFPDKNLELEILKLNLELKEYELTLLKKEMQEIRKYSNFL
Ga0211668_1008908023300020406MarineNFPDLERLPPHNHLKHFLEWLINKPKMMIENYVKKNFPNKNLELEILKQKLELKEFELALLKKEIQELRKYSNLLLK
Ga0211516_1012232213300020413MarineMNKKTNFPDLEILPPHNHLKHFLDWLINKPRMIIENYVRKKFPDKNSELEILKLNLELKEYELTLLKKEIQELRKYSNLL
Ga0211528_1021296813300020417MarineMKMMMRIKIMDKKTNFPDLERLPPHNHLKHFLDWLINKPRIKLKDYIRKNFTNENLELEVLKLDLQLKEYELTLLKKEIQELRKYSNLL
Ga0211528_1039661723300020417MarineKTNFPDLEILPPHNHFKHFFDWLISKPRMIIEDYVRKNFPDKNLELEILKLNLELKEHELTLLKKEIQELRKYSNFL
Ga0211653_1001723333300020421MarineMDKKTNFPDLERLPPHNHFKHFLDWLINKPRMIIENYVRKNFTDKNLELEILKLNLELKEYELILLKKEIQELRKY
Ga0211554_1038839613300020431MarineMDKKTNFPDLEILPPHNHFKHFLDWMISKPRMIIKDYVRKNFPDENLELEILKLDLQLKEYELTLLKKEIQEL
Ga0211554_1054478823300020431MarineMDKKTNFPDLERLPPHNHLKHFLDWLINKPRIKLKDYIRKNFTNKNLELEVLKLDLQLKEYELTLLKKEIQE
Ga0211565_1002300223300020433MarineMMMKTKTMDKKTNFPHLERLPPHNHLKHFLEWLMNKPKMIIEEYIKKKFPDKNLELEILKQNLELKEYELLLLKKEIQELRKYSNFL
Ga0211576_1013675323300020438MarineMDKKTNFPDLERLPPHNHFKHFLDWVITKPRMIIENYIIKNFPSKNLELETLKLNLELKEYELTVLKKEIQELRNYSNLL
Ga0211518_1000928943300020440MarineMDKKTNFPDLERLPPHNHLKHFIEWLINKPKMMIEVYVKKNFPDKNLELEILKQNLELKEYELSLLKKEIQELKKYSNLSLK
Ga0211564_1000289833300020445MarineMNKKTNFPDLEILPPHNHFKHFLDWLVNKPHWIIKDYIRKNFLDKNIELEVLKMNLEIKEIELTLLKNEINILKKSKQKV
Ga0211638_1011201123300020448MarineMDKKTNFPDLERLPPHNHLKHFLEWLINKPKMIIEDYVKKNFPDKNLELEILKLNLELKEYELTLLKKEIQELRNILIFHKN
Ga0211473_1038105523300020451MarineMRIKTMDKKTNFPDLEILPPHNHFKHFLDWLINKPRMIIKDYVRKNFTDKNLELELLKLNLELKEYELSLVKKEIQELRKYSNLL
Ga0211473_1068276213300020451MarineLEILPPHNHFKHFLDWLISKPRVIIENYVRKNFPDKNLELEFLKLNLELKEYELTLLKKEIQEIKKYSNLL
Ga0211545_1017033923300020452MarineMDKKTNFPDLEILPPHNHFKHFLNWLINKPKMIIKDYVVKNFPNKNLELEILKLNLELKEYELTLLKKEIQEIRKYSNFL
Ga0211548_1024871323300020454MarineLPPHNHFKHFLDWMISKPRMIIKDYVRKNFPDENLELEILKLDLQLKEYELTLLKKEIQELRKYSNLL
Ga0211664_1048200623300020455MarineMRIKTMDKKTNFPDLERLPPHNHIKHFLDWLINKPRIIIEDYVRKNFPDKNLELEFLKLNLELKEYELTVLKKEIQELRKYSNLL
Ga0211643_1050528713300020457MarineMDKKTNFPDLEILPPHNHFKHFLNWLINKPRIIIEDYVRKNFSNKNLELEVLKLNLELKEYELTLLKKEIQELRKYSSFL
Ga0211546_1054688023300020462MarineHNHFKHFLNWLINKPKMIFKDYIIKNFPDKNLELEILKLNLELKEYELTLLKKEIQEIRKYSNFL
