| Basic Information | |
|---|---|
| Family ID | F092673 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 49 residues |
| Representative Sequence | AIGSDVTFYSKPSILDSIYGSNPVSWKLFFRIRPSPMTMSRMHGTH |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 94.39 % |
| % of genes from short scaffolds (< 2000 bps) | 84.11 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.262 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (14.953 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.336 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (72.897 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.46% β-sheet: 0.00% Coil/Unstructured: 90.54% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13798 | PCYCGC | 42.99 |
| PF00578 | AhpC-TSA | 12.15 |
| PF11604 | CusF_Ec | 7.48 |
| PF13414 | TPR_11 | 1.87 |
| PF04234 | CopC | 0.93 |
| PF13088 | BNR_2 | 0.93 |
| PF00484 | Pro_CA | 0.93 |
| PF13620 | CarboxypepD_reg | 0.93 |
| PF01432 | Peptidase_M3 | 0.93 |
| PF04366 | Ysc84 | 0.93 |
| PF13474 | SnoaL_3 | 0.93 |
| PF13508 | Acetyltransf_7 | 0.93 |
| PF02518 | HATPase_c | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.93 |
| COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.93 |
| COG2372 | Copper-binding protein CopC (methionine-rich) | Inorganic ion transport and metabolism [P] | 0.93 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.26 % |
| Unclassified | root | N/A | 3.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_105567795 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300000550|F24TB_13048664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 541 | Open in IMG/M |
| 3300000956|JGI10216J12902_110052107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1155 | Open in IMG/M |
| 3300001089|JGI12683J13190_1020612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300002897|JGI24804J43974_1000714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 2435 | Open in IMG/M |
| 3300003323|rootH1_10013116 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300004157|Ga0062590_100473238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1057 | Open in IMG/M |
| 3300004479|Ga0062595_101957358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300005093|Ga0062594_100645139 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300005288|Ga0065714_10212759 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300005293|Ga0065715_10582753 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300005293|Ga0065715_11080677 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005328|Ga0070676_10072941 | All Organisms → cellular organisms → Bacteria | 2065 | Open in IMG/M |
| 3300005337|Ga0070682_101097491 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300005340|Ga0070689_100508729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1033 | Open in IMG/M |
| 3300005340|Ga0070689_101422134 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300005343|Ga0070687_101075659 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300005434|Ga0070709_11565551 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005438|Ga0070701_10926605 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300005440|Ga0070705_101193002 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300005440|Ga0070705_101685670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 535 | Open in IMG/M |
| 3300005441|Ga0070700_100026506 | All Organisms → cellular organisms → Bacteria | 3424 | Open in IMG/M |
| 3300005536|Ga0070697_101586932 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005536|Ga0070697_101861276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 539 | Open in IMG/M |
| 3300005564|Ga0070664_100682716 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300005615|Ga0070702_101245793 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300005618|Ga0068864_100750422 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300005618|Ga0068864_101414167 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005618|Ga0068864_102194320 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005719|Ga0068861_100558891 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300005719|Ga0068861_101332827 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300005840|Ga0068870_10478144 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300005843|Ga0068860_100455327 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300005844|Ga0068862_100955792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 845 | Open in IMG/M |
| 3300005844|Ga0068862_101052725 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300006058|Ga0075432_10056891 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300006169|Ga0082029_1767914 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300006237|Ga0097621_100049979 | All Organisms → cellular organisms → Bacteria | 3399 | Open in IMG/M |
| 3300006755|Ga0079222_10291514 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300006755|Ga0079222_12113148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 557 | Open in IMG/M |
| 3300006852|Ga0075433_10225617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1664 | Open in IMG/M |
| 3300006876|Ga0079217_10017338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2468 | Open in IMG/M |
| 3300006880|Ga0075429_101552408 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300006904|Ga0075424_100469157 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300006904|Ga0075424_100657262 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300007004|Ga0079218_11463434 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300009098|Ga0105245_10350976 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300009098|Ga0105245_11121786 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300009100|Ga0075418_10143214 | All Organisms → cellular organisms → Bacteria | 2543 | Open in IMG/M |
| 3300009101|Ga0105247_11479553 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300009162|Ga0075423_10394699 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
| 3300009174|Ga0105241_11488446 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300009174|Ga0105241_11713461 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300009176|Ga0105242_13002918 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300009177|Ga0105248_13243820 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300010037|Ga0126304_10358451 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300010045|Ga0126311_10011972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4908 | Open in IMG/M |
| 3300010046|Ga0126384_10618715 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300010375|Ga0105239_10776867 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300010397|Ga0134124_11679630 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300012189|Ga0137388_11657255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 574 | Open in IMG/M |
| 3300012893|Ga0157284_10226641 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300012986|Ga0164304_10256507 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300013100|Ga0157373_11590236 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300013102|Ga0157371_11658095 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300013297|Ga0157378_11607584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 696 | Open in IMG/M |
| 3300013306|Ga0163162_12445342 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300013307|Ga0157372_10576528 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300013308|Ga0157375_10526044 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300014325|Ga0163163_12645629 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300014745|Ga0157377_10703060 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300015052|Ga0137411_1301091 | All Organisms → cellular organisms → Bacteria | 2919 | Open in IMG/M |
| 3300015085|Ga0167632_1022847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 852 | Open in IMG/M |
| 3300015265|Ga0182005_1184412 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300015371|Ga0132258_12323739 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300015372|Ga0132256_101195274 | Not Available | 874 | Open in IMG/M |
| 3300015372|Ga0132256_102592677 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300018466|Ga0190268_12171880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300025899|Ga0207642_10950788 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300025911|Ga0207654_10732968 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300025936|Ga0207670_10690833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 844 | Open in IMG/M |
| 3300025936|Ga0207670_11256811 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300025945|Ga0207679_11586284 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300026023|Ga0207677_11441972 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300026035|Ga0207703_10142186 | All Organisms → cellular organisms → Bacteria | 2084 | Open in IMG/M |
| 3300026041|Ga0207639_10050519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3158 | Open in IMG/M |
| 3300026088|Ga0207641_11955326 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300026089|Ga0207648_10237940 | All Organisms → cellular organisms → Bacteria | 1620 | Open in IMG/M |
| 3300026089|Ga0207648_10582450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1030 | Open in IMG/M |
| 3300026095|Ga0207676_10123753 | All Organisms → cellular organisms → Bacteria | 2186 | Open in IMG/M |
| 3300026116|Ga0207674_10806215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 906 | Open in IMG/M |
| 3300026116|Ga0207674_11194782 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300026118|Ga0207675_100122509 | All Organisms → cellular organisms → Bacteria | 2461 | Open in IMG/M |
| 3300027639|Ga0209387_1000314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 14155 | Open in IMG/M |
| 3300027691|Ga0209485_1149382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 697 | Open in IMG/M |
| 3300027775|Ga0209177_10203018 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300027909|Ga0209382_11398869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 703 | Open in IMG/M |
| 3300028381|Ga0268264_10065926 | All Organisms → cellular organisms → Bacteria | 3052 | Open in IMG/M |
| 3300028381|Ga0268264_10941753 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300028381|Ga0268264_12288987 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300031548|Ga0307408_100247440 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300032004|Ga0307414_10159948 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300032180|Ga0307471_103809674 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300033412|Ga0310810_10802559 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 14.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.48% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.48% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 6.54% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 5.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.87% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.87% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.93% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.93% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300002897 | Soil microbial communities from Manhattan, Kansas, USA - Sample 500um Nextera | Environmental | Open in IMG/M |
| 3300003323 | Sugarcane root Sample H1 | Host-Associated | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015085 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1055677952 | 3300000364 | Soil | IGSDVTFYSKPAILDSVYGNNPVSWKLFFRIRPGKMTMQMH* |
| F24TB_130486642 | 3300000550 | Soil | EIWNPKKTSVALGSDLTFYSKPEILDSIYGDHPVSWKFFVRLRPTKMTMSDLHGKH* |
| JGI10216J12902_1100521071 | 3300000956 | Soil | SDLTFYSKPSILDSVYGTNPVSWKIFFRLRPSKMNMSGTHGTH* |
| JGI12683J13190_10206121 | 3300001089 | Forest Soil | IGSDLTFYSKPAILDRIYGANPVSWKLFLRIRPGKMDMSSMHGTHGKH* |
| JGI24804J43974_10007141 | 3300002897 | Soil | SVALGSDVTFYSKPAALDQIYGSSPVSWKVFVRLRPAKMDMQRMHGGH* |
| rootH1_100131162 | 3300003323 | Sugarcane Root And Bulk Soil | LTFYSKPSILDPIYGSNPVSWKVFVRIRPGQMHMSSMHGMH* |
| Ga0062590_1004732381 | 3300004157 | Soil | FYSKPSILDSIYGAHPVSWKLFVRVRPAAMNMTGMHSMH* |
| Ga0062595_1019573582 | 3300004479 | Soil | VTFYSKPSILDSIYGSNPVSWKLFVRVRPAQMNMSGMHATH* |
| Ga0062594_1006451391 | 3300005093 | Soil | ALAIGSDVTFYSKPSILDSVYGNNPVSWKLFFRIRPGKMTMHMH* |
| Ga0066688_104262582 | 3300005178 | Soil | SLAVGSDVTFYSKPAALDPIYGQRPVSWKLFFRIRPGKMEMSHAHDGMQMPQGQQ* |
| Ga0065714_102127593 | 3300005288 | Miscanthus Rhizosphere | NTEKASFAIGSDLTLYSTPSVLDPIYGSNPVSWKLFVRVRPGPMNMSSMHGMH* |
| Ga0065715_105827532 | 3300005293 | Miscanthus Rhizosphere | GGARDIWNTEKTSLAIGSDLTFYSKPSLLDPIYGANPVSWKLFFRVRPAQMNMSAMHGTH |
| Ga0065715_110806771 | 3300005293 | Miscanthus Rhizosphere | KTSVAIGSDVTFYSKPPILDSIYGSNPVSWKVFVRVRPGPMNMSSSMHGTH* |
| Ga0070676_100729411 | 3300005328 | Miscanthus Rhizosphere | GGSREIWNTEKHSLALGSDVTFYSKPSILDSIYGKNPVSWKFFIRLRPQKMTHGTH* |
| Ga0070690_1011565121 | 3300005330 | Switchgrass Rhizosphere | GIGSDLTFYSKPSILDTLYGNNPVSWKIFFRIRPGKMDMHSMHGTSGDKNKK* |
| Ga0070682_1010974911 | 3300005337 | Corn Rhizosphere | AGGARDIWNTEKTSVAIGSDVTFYSKPSILDPIYGTNPVSWKVFVRVRPGPMNMSSMHGTH* |
| Ga0070689_1005087291 | 3300005340 | Switchgrass Rhizosphere | AIGSDLTFYSKPSILDSIYGTNPVSWKAFVRIRPGQMNMGSMHGMH* |
| Ga0070689_1014221341 | 3300005340 | Switchgrass Rhizosphere | EKVSLAIGSDLTFYSKPSILDSIYGANPVSWKAFVRIRPGQMNMSSMHGTH* |
| Ga0070687_1010756591 | 3300005343 | Switchgrass Rhizosphere | DVTFYSKPSILDSVYGENPVSWKIFFRLRPAKMTMHGSHQTH* |
| Ga0070709_115655512 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | FAIGSDLTFYSKPSLLDSVYGTNPISWKAFFRIRPGKIDMHGGH* |
| Ga0070701_109266052 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | TEKTSVAIGSDVTFYSKPSILDSIYGSNPVSWKVFVRVRPGPMNMSSMHGTH* |
| Ga0070705_1011930021 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | TSFAIGSDLTFYSKPSLLDPIYGSNPVSWKLFFRLRPNEMNMSAMH* |
| Ga0070705_1016856702 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | GTRDIWNTEKTSLAIGSDVTFYSKPSILDSIYGAHPVSWKLFVRVRPAAMNMTGMHSMH* |
| Ga0070700_1000265061 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | AIGSDVTFYSKPSILDSIYGKNPVSWKFFIRLRPQKMTHGTH* |
| Ga0070697_1015869322 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | SLAIGSDVTFYSKPSILDSIYGQHPVSWKVFVRLRPGPMNMNGMH* |
| Ga0070697_1018612762 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | DLTFYSKPAILDRIYGTNPVSWKLFLRFSAGKMDMSSVHGMH* |
| Ga0070664_1006827163 | 3300005564 | Corn Rhizosphere | IGSDVTFYSKPSILDPIYGANPVSWKIFVRVRPGPMDMSSMHGTH* |
| Ga0070702_1012457932 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | GSDVTFYSKPSILDSVYGQNPVSWKLFVRIRPAPMNMSGMHSMH* |
| Ga0068864_1007504221 | 3300005618 | Switchgrass Rhizosphere | DVTFYSKPSILDSIYGAHPVSWKLFVRVRPAAMNMTGMHSMH* |
| Ga0068864_1014141672 | 3300005618 | Switchgrass Rhizosphere | TAGGARDIWNTEKTSVAIGSDVTFYSKPSILDPIYGSHPVSWKVFVRVRPGPMNMSSSMHGTH* |
| Ga0068864_1021943202 | 3300005618 | Switchgrass Rhizosphere | RDIWNTEKVSLAIGSDLTFYSKPSILDPIYGANPVSWKAFVRIRPGQMNMSSMHGTH* |
| Ga0068861_1005588911 | 3300005719 | Switchgrass Rhizosphere | AIGSDVTFYSKPSILDSIYGSNPVSWKLFFRIRPSPMTMSRMHGTH* |
| Ga0068861_1013328272 | 3300005719 | Switchgrass Rhizosphere | IGSDLTFYSKPSILDPIYGANPVSWKAFVRIRPGPMKMSSMHDMH* |
| Ga0068870_104781441 | 3300005840 | Miscanthus Rhizosphere | IWNTEKHSFAVGSDVTFYSKPSILDAIYGTNPVSWKIFFRLRPQKMSMSGMHGTH* |
| Ga0068860_1004553272 | 3300005843 | Switchgrass Rhizosphere | YTFGGVRDLWNSRRLSLAIGSDLTFYSKPSVLDQIYGSNPVSWKLFFRVRPAKMK* |
| Ga0068862_1009557921 | 3300005844 | Switchgrass Rhizosphere | GSDVTFYSKPSILDPIYGSNPVSWKLFVRLRPAPMTMSRMMHGMH* |
| Ga0068862_1010527251 | 3300005844 | Switchgrass Rhizosphere | NTEKVSLAIGSDLTFYSKPSILDSIYGANPVSWKAFVRIRPGQMNMSSMHGTH* |
| Ga0068862_1014275043 | 3300005844 | Switchgrass Rhizosphere | GIGSDLTFYSKPAILDSIYGNKPISWKLFFRIRPGKMDMHGTH* |
| Ga0075432_100568914 | 3300006058 | Populus Rhizosphere | KTSFAIGSDLTFYSKPSLLDSIYGSNPVSWKLFFRLRPSRMNMSAMHGTH* |
| Ga0082029_17679143 | 3300006169 | Termite Nest | IGADTFGGAREIWNTEKTSFAVGSDLTFYSKPSLLDPIYGSNPVSWKLFFRVRPSQMNMSAMHGTH* |
| Ga0097621_1000499791 | 3300006237 | Miscanthus Rhizosphere | GSDLTFYSKPSVLDQIYGSNPVSWKLFFRVRPAKMK* |
| Ga0079222_102915143 | 3300006755 | Agricultural Soil | VAIGTDLTFYSKPSILDPIYGSNPVSWKAFVRISPGPMNMSSMHGMH* |
| Ga0079222_121131482 | 3300006755 | Agricultural Soil | SLAVGSDVTFYSKPSILDPIYGSHPVSWKLFFRLRPAPMNMSGMH* |
| Ga0075433_102256171 | 3300006852 | Populus Rhizosphere | FAIGSDLTFYSKPSLLDPIYGSNPVSWKLFFRLRPSEMNMSAMHGTH* |
| Ga0079217_100173385 | 3300006876 | Agricultural Soil | GSDLTFYSKPSILDSIYGTNPVSWKLFIRLRPQKMNMSGMHGTH* |
| Ga0075429_1015524082 | 3300006880 | Populus Rhizosphere | WNTEKHSLAIGSDVTFYSKPSILDSIYGTNPVSWKIFFRLRPQKMSMSGMHGTH* |
| Ga0075424_1004691573 | 3300006904 | Populus Rhizosphere | VGSDVTFYSKPSILDSIYGSNPVSWKLFVRVRPAQMNMSGMHATH* |
| Ga0075424_1006572623 | 3300006904 | Populus Rhizosphere | SDLTFYSTPSILDPIYGSNPVSWKLFFRLRPSEMNMSAMHGMH* |
| Ga0079218_114634341 | 3300007004 | Agricultural Soil | TEKHSLAIGSDVTFYSKPSILDSIYGTNPVSWKIFFRLRPQKMSMSGMHGTH* |
| Ga0105245_103509763 | 3300009098 | Miscanthus Rhizosphere | SIAAGSDVTFYSKPAVLDQLYGNNPVSWKLFLRFRPGKMEMSSMHPTH* |
| Ga0105245_111217863 | 3300009098 | Miscanthus Rhizosphere | FYSTPSLLDPIYGSNPVSWKLFFRLRPSQMNMSSMHGTH* |
| Ga0075418_101432144 | 3300009100 | Populus Rhizosphere | GAREIWNTDRASLAIGTDLTFYSKPSILDTVYGTHPVSWKAFFRVRPGKMKMHGMH* |
| Ga0105247_114795531 | 3300009101 | Switchgrass Rhizosphere | DIWNTEKTLLAIGSDVTFYSKPSLLDSVYGQNPVSWKLFVRVRPAPMNMSGMHSMH* |
| Ga0075423_103946994 | 3300009162 | Populus Rhizosphere | EKTSFAIGSDLTFYSKPSLLDPIYGSNPVSWKLFFRLRPSEMNMSAMHGMH* |
| Ga0105241_114884461 | 3300009174 | Corn Rhizosphere | LTFYSKPALLDPIYGGNPVSWKAYLRFRPGKMDMASMHGTH* |
| Ga0105241_117134611 | 3300009174 | Corn Rhizosphere | PSILDPIYGSNPVSWKVFVRVRPGPMNMSSMHGMH* |
| Ga0105242_130029182 | 3300009176 | Miscanthus Rhizosphere | IGSDLTFYSKPSLLDPIYGSNPVSWKLFFRLRPNEMNMSAMHGTH* |
| Ga0105248_132438202 | 3300009177 | Switchgrass Rhizosphere | RDIWNTEKASVAIGSDLTFYSKPSILDPIYGANPVSWKAFVRIRPGPMKMSSMHDMH* |
| Ga0126304_103584511 | 3300010037 | Serpentine Soil | IGSDLTFYSKPAILDSIYGSNPVSWKIFFRVRPGPMNMSSMHGTH* |
| Ga0126311_100119721 | 3300010045 | Serpentine Soil | SDVTFYSKPSILDPVYGSNPVSWKVFVRLRPGPMSMTH* |
| Ga0126384_106187153 | 3300010046 | Tropical Forest Soil | AIGSDVTFYSKPSLLDPIYGSHPVSWKLFFRLRPAPMSMSGMHGMH* |
| Ga0105239_107768673 | 3300010375 | Corn Rhizosphere | IGSDLTFYSTPSILDPIYGSNPVSWKLFVRVRPGPMNMSSMHGMH* |
| Ga0134124_116796301 | 3300010397 | Terrestrial Soil | IGAYTAGGARDIWNTEKTSVAIGSDVTFYSKPSILDPIYGANPVSWKIFVRVRPGPMDMSSMHGTH* |
| Ga0137388_116572552 | 3300012189 | Vadose Zone Soil | GSDLTFYSKPAVLDQIYGANPVSWKLFLRFRPGKMDMSMHGRH* |
| Ga0157284_102266412 | 3300012893 | Soil | VWNTAKTSLAIGSDVTFYSKPSILDSVYGENPVSWKIFFRLRPAKMTMHGSHQTH* |
| Ga0164304_102565071 | 3300012986 | Soil | SARVSIALGSDVTFYSKPALLDQLYGNNPVSWKLFFRIRPGKMEMSEPHGTH* |
| Ga0157373_115902362 | 3300013100 | Corn Rhizosphere | EKTSFAIGSDLTFYSKPSLLDPIYGLNPVSWKLFFRLRPNEMNMSAMHGTH* |
| Ga0157371_116580952 | 3300013102 | Corn Rhizosphere | GGARDIWNTEKTSLAIGSDVTFYSKPSILDSIYGAHPVSWKLFVRVRPAAMNITGMHSMH |
| Ga0157378_116075843 | 3300013297 | Miscanthus Rhizosphere | ELFTSTKVSLAVGSDVTFYSKPAMLDQIYGNNPVSWKLFLRFRPGKMEMSSMHGGH* |
| Ga0163162_124453421 | 3300013306 | Switchgrass Rhizosphere | TFGGARDIWNTEKTSLAIGSDLTFYSKPSILDSIYGTNPVSWKAFVRIRPGQMNMGSMHGMH* |
| Ga0157372_105765281 | 3300013307 | Corn Rhizosphere | TSVAIGSDVTFYSKPSILDPVYGSNPVSWKVFVRLRPSPMSMTH* |
| Ga0157375_105260441 | 3300013308 | Miscanthus Rhizosphere | DIWNTEKTLLAIGSDVTFYSKPSLLDSVYGQNPVSWKLFVRIRPAPMNMSGMHSMH* |
| Ga0163163_126456291 | 3300014325 | Switchgrass Rhizosphere | ARDIWNTEKTSVAIGSDLTFYSKPSILDPIYGTNPVSWKVFVRVRPGPMNMSSMHGTH* |
| Ga0157377_107030601 | 3300014745 | Miscanthus Rhizosphere | TEKTSVAIGSDVTFYSKPSILDPIYGSHPVSWKVFVRVRPGPMNMSSSMHGTH* |
| Ga0137411_13010914 | 3300015052 | Vadose Zone Soil | MAIGSDVTFYSKPSALDRLYGANPVSWRLFLRLRPSKMDMSGTKYTAI* |
| Ga0167632_10228472 | 3300015085 | Glacier Forefield Soil | KISFAIGSDLTFYSKPALLDPIYGNPVSWKLFVRLRPARMKMGNIQSTHENH* |
| Ga0182005_11844121 | 3300015265 | Rhizosphere | SDVTFYSKASILDPIYGSHPVSWKLFFRLRPAPMSMGGMHGTH* |
| Ga0132258_123237394 | 3300015371 | Arabidopsis Rhizosphere | DLTFYSKSSLLDPIYGSNPVSWKLFFRLRPNEMNMSAMHGTH* |
| Ga0132256_1011952741 | 3300015372 | Arabidopsis Rhizosphere | AIGSDVTFYSKPAALDVIYGNNPVSWKVFFRLRPAKMKMDVHGSHDQMTKPE* |
| Ga0132256_1025926771 | 3300015372 | Arabidopsis Rhizosphere | GSDLTFYSKPSVLDQIYGSNPVSWKLFFRVRPAKM* |
| Ga0190268_121718801 | 3300018466 | Soil | GSDVTFYSKPSILDSIYGANPVSWKLFVRLRPSQMTMSRMH |
| Ga0207642_109507882 | 3300025899 | Miscanthus Rhizosphere | RDIWNTEKTSVAIGSDVTFYSKPPILDSIYGSNPVSWKVFVRVRPGPMNMSSAMHGTH |
| Ga0207654_107329681 | 3300025911 | Corn Rhizosphere | TEKTSLAIGSDVTFYSKPSILDSIYGAHPVSWKLFVRVRPAAMNMTGMHSMH |
| Ga0207670_106908331 | 3300025936 | Switchgrass Rhizosphere | PSLLDPIYGSNPVSWKLFFRLRPNEMNMSAMHGTH |
| Ga0207670_112568112 | 3300025936 | Switchgrass Rhizosphere | EKVSLAIGSDLTFYSKPSILDSIYGANPVSWKAFVRIRPGQMNMSSMHGTH |
| Ga0207679_115862841 | 3300025945 | Corn Rhizosphere | FRIGAYTAGGARDIWNTEKTSVAIGSDLTFYSKPSILDPIYGTNPVSWKVFVRVRPGPMNMSSMHGSH |
| Ga0207677_114419722 | 3300026023 | Miscanthus Rhizosphere | AIGSDVTFYSKPSILDPIