| Basic Information | |
|---|---|
| Family ID | F092684 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 42 residues |
| Representative Sequence | GRDDGKGFLVVTRYKLKEIESGKVQDPLVKPGDRITIHD |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.87 % |
| % of genes near scaffold ends (potentially truncated) | 98.13 % |
| % of genes from short scaffolds (< 2000 bps) | 95.33 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.701 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (9.346 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.664 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.682 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.96% β-sheet: 5.97% Coil/Unstructured: 85.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF12796 | Ank_2 | 53.27 |
| PF13857 | Ank_5 | 14.02 |
| PF13637 | Ank_4 | 11.21 |
| PF11008 | DUF2846 | 0.93 |
| PF01494 | FAD_binding_3 | 0.93 |
| PF04191 | PEMT | 0.93 |
| PF00023 | Ank | 0.93 |
| PF00797 | Acetyltransf_2 | 0.93 |
| PF14066 | DUF4256 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.87 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.93 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.93 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.93 |
| COG2162 | Arylamine N-acetyltransferase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.37 % |
| Unclassified | root | N/A | 19.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_62695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1411 | Open in IMG/M |
| 2228664021|ICCgaii200_c0699296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 563 | Open in IMG/M |
| 3300000559|F14TC_100349942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 647 | Open in IMG/M |
| 3300000559|F14TC_103715835 | Not Available | 705 | Open in IMG/M |
| 3300000789|JGI1027J11758_12469434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 586 | Open in IMG/M |
| 3300000789|JGI1027J11758_12832070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 757 | Open in IMG/M |
| 3300001431|F14TB_103732856 | Not Available | 692 | Open in IMG/M |
| 3300001431|F14TB_109781179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 568 | Open in IMG/M |
| 3300002128|JGI24036J26619_10114292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 556 | Open in IMG/M |
| 3300003321|soilH1_10088624 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4836 | Open in IMG/M |
| 3300004156|Ga0062589_101801441 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300004157|Ga0062590_102403199 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300004463|Ga0063356_106048014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 519 | Open in IMG/M |
| 3300004479|Ga0062595_100186255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1264 | Open in IMG/M |
| 3300004629|Ga0008092_11019173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
| 3300004643|Ga0062591_100532136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1019 | Open in IMG/M |
| 3300005180|Ga0066685_10902078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 590 | Open in IMG/M |
| 3300005294|Ga0065705_10132691 | All Organisms → cellular organisms → Bacteria | 2393 | Open in IMG/M |
| 3300005336|Ga0070680_100041058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 3751 | Open in IMG/M |
| 3300005343|Ga0070687_101529024 | Not Available | 503 | Open in IMG/M |
| 3300005345|Ga0070692_10710199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 677 | Open in IMG/M |
| 3300005444|Ga0070694_101448624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 580 | Open in IMG/M |
| 3300005458|Ga0070681_11350422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 636 | Open in IMG/M |
| 3300005546|Ga0070696_100186109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1543 | Open in IMG/M |
| 3300005558|Ga0066698_10735714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 646 | Open in IMG/M |
| 3300005578|Ga0068854_101050580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 723 | Open in IMG/M |
| 3300005617|Ga0068859_102929874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 522 | Open in IMG/M |
| 3300005618|Ga0068864_101937123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 595 | Open in IMG/M |
| 3300005718|Ga0068866_11299420 | Not Available | 528 | Open in IMG/M |
| 3300005718|Ga0068866_11305982 | Not Available | 527 | Open in IMG/M |
| 3300005719|Ga0068861_101496862 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 662 | Open in IMG/M |
| 3300005834|Ga0068851_10655259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 643 | Open in IMG/M |
| 3300005842|Ga0068858_100649516 | Not Available | 1025 | Open in IMG/M |
| 3300005842|Ga0068858_100836677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 899 | Open in IMG/M |
| 3300005843|Ga0068860_100827688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 940 | Open in IMG/M |
| 3300005844|Ga0068862_101099541 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Prosorrhyncha → Heteroptera → Euheteroptera → Neoheteroptera → Panheteroptera → Cimicomorpha → Reduvioidea → Reduviidae → Triatominae → Rhodnius | 790 | Open in IMG/M |
| 3300005844|Ga0068862_101655317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 648 | Open in IMG/M |
| 3300005875|Ga0075293_1047734 | Not Available | 608 | Open in IMG/M |
| 3300006169|Ga0082029_1312147 | Not Available | 500 | Open in IMG/M |
| 3300006846|Ga0075430_101679694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 521 | Open in IMG/M |
| 3300006854|Ga0075425_100738102 | Not Available | 1130 | Open in IMG/M |
| 3300006871|Ga0075434_102661382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 500 | Open in IMG/M |
| 3300006876|Ga0079217_10488165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 761 | Open in IMG/M |
| 3300006904|Ga0075424_100575578 | Not Available | 1203 | Open in IMG/M |
| 3300006931|Ga0097620_101860915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 665 | Open in IMG/M |
| 3300007004|Ga0079218_13561648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 529 | Open in IMG/M |
| 3300009093|Ga0105240_11447082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 721 | Open in IMG/M |
| 3300009093|Ga0105240_12408947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 545 | Open in IMG/M |
| 3300009101|Ga0105247_10835427 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 706 | Open in IMG/M |
| 3300009101|Ga0105247_10932328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 673 | Open in IMG/M |
| 3300009147|Ga0114129_13014309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 553 | Open in IMG/M |
| 3300009148|Ga0105243_11508927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 696 | Open in IMG/M |
| 3300009162|Ga0075423_10256693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1831 | Open in IMG/M |
| 3300009174|Ga0105241_12226038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 544 | Open in IMG/M |
| 3300009545|Ga0105237_10225601 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
| 3300009553|Ga0105249_11724895 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera rhizosphaereae | 699 | Open in IMG/M |
| 3300010038|Ga0126315_10584840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 719 | Open in IMG/M |
| 3300010040|Ga0126308_10905074 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300010041|Ga0126312_10928171 | Not Available | 635 | Open in IMG/M |
| 3300010046|Ga0126384_12506047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 501 | Open in IMG/M |
| 3300010047|Ga0126382_12356214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 516 | Open in IMG/M |
| 3300010373|Ga0134128_10876850 | Not Available | 994 | Open in IMG/M |
| 3300010375|Ga0105239_12057604 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Parasitiformes → Mesostigmata → Monogynaspida → Gamasina → Dermanyssoidea | 663 | Open in IMG/M |
| 3300010396|Ga0134126_10229222 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
| 3300010397|Ga0134124_12926443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 521 | Open in IMG/M |
| 3300010399|Ga0134127_10861749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 958 | Open in IMG/M |
| 3300010403|Ga0134123_10666141 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Choanoflagellata → Craspedida → Salpingoecidae → Salpingoeca → Salpingoeca rosetta | 1012 | Open in IMG/M |
| 3300012015|Ga0120187_1017592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga | 709 | Open in IMG/M |
| 3300012045|Ga0136623_10032337 | All Organisms → cellular organisms → Bacteria | 2259 | Open in IMG/M |
| 3300012212|Ga0150985_111200071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 529 | Open in IMG/M |
| 3300012285|Ga0137370_10906538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 545 | Open in IMG/M |
| 3300012363|Ga0137390_11565290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 598 | Open in IMG/M |
| 3300012948|Ga0126375_11052609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 667 | Open in IMG/M |
| 3300012948|Ga0126375_11559846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 567 | Open in IMG/M |
| 3300012958|Ga0164299_11478846 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300014326|Ga0157380_10304818 | Not Available | 1469 | Open in IMG/M |
| 3300014326|Ga0157380_12151329 | Not Available | 621 | Open in IMG/M |
| 3300014745|Ga0157377_10379888 | Not Available | 956 | Open in IMG/M |
| 3300014745|Ga0157377_11592065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 523 | Open in IMG/M |
| 3300015373|Ga0132257_100987563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1059 | Open in IMG/M |
| 3300015373|Ga0132257_101317742 | Not Available | 917 | Open in IMG/M |
| 3300015374|Ga0132255_103554007 | Not Available | 663 | Open in IMG/M |
| 3300018027|Ga0184605_10188173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 935 | Open in IMG/M |
| 3300025899|Ga0207642_11044757 | Not Available | 527 | Open in IMG/M |
| 3300025900|Ga0207710_10651028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 552 | Open in IMG/M |
| 3300025904|Ga0207647_10366401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 815 | Open in IMG/M |
| 3300025911|Ga0207654_10241587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1207 | Open in IMG/M |
| 3300025911|Ga0207654_11316502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 527 | Open in IMG/M |
| 3300025912|Ga0207707_10608577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 924 | Open in IMG/M |
| 3300025917|Ga0207660_10256367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1382 | Open in IMG/M |
| 3300025918|Ga0207662_10442462 | Not Available | 887 | Open in IMG/M |
| 3300025927|Ga0207687_10914273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. OK095 | 751 | Open in IMG/M |
| 3300025933|Ga0207706_10559629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 984 | Open in IMG/M |
| 3300025936|Ga0207670_11747456 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 529 | Open in IMG/M |
| 3300025937|Ga0207669_10992339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 705 | Open in IMG/M |
| 3300025960|Ga0207651_10631570 | All Organisms → cellular organisms → Eukaryota | 939 | Open in IMG/M |
| 3300025981|Ga0207640_10912953 | Not Available | 768 | Open in IMG/M |
| 3300026041|Ga0207639_11852072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 564 | Open in IMG/M |
| 3300026116|Ga0207674_10296657 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300026116|Ga0207674_10856876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 876 | Open in IMG/M |
| 3300027775|Ga0209177_10374315 | Not Available | 564 | Open in IMG/M |
| 3300027909|Ga0209382_12332355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 502 | Open in IMG/M |
| 3300028380|Ga0268265_10402230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1266 | Open in IMG/M |
| 3300031901|Ga0307406_11676399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 563 | Open in IMG/M |
| 3300031908|Ga0310900_11837680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 516 | Open in IMG/M |
| 3300032013|Ga0310906_10396649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 910 | Open in IMG/M |
| 3300033412|Ga0310810_10258047 | All Organisms → cellular organisms → Bacteria | 1911 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 9.35% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.54% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 6.54% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.74% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.74% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.80% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.93% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012015 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1 | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_00797860 | 2199352025 | Soil | VRVGRDDGKGFLVVTRYQLKDIEMGKVQDPLIQPGDRITVIN |
| ICCgaii200_06992962 | 2228664021 | Soil | IVGKPKEARLGRDDGRGFLIVTKFKLKEIESGKVPDPLVRPGDRIMVQ |
| F14TC_1003499421 | 3300000559 | Soil | VRIGRDNGKGFLTVTRYRLKEINSGKVADPPIEPGDRITIVN* |
| F14TC_1037158351 | 3300000559 | Soil | GGLAKNSKEARLARDNGKGXXXXXXYKLKDIDSGKVPDPLVQPGDRITIVK* |
| JGI1027J11758_124694342 | 3300000789 | Soil | DDGKGFLKETRYKLNEIASGKLLDPLIQPGDRITIIK* |
| JGI1027J11758_128320701 | 3300000789 | Soil | ARLARDNGKGFLVLSRYKLKDIDSGKVPDPLVQPGDRITVVK* |
| F14TB_1037328562 | 3300001431 | Soil | HGFLVVNRYKLKDIDSGRVPDPVIQPGDRITIID* |
| F14TB_1097811792 | 3300001431 | Soil | GKGFLTVTRYRLKEINSGKVADPPIEPGDRITIVN* |
| JGI24036J26619_101142922 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | IAREDGNGFLVMTRYKLKDIETGKGRDPQIQPGDRITIVD* |
| soilH1_100886241 | 3300003321 | Sugarcane Root And Bulk Soil | VTPKAKEARLGRDDGHGFLTITRLKLKDIESGKLPDPVVRPGDRIMIVK* |
| Ga0062589_1018014411 | 3300004156 | Soil | KKAELARDNGKGFLVVTRFKLKEIESGKVPDPPIQPGDRITIIK* |
| Ga0062590_1024031991 | 3300004157 | Soil | ARDNGKGFLMVTRFKLKEIESGKVPDPPIQPGDRITIIK* |
| Ga0063356_1060480142 | 3300004463 | Arabidopsis Thaliana Rhizosphere | ARLARDNGNGYLVMHRFKLKDIDSGKAPDPPIQPGDRITIVK* |
| Ga0062595_1001862553 | 3300004479 | Soil | KPKEARIGRNDAGGFIVVTRYQLKDIESGKVQDPLVQPGDRIMVSN* |
| Ga0008092_110191731 | 3300004629 | Tropical Rainforest Soil | AKEVRLARDNGKGFLTISHYKLKEVNSGRTADPVLQPGDRITIGK* |
| Ga0062591_1005321362 | 3300004643 | Soil | AKEARLGRDDGKGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE* |
| Ga0066685_109020782 | 3300005180 | Soil | KEARFARDNGKGFLVVNRYKLKAIESGKVPDPVIQPGDRITIID* |
| Ga0065705_101326915 | 3300005294 | Switchgrass Rhizosphere | RIGRDDGKGFLVVTRFKLKEIESGKVPDPVIKPGDRITIRD* |
| Ga0070680_1000410581 | 3300005336 | Corn Rhizosphere | KEARLGRDDGRGFLIITKFKLKDIESGKVPDPLIRPGDRIMVIK* |
| Ga0070687_1015290242 | 3300005343 | Switchgrass Rhizosphere | KAQLARDNGRGFLAVKRYKLKEIDSGKVPDPVIQPGDRITIID* |
| Ga0070692_107101991 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VTNKAKEARLGRDDGNGYLTVTKIKLKDIESGKAPDPLVRPGDRIMIDK* |
| Ga0070694_1014486241 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | EVRLARDDGKGFLNVTRYRLKEIEEGKTQDPLIQPGDRITIIF* |
| Ga0070681_113504222 | 3300005458 | Corn Rhizosphere | RVARDNGEGFLAVTRYKLKDVESGKVQDPVVKPGDRITIRN* |
| Ga0070696_1001861091 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | KPKEARLGRDDGRGFLIITKFKLKDIESGKVPDPLIRPGDRIMVIK* |
| Ga0066698_107357141 | 3300005558 | Soil | TKKSKEARLARDNGKGFLVVSRYKLKDIESGKVPDPVIQPGDRITIID* |
| Ga0068854_1010505801 | 3300005578 | Corn Rhizosphere | DNGQGFLAITRYKLKEIESGKVADPSIEPGDRITIND* |
| Ga0068859_1029298742 | 3300005617 | Switchgrass Rhizosphere | ARIGRDDGKGFLVVTRFKLKEIESGKIQDPIIKPGDRITIGH* |
| Ga0068864_1019371232 | 3300005618 | Switchgrass Rhizosphere | TPKAKEARLGRDDGKGFLTVTKYKLKEIESGKVQDPAVKPGDRITIKE* |
| Ga0068866_112994201 | 3300005718 | Miscanthus Rhizosphere | SRDSGNGFLMMTRYKLQEIDSGKRPDPLVQPGDRITVVK* |
| Ga0068866_113059821 | 3300005718 | Miscanthus Rhizosphere | VRLARDDGKGFLIVNHYKLKDIESGNVKDPLIQAGDRITINE* |
| Ga0068861_1014968621 | 3300005719 | Switchgrass Rhizosphere | TSKGKEARIGRDDGNGFLVVTRFKLKEIESGKIPDPVVKPGDRITIKD* |
| Ga0068851_106552591 | 3300005834 | Corn Rhizosphere | TPKAKEARLGRDDGKGFLVVTKFKLKDIESGKVQDPTIKPGDRITIKE* |
| Ga0068858_1006495161 | 3300005842 | Switchgrass Rhizosphere | QLGRDDGKGFLVVTKFKLKEIESGKAQDPVVKPGDRITIKE* |
| Ga0068858_1008366771 | 3300005842 | Switchgrass Rhizosphere | DGKGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE* |
| Ga0068860_1008276882 | 3300005843 | Switchgrass Rhizosphere | VTTKAKEARLGRDDGKGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE* |
| Ga0068862_1010995411 | 3300005844 | Switchgrass Rhizosphere | LGRDDGRGFLIVTKFKLKDIESGKVPDPLVRPGDRITVVQ* |
| Ga0068862_1016553171 | 3300005844 | Switchgrass Rhizosphere | DGRGFLIITKFKLKDIESGKVPDPLIRPGDRIMVIK* |
| Ga0075293_10477341 | 3300005875 | Rice Paddy Soil | PKGKEARLGRDDGKGYLVVTKFKLKDVEAGKVQDPTLKPGDRITIKE* |
| Ga0082029_13121472 | 3300006169 | Termite Nest | DGKGFLTVTKFKLKDIETGKVQDPGVKPGDRITIKE* |
| Ga0075430_1016796942 | 3300006846 | Populus Rhizosphere | LARDDGKGFLIVNRYKLQDIESGKMKDPLIEPGDRITIND* |
| Ga0075425_1007381021 | 3300006854 | Populus Rhizosphere | RDNGKGFLGVKRYKLKEIESGKVPDPPILPGDRITIIK* |
| Ga0075434_1026613821 | 3300006871 | Populus Rhizosphere | TAREAQVARDNGKGFLAVTRYKLKEIDSGKIADPAIQPGDRITITD* |
| Ga0079217_104881652 | 3300006876 | Agricultural Soil | GKPKEARLGRDDGRGFLIVTKFKLKDIESGKVPDPLVRPGDRITVVQ* |
| Ga0075424_1005755782 | 3300006904 | Populus Rhizosphere | GRGFLGVKRYKLKEIESGKVPDPPILPGDRITIIK* |
| Ga0097620_1018609151 | 3300006931 | Switchgrass Rhizosphere | VTNKAKEARLGRDDGNGYLTITKIKLKDIESGKAPDPLVRPGDRIMIVD* |
| Ga0079218_135616482 | 3300007004 | Agricultural Soil | GRGFLIVTKFKLKDIESGKVPDPLIRPGDRITVVE* |
| Ga0105240_114470821 | 3300009093 | Corn Rhizosphere | LTKNPKEARLARDSGKGFLVQSRYKLKDIDSGKVPDPLVQPGDRITIVK* |
| Ga0105240_124089472 | 3300009093 | Corn Rhizosphere | GGVTALAKQARLGRDNGKGFLVVNSYKLKDVDSGKIPDPVLQPGDRITIE* |
| Ga0105247_108354272 | 3300009101 | Switchgrass Rhizosphere | RDDGNGFLVVNRYKLKDIESGKVQDPVVKPGDRIVIRD* |
| Ga0105247_109323281 | 3300009101 | Switchgrass Rhizosphere | LGRDDGKGFLVVTRYKLKEIESGKVQDPGVKPGDRITIKE* |
| Ga0114129_130143092 | 3300009147 | Populus Rhizosphere | GRDNGDGFLVVTRYKLKDIDSGKVQDPVVKPGDRITIHD* |
| Ga0105243_115089272 | 3300009148 | Miscanthus Rhizosphere | GDGFLVVTRYKLKDIESGKVQDPLVKPGDRITIHD* |
| Ga0075423_102566931 | 3300009162 | Populus Rhizosphere | RDDGKGFLKETRYKLNEIASGKLLDPLIQPGDRITIIK* |
| Ga0105241_122260381 | 3300009174 | Corn Rhizosphere | PRKLKEARLSRDNGKGFLVVNRYKLKDIDSGRMPDPLLQPGDRVTVTK* |
| Ga0105237_102256013 | 3300009545 | Corn Rhizosphere | GKGFLVVTRFKLKEIESGKIQDPVIKPGDRITIGH* |
| Ga0105249_117248951 | 3300009553 | Switchgrass Rhizosphere | EATLGRDDGKGFLVVTKYKLKEIESGKVQDPVVKPGDRITIKE* |
| Ga0126315_105848402 | 3300010038 | Serpentine Soil | NGFLVVTRYKLKDIESGKVPDPAVKPGDRITIRD* |
| Ga0126308_109050741 | 3300010040 | Serpentine Soil | PKAKEARLGRDDGKGFLIVTRYKLKEIESGKVQDPAVKPGDRITIKE* |
| Ga0126312_109281712 | 3300010041 | Serpentine Soil | GKGFLVITTYKLKEIESGKAQDPAVKPGDRITIKE* |
| Ga0126384_125060471 | 3300010046 | Tropical Forest Soil | ARIGRDDGKGFLVVTRFKLKEIESGKIQDPLVKPGDRITIRD* |
| Ga0126382_123562143 | 3300010047 | Tropical Forest Soil | DNGKGFLVVNRYKLKDINSGKVPDPLIQAGDRITIE* |
| Ga0134128_108768502 | 3300010373 | Terrestrial Soil | KGFLNVIRYKLEEIESGKLQDPLIQPGDRILIVN* |
| Ga0105239_120576042 | 3300010375 | Corn Rhizosphere | KAKEARLGRDDGSGFLAVTVYKLKDIESGKAQDPVLKPGDRITIKD* |
| Ga0134126_102292223 | 3300010396 | Terrestrial Soil | GKGFLIVTKFKLKEIESGKVQDPTVKPGDRITIKE* |
| Ga0134124_129264431 | 3300010397 | Terrestrial Soil | TEARLWRDDGKGFLKETRYKLKEIASGKLLDPLIQPGDRITIIN* |
| Ga0134127_108617491 | 3300010399 | Terrestrial Soil | GKPKEARLGRDDGRGFLIVTKFKLKEIESGKVPDPLVRPGDRITVIQ* |
| Ga0134123_106661412 | 3300010403 | Terrestrial Soil | KEARLGRDDGKGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE* |
| Ga0120187_10175922 | 3300012015 | Terrestrial | KEARLARDDGKGFLAVTRYKLKEIESGKVQDPLVKPGDRITIKE* |
| Ga0136623_100323373 | 3300012045 | Polar Desert Sand | DDGKGFLSVSRYKLKDIDSGKQPDPLIQPGDRITIVD* |
| Ga0150985_1112000712 | 3300012212 | Avena Fatua Rhizosphere | VTPKAKEARLGRDDGKGFLVVTKYKLKEIESGKVQDPAVKPGDRITIKE* |
| Ga0137370_109065381 | 3300012285 | Vadose Zone Soil | QARLGRDDGNGFLVINHFKLKDIESGKVPDPVVKPGDRIMIVE* |
| Ga0137390_115652901 | 3300012363 | Vadose Zone Soil | EARIARDDGKGFLVVNRYKLKDIDSGKLPDPLIQPGDRITIVD* |
| Ga0126375_110526092 | 3300012948 | Tropical Forest Soil | GKGFLAVSRYKLKDIEKGKVADPVIQPGDRITIIK* |
| Ga0126375_115598462 | 3300012948 | Tropical Forest Soil | KEARLARDNGKGFLSVTRYKLKEINSGKVPDPVIQAGDRITIEH* |
| Ga0164299_114788461 | 3300012958 | Soil | RDDGKGFLVVTKYKLNEIESGKVQDPAVKPGDRITIKE* |
| Ga0157380_103048182 | 3300014326 | Switchgrass Rhizosphere | GRGLLAVKRYKLKEIDSGKVPDPVIQPGDRITIID* |
| Ga0157380_121513291 | 3300014326 | Switchgrass Rhizosphere | GKGFLVVTSYKLKEIDSGKVQDPLVKAGDRITIKD* |
| Ga0157377_103798882 | 3300014745 | Miscanthus Rhizosphere | RDDGKGFLTVTKYKLKEIESGKVQDPAVKPGDRITIKE* |
| Ga0157377_115920651 | 3300014745 | Miscanthus Rhizosphere | PREVRVGRDDGKGFLAVTRYQLKDIEMGKVQDPLIQPGDRITVIN* |
| Ga0132257_1009875631 | 3300015373 | Arabidopsis Rhizosphere | ARLARDDGKGFLIITKYKLKDIDSAKLPDPIIQPGDRITIID* |
| Ga0132257_1013177422 | 3300015373 | Arabidopsis Rhizosphere | RDNGKGFLMVKRYKLKEIESGKVPDPPIQTGDRITIIK* |
| Ga0132255_1035540072 | 3300015374 | Arabidopsis Rhizosphere | GKGFLVQSRYKLKDIDSGKVPGPLVQPGDRITIVK* |
| Ga0184605_101881732 | 3300018027 | Groundwater Sediment | GKPKEARLARDDGKGFLVVSRYKLKDIDSGKLPDPSIQPGDRITIVD |
| Ga0207642_110447572 | 3300025899 | Miscanthus Rhizosphere | VRLARDDGKGFLIVNHYKLKDIESGNVKDPLIQAGDRITINE |
| Ga0207710_106510281 | 3300025900 | Switchgrass Rhizosphere | KAKEARLGRDNGEGFLVVTRYKLKDIESGKVADPIVKPGDRITIHD |
| Ga0207647_103664011 | 3300025904 | Corn Rhizosphere | GRDDGKGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE |
| Ga0207654_102415872 | 3300025911 | Corn Rhizosphere | DNGEGFLVVTRYRLKDIESGKVPDPVVKPGDRITIHD |
| Ga0207654_113165021 | 3300025911 | Corn Rhizosphere | GRDDGKGFLVVTRYKLKEIESGKVQDPLVKPGDRITIHD |
| Ga0207707_106085771 | 3300025912 | Corn Rhizosphere | KGKEARLGRDDGHGFLTVTKFKLKEIESGKIADPVVHPGDRITIME |
| Ga0207660_102563671 | 3300025917 | Corn Rhizosphere | GGVVDKPKEARLGRDDGRGFLIITKFKLKDIESGKVPDPLIRPGDRIMVIK |
| Ga0207662_104424622 | 3300025918 | Switchgrass Rhizosphere | AQLARDNGRGFLAVKRYKLKEIDSGKVPDPVIQPGDRITIID |
| Ga0207687_109142733 | 3300025927 | Miscanthus Rhizosphere | MCAVRDDGKGFLVVTKFKLKDIESGKVQDPTIKPGDRITIKE |
| Ga0207706_105596291 | 3300025933 | Corn Rhizosphere | RLGRDDGNGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE |
| Ga0207670_117474561 | 3300025936 | Switchgrass Rhizosphere | DGNGFLVVTRFKLKEIESGKIPDPVVKPGDRITIKD |
| Ga0207669_109923391 | 3300025937 | Miscanthus Rhizosphere | GNGFLVMTRYKLKDIETGKGRDPQIQPGDRITIVD |
| Ga0207651_106315702 | 3300025960 | Switchgrass Rhizosphere | KVKEARLARDDGKGFLVVTSYKLKEIDSGKVQDPLVKAGDRITIKD |
| Ga0207640_109129531 | 3300025981 | Corn Rhizosphere | KEAQVGRDNGQGFLAITRYKLKEIESGKVADPSIEPGDRITIND |
| Ga0207639_118520721 | 3300026041 | Corn Rhizosphere | DGKGFLVVTRYKLKEIESGKVQDPDVKPGDRITIKE |
| Ga0207674_102966571 | 3300026116 | Corn Rhizosphere | NGEGFLVVTRYKLKEIESGKVQDPVVKPGDRITIRD |
| Ga0207674_108568762 | 3300026116 | Corn Rhizosphere | KEARLGRDDGRGFLILTKFKLKDIESGKVPDPLLRPGDRITVVK |
| Ga0209177_103743152 | 3300027775 | Agricultural Soil | GKKAELARDNGKGFLMVKRYKLKEIESGKVPDPPIQTGDRITIIK |
| Ga0209382_123323551 | 3300027909 | Populus Rhizosphere | DGNGFLVMTRYKLKDIETGKGRDPQIQPGDRITIVD |
| Ga0268265_104022301 | 3300028380 | Switchgrass Rhizosphere | KAKEARLGRDDGKGFLVVTRYKLKEIESGKVQDPAVKPGDRITIKE |
| Ga0307406_116763991 | 3300031901 | Rhizosphere | VLGKPKEARLGRDDGRGFLIVTKFKLKEIESGKVPDPLVRPGDRVTVIE |
| Ga0310900_118376801 | 3300031908 | Soil | AGGVVEKPKEARLGRDDGRGFLIVTKFKLKDIESGKVPDPLVRPGDRIMVVK |
| Ga0310906_103966491 | 3300032013 | Soil | DDGKGFLIVNRYKLQEIESGKLKDPLIEPGDRITIND |
| Ga0310810_102580471 | 3300033412 | Soil | RDDGKGFLTVTKYKLKDIESGKVQDPVVKPGDRITIKD |
| ⦗Top⦘ |