 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F092676 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 40 residues |
| Representative Sequence | VTYETRFERGEAMETFTLVERNGRWLLARYFVNSTALK |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.07 % |
| % of genes from short scaffolds (< 2000 bps) | 92.52 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.402 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.280 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.664 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (58.879 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 39.39% Coil/Unstructured: 60.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF00206 | Lyase_1 | 63.55 |
| PF10397 | ADSL_C | 18.69 |
| PF13211 | DUF4019 | 2.80 |
| PF00188 | CAP | 0.93 |
| PF13507 | GATase_5 | 0.93 |
| PF12710 | HAD | 0.93 |
| PF07583 | PSCyt2 | 0.93 |
| PF13462 | Thioredoxin_4 | 0.93 |
| PF03466 | LysR_substrate | 0.93 |
| PF01887 | SAM_HAT_N | 0.93 |
| PF08282 | Hydrolase_3 | 0.93 |
| PF02518 | HATPase_c | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.93 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.93 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.93 |
| COG1912 | Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming) | Defense mechanisms [V] | 0.93 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.93 |
| COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.93 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.40 % |
| Unclassified | root | N/A | 48.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.28% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 7.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.74% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.80% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.80% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.87% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.87% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.93% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.93% |
| Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 0.93% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012527 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ83 (22.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015086 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5c, rocky medial moraine) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034009 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 40SMS | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| 3300034376 | Biocrust microbial communities from Mojave Desert, California, United States - 19HNC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1034411712 | 3300000956 | Soil | VSYQTKFERGEAMETFTVIEENGKWKLARYLVNSTSLR* |