Ga0211676_1001104523300020463MarineMDKKTNFPDLKISPKHNHFKHFLDWLINKPRMIIRDYVRKNFPDENLELEILKLNLELKEYELTVLKKEIQELRKYSNLL
Ga0211676_1007076133300020463MarineMDKKKNFPDLERLPSHNHLKHFLDWLINKPRIIIENYVRKNFSNENLELEVLKLNLELKEYELTVLKKEIQELRNYSNLL
Ga0211676_1023199123300020463MarineMDKKTNFPDLERLPPHNHFKHFFVSLIGKPRMIIEDYLRKNFPNKNLELEILKLNLELKEYELTVLKKEIQELRKYSNFS
Ga0211676_1028840613300020463MarineMRTKIMDKKTNFPDLERLPPHNHFKHFLNWLINKPKMIFKDYIIKNFPDKNLELEILKLNLELKEYELTLLKKEMQEIRKYYNFL
Ga0211676_1044576023300020463MarineMKIKTMDKKTNFPDLEILPPHNHLKHFLDWLISKPRMIIENYVRKNFPDKDLELEILKLNLELKENELTLLKKEIQELRKYFNFRKN
Ga0211676_1062101223300020463MarineDKKTNFPDLEILPPHNHFKHFLNWLISKPRMIIENYLRKNFPDKNLELEVLKLNLELKEYELTLLKKEIQELRNYSNLL
Ga0211640_1052722913300020465MarineMDKKTNFPDLERLPPHNHFKHFLNWLINKPKMIFKDYIIKNFPDKNLELEILKLNLELKEYELTLLKKEMQEIRKYSNFL
Ga0211475_1004721633300020468MarineEILPPHNHFKHFLNWLINKPRMIIEDYVRKNFSNKNLELEVLKLDLQLKEYELTLLKKEIQELRKYSNFL
Ga0211475_1013151523300020468MarineMNKKTNFPDLEISPPHNHLKHFLDWLINKPRMIIENYVRKKFPDKNSELEILKLNLELKEYELTLLKKEIQELRKYSNLSKN
Ga0211577_1006406833300020469MarineMMEIKIMDKKTNFPDLERLPPHNHFKHFFVSLIGKPRMIIEDYLRKNFPNKNLELEILKLNLELKEYELTVLKKEIQELRKYSNFS
Ga0211543_1056689613300020470MarineMMMSIKIMDKKTNFPDLEILPPHNHFKHFFDWLISKPRMIIEDYVRKNFPDKNLELEILKLNLELKEHELTLLKKEIQELRKYSNFL
Ga0211579_1068425923300020472MarineMDKKTDFPDLEKLPPHNHLKHFLDWLINKPRMIIEDYVIKNFPDKNLELEILKLNLELKEYELKLLKKEIQELRKYSYFL
Ga0211625_1000068033300020473MarineMKMMRIKTMDKKTNFPDLEIIPPHNHFKHFLNWLINKPRIIIEDYIRKNYPDKNLELELLKLNLKLKEHELTLLKKEIQELRKYSNLL
Ga0209832_106241523300025830Pelagic MarineMMMRIKTMDKKTNFPDLEILPPHNHFKHFLDWLISKPRNIIEDYFRKNFPDKNLELELLKMNLELKEYELTLLKKEIQEIRKYSNLL
Ga0208407_108814423300026257MarineMNKKTNFPDLEILPPHNHFKHFLNWLINKPRMIIENYVRKNFPDKNLELEILKLNLELKKYELTVLKKEIQELRNNQ
Ga0315316_1008277523300032011SeawaterMDKKTNYPDLERLPPHNHFKHFLNWLINKPKMIFKDYIIKNFPDKNLELEILKLNLELKEYELTLLKKEMQEIRKYSNFL
Ga0315315_10001587173300032073SeawaterMDKKTNFPDLEILPPHNHFKHFLGWLISKPRMIIEDYVRKNFPDKNLELKILKLNLELKEYELTLLKKEIQELRKYSNLL
Ga0315315_1041000623300032073SeawaterMKMMRIKTMDKKTNFPDLEILPPHNHFKHFLNWLINKPRMIIENYVRKNFPDKNLELEILKLNLELKEYELTVLKKEIQELRNNQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.