| JGI25382J37095_102725652 | 3300002562 | Grasslands Soil | VLTYETKFEGGDGMETFTLVERNGHWLLAKYLVNSMALS* |
| Ga0062592_1015545232 | 3300004480 | Soil | GHAFILSYETRFERGTGMETFTLIEQDGHWRLARYLVNSTALK* |
| Ga0062383_103256852 | 3300004778 | Wetland Sediment | IVAYRTKFQNGEGMETFTLVERNGRWLLARYFVNSTALK* |
| Ga0068869_1014714641 | 3300005334 | Miscanthus Rhizosphere | QEHSFVLTYQTKFERGEGMETFTLVERNRQWLLAKYFVNSIALQ* |
| Ga0070687_1007022672 | 3300005343 | Switchgrass Rhizosphere | YILTYQTRFERGDGMETFTLIEENGRWLLARYFVNSTALT* |
| Ga0070671_1018218931 | 3300005355 | Switchgrass Rhizosphere | ILSYDTRFERGDGMENFTLIEENGRWALARYFVNSTALK* |
| Ga0070701_110349112 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | FILSYETNFEHGAGMETFTLIEENGRWRLARYFVNSTALQ* |
| Ga0070705_1004794921 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | RAFIVAYRTKFQNGEGMETFTLVERDGHWLLARYFVNSTALK* |
| Ga0070708_1003256672 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LPGHSFVIAYQTKFERGDGMETFTLVERNGHWLLARYFVNSTALN* |
| Ga0070662_1002477961 | 3300005457 | Corn Rhizosphere | IVTYQTKFEQGQGMEWFTLIEEDNRWALARYLVNSTALR* |
| Ga0070662_1013784562 | 3300005457 | Corn Rhizosphere | KGRAFIVTYQTKFELGEAMETFTLVEENGRWKLARYLVNSTALK* |
| Ga0068867_1003100802 | 3300005459 | Miscanthus Rhizosphere | YIVAYRTKFQNGEGMETFTLVEREGRWQLARYFVNSTSLK* |
| Ga0068867_1020948971 | 3300005459 | Miscanthus Rhizosphere | IVTYRTKFQNAEAMENFTLVERDGRWLLARYLVNSTALK* |
| Ga0070706_1006509461 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | IVTYQTKFQNGEGMETLTLVERKGQWLLARYLVTSTALK* |
| Ga0070698_1015417191 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | YILTYRTRFQRGEGMETFTLVERKGQWLLARYLVTSTALK* |
| Ga0070698_1018422961 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | KGHVFILSYETSFERGDGMENFTLIEENGRWLLARYFVNSTALK* |
| Ga0070686_1010312361 | 3300005544 | Switchgrass Rhizosphere | IVAYQTKFELGEGMETYTLVERNGHWLLARYLVNSTALNQ* |
| Ga0070695_1001557553 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LKGHVYILTYQTRFEQGDGMETFTLIEDNGRWLLARYFVNSTALK* |
| Ga0070696_1012951141 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GHAFIVSYRTKFERGEGMETFTLVEENGRWVLARYLATSTALK* |
| Ga0070665_1003220471 | 3300005548 | Switchgrass Rhizosphere | KGHAYIVSYRTKFQNGEGMETFTLVERDGRWLLARYFVNSTALK* |
| Ga0070665_1015807042 | 3300005548 | Switchgrass Rhizosphere | TKFQNGEGMETFTLVERDGRWLLARYFVNSTALK* |
| Ga0066700_104381511 | 3300005559 | Soil | TSFERGDGMETFTLVEHGGRWYLARYFVSSKALK* |
| Ga0068855_1018081672 | 3300005563 | Corn Rhizosphere | ILLYETRFERGDGMETFTLIEESGQWRLARYFVNSTALK* |
| Ga0068852_1003615661 | 3300005616 | Corn Rhizosphere | VFILSYETNFEHGAGMETFTLIEENGHWLLARYFVNSTALK* |
| Ga0068863_1010151311 | 3300005841 | Switchgrass Rhizosphere | YETRFERGDGMENFTLIEENGRWALARYFVNSTALK* |
| Ga0068858_1008277422 | 3300005842 | Switchgrass Rhizosphere | KGHVYILTYQTHFEQGEGMETFTLIEDNGRWLLARYLVNSTALK* |
| Ga0068860_1004628561 | 3300005843 | Switchgrass Rhizosphere | VAYQTKFELGEGMETYTLVERNGHWLLARYLVNSTALNQ* |
| Ga0075289_10156202 | 3300005888 | Rice Paddy Soil | QTRFEQGDGMETFTLIENNGRWLLARYFVNSTALK* |
| Ga0082029_160701012 | 3300006169 | Termite Nest | SYETHFERGDGMENFTLIEENGQWRLARYFVNSTALK* |
| Ga0079222_105589251 | 3300006755 | Agricultural Soil | KGHAYILTYQTRFERGDGMETFTLIEENGRWLLARYFVNSMALK* |
| Ga0066659_117210882 | 3300006797 | Soil | AHSFIIDYKTTFDHGDGMETFTLVERNGRWLLARYFVNSDALK* |
| Ga0066660_115349061 | 3300006800 | Soil | YRTTFDKGDGMETFTLVERDGHWLLARYFVNSNALK* |
| Ga0079217_107118561 | 3300006876 | Agricultural Soil | KGRVYILSYQTRFERGEGMETFTLVEQNGRWLLARYFVNSTALK* |
| Ga0079219_100176171 | 3300006954 | Agricultural Soil | TRFANGDAMETFTLIDDNGRWELARYFVNSTALK* |
| Ga0099830_107958021 | 3300009088 | Vadose Zone Soil | VVAYQTKFERGDGMETFTLVERDGHWLLARYFVNSTALN* |
| Ga0099830_117527362 | 3300009088 | Vadose Zone Soil | VTYETRFERGEAMETFTLVERNGRWLLARYFVNSTALK* |
| Ga0105245_126894701 | 3300009098 | Miscanthus Rhizosphere | YILTYQTRFEQGDGMETFTLIEDNGRWLLARYFVNSTALK* |
| Ga0066709_1021510041 | 3300009137 | Grasslands Soil | TKFERADGMETFTFVERDGHWLLARYFVNSTALK* |
| Ga0114129_102625644 | 3300009147 | Populus Rhizosphere | VTYQTKFERGEGMETFTLVERDHQWQLARYFVSSMALK* |
| Ga0114129_114024201 | 3300009147 | Populus Rhizosphere | VFIVTYQTKFEQGQGMEWFTLIEEDNRWALARYLVNSTALK* |
| Ga0105237_1001979111 | 3300009545 | Corn Rhizosphere | SYETSFERGEAMETFTLIEENGRWELARYFVNSTALK* |
| Ga0105249_116898702 | 3300009553 | Switchgrass Rhizosphere | IVSYQTKFERGEAMETFTVIEENGKWKLARYLVSSTGLK* |
| Ga0105249_135670091 | 3300009553 | Switchgrass Rhizosphere | ILTYRTKFQHDEGMETFTLVERRGQWLLARYLVTSTALK* |
| Ga0126307_102908981 | 3300009789 | Serpentine Soil | SYKTHFEHGDGMETFTLIEENGRWLMARYFVNSTALK* |
| Ga0134124_102201071 | 3300010397 | Terrestrial Soil | LSYETHFERGDGMENFTLIEENGQWRLARYFVNSTLLKD* |
| Ga0134127_117307642 | 3300010399 | Terrestrial Soil | VAYRTKFQNGEGMETFTLVERDGHWLLARYFVNSTALK* |
| Ga0134122_104458591 | 3300010400 | Terrestrial Soil | LTYQTRFANGDAMETFTLIEDNGRWELARYFVNSTALK* |
| Ga0134122_121927351 | 3300010400 | Terrestrial Soil | YRTRFERGEAGETFTLIEENGQWLLARYLVNSTLLQ* |
| Ga0134121_112636721 | 3300010401 | Terrestrial Soil | FIVSYQTKFERGEAMETFTVIEENGKWKLARYLVSSTGLK* |
| Ga0105246_121618131 | 3300011119 | Miscanthus Rhizosphere | HVFILSYDTRFERGDGMENFTLIEENGRWALARYFVNSTALK* |
| Ga0137442_10471861 | 3300011414 | Soil | RAFIVAYRTKFQNGEGMETFTLVERDGRWLLARYFVNSTALK* |
| Ga0137463_10387073 | 3300011444 | Soil | GRAYIVTYRTKFQNGEGMETFTLVERDGRWLLARYFVNSTALK* |
| Ga0136631_101658271 | 3300012043 | Polar Desert Sand | TKFERAEAIEQLTLVERDGRWQLARYTVNSDALK* |
| Ga0136623_104626092 | 3300012045 | Polar Desert Sand | LKGDAFIITYQTKFEKAPGMETFTLVKRDNRWLLARYFVNSTALK* |
| Ga0136632_100905741 | 3300012093 | Polar Desert Sand | TYQTKFEKGQGMETFTLVKRDSRWLLAKYFVNSTALK* |
| Ga0136632_104742062 | 3300012093 | Polar Desert Sand | YNTKFERAEAIEQLTLVERDGRWQLARYTVNSDALK* |
| Ga0137380_115901792 | 3300012206 | Vadose Zone Soil | FVTYQTSFDRGDAMETFTLVERGGRWQLARYYVTSTALK* |
| Ga0157332_10340922 | 3300012511 | Soil | YQTKFERGEAMETFTVIEENGKWKLARYLVNSTSLR* |
| Ga0136633_10526302 | 3300012527 | Polar Desert Sand | YQTKFEKGQGMETFTLVKRDSRWLLARYFVNSTALK* |
| Ga0136614_109369021 | 3300012684 | Polar Desert Sand | TFARGTGMETFTLVEREGRWLLARYFVSSDALRQ* |
| Ga0136614_111702722 | 3300012684 | Polar Desert Sand | IITYQTKFEKASGMETFTLVKRDNRWLLARYFVNSTALK* |
| Ga0137416_101631061 | 3300012927 | Vadose Zone Soil | GRAYIVTYRTKFQNGEGMETFTLVERDGRWLLARYFVNSTGLK* |
| Ga0164299_105137861 | 3300012958 | Soil | IITYQTKFERAEAMETFTLIEENGHWMLARYLVNSTALQ* |
| Ga0164302_112439782 | 3300012961 | Soil | YRTKFQNAEAMETFTLVERDGRWLLARYLVNSTALK* |
| Ga0164309_119614111 | 3300012984 | Soil | SYETRFERGDGMENFTLIEENGRWLLARYFVNSTALK* |
| Ga0157378_104002481 | 3300013297 | Miscanthus Rhizosphere | YQTKFERGEAMETFTVIEENGKWKLARYLVNSTSLK* |
| Ga0157375_129192751 | 3300013308 | Miscanthus Rhizosphere | HAYIVSYRTKFQNGEGMETFTLVERDGRWLLARYFVNSTALK* |
| Ga0134079_105061611 | 3300014166 | Grasslands Soil | TKFQNGEGMETFTLVELDGRWLLARYFVNSTALK* |
| Ga0157379_102375331 | 3300014968 | Switchgrass Rhizosphere | LYETRFERGDGMETFTLIEESGQWRLARYFVNSTALK* |
| Ga0167655_10207772 | 3300015086 | Glacier Forefield Soil | YIVIYRTKFQNAEAMETFTLVERDGHWLLARYLVNSTALK* |
| Ga0136617_102617531 | 3300017789 | Polar Desert Sand | TGGHSFAITYTTTFERAEGMETFTLVERDGRWLLARYFVNSDALK |
| Ga0184632_104602472 | 3300018075 | Groundwater Sediment | DAFIITYQTKFEKGAGMETFTLVRRDRRWLLARYFVNSTALK |
| Ga0190272_101952601 | 3300018429 | Soil | VTYRTRFQNGEGMETFTLVERDRQWKLARYFVNSTALK |
| Ga0190268_111052561 | 3300018466 | Soil | YQTTFERGDAVEQFTLLEREGRWLLARYSVSSDALRP |
| Ga0190268_112515852 | 3300018466 | Soil | YNTKFERADAHETVTLVERDGRWQLARYAVNSDALKP |
| Ga0190270_106923302 | 3300018469 | Soil | GPLQGRAYILTYRTKFQNGEGMETFTLVERKGQWLLARYLVTSTALG |
| Ga0207645_102549512 | 3300025907 | Miscanthus Rhizosphere | YQTKFERAEAMETFTLIEENGHWMLARYLVNSTALQ |
| Ga0207660_105926442 | 3300025917 | Corn Rhizosphere | YRTRFERGEAGETFTLIEENGQWLLARYLVNSTLLQ |
| Ga0207660_108901842 | 3300025917 | Corn Rhizosphere | FIITYQTKFERAEAMETFTLIEENGHWMLARYLVNSTALQ |
| Ga0207681_103892262 | 3300025923 | Switchgrass Rhizosphere | RAFIVLYRSKFKLGEGMETFTIVERNGKWQLARYFVNSTQLQR |
| Ga0207706_100420461 | 3300025933 | Corn Rhizosphere | KGRAFIVTYQTKFELGEAMETFTLVEENGRWKLARYLVNSTALK |
| Ga0207706_101415591 | 3300025933 | Corn Rhizosphere | FIVTYQTKFEQGQGMEWFTLIEEDNRWALARYLVNSTALR |
| Ga0207670_115602382 | 3300025936 | Switchgrass Rhizosphere | HVYILTYQTRFERGEAMETFTLIEENGRWKLARYLVNSTALK |
| Ga0207711_112639021 | 3300025941 | Switchgrass Rhizosphere | YILSYQTRFERGDGMETFTLIEENGRWRLARYFVNSTALQ |
| Ga0207689_115455872 | 3300025942 | Miscanthus Rhizosphere | QEHSFVLTYQTKFERGEGMETFTLVERNRQWLLAKYFVNSIALQ |
| Ga0207640_110888752 | 3300025981 | Corn Rhizosphere | VFIVTYQTKFEQGQGMEWFTLIEEDNRWALARYLVNSTALR |
| Ga0207677_120613861 | 3300026023 | Miscanthus Rhizosphere | ILLYRTKFQRAEGMETFTLVERNGKWLLARYLVTSTALQ |
| Ga0207703_101523414 | 3300026035 | Switchgrass Rhizosphere | ETRFERGDGMETFTLIEESGQWRLARYFVNSTALK |
| Ga0207639_111095622 | 3300026041 | Corn Rhizosphere | GHAFILSYETSFERGEAMETFTLIEENGRWELARYFVNSTALK |
| Ga0207648_108213181 | 3300026089 | Miscanthus Rhizosphere | SYQTKFQNGEGMETFTFVERNGHWLLARYFVNSTALK |
| Ga0207676_108085552 | 3300026095 | Switchgrass Rhizosphere | VFILSYETHFERGDAMETFTLIEENGHWLLARYFVNSTALK |
| Ga0207674_116098511 | 3300026116 | Corn Rhizosphere | KGHVFILSYETHFERGDAMETFTLIEENGHWLLARYFVNSTALK |
| Ga0207698_107228611 | 3300026142 | Corn Rhizosphere | YETSFERGEGMENFTLIEENGRWALARYFVNSTALK |
| Ga0207428_106442051 | 3300027907 | Populus Rhizosphere | GHVFIVTYQSKFERGEAMETFTLIEENGRWKLARYLVNSTALK |
| Ga0209382_105972211 | 3300027909 | Populus Rhizosphere | YRTRFERGDAGETFTLVEENGSWLLARYLVNSTALK |
| Ga0268264_106154281 | 3300028381 | Switchgrass Rhizosphere | VFILLYETRFERGDGMETFTLIEESGQWRLARYFVNSTALK |
| Ga0268264_108773761 | 3300028381 | Switchgrass Rhizosphere | YQTKFELGEGMETYTLVERNGHWLLARYLVNSTALNQ |
| Ga0307405_109227042 | 3300031731 | Rhizosphere | KGDVFIITYQTKFEKAPGMETFTLVKRDNRWVLARYFVNSTALK |
| Ga0310889_107187051 | 3300032179 | Soil | YETRFERGAAMETFTLIEDKGSWLLARYLVNSTNLK |
| Ga0306920_1004166343 | 3300032261 | Soil | VVYQTSFERGEGMETFTLIERNGQWRLARYFVTSMALR |
| Ga0310810_101117556 | 3300033412 | Soil | SYQTQFQQAEGMETFTLVEQQGQWLLARYFVNSTALK |
| Ga0310810_109494551 | 3300033412 | Soil | LKGRAFIVAYRTKFQNGEGMETFTLVERDGRWQLARYFVNSTALK |
| Ga0310810_110220721 | 3300033412 | Soil | YQTNFERGEAMETFTLVEQNGRWLLARYFVNSTAL |
| Ga0334944_106711_416_529 | 3300034009 | Sub-Biocrust Soil | YETKFERGDGMETFTLLERDGRWLLAGYMVNSDTLKQ |
| Ga0364932_0108336_3_116 | 3300034177 | Sediment | TYRTKFQNGEGMETFTLVERDGRWLLARYFVNSTALK |
| Ga0334923_028684_1021_1152 | 3300034376 | Hypolithic Biocrust | MHRLVIRYETKFERGDGLETFTLLERDGRWLLAGYFVNSDALK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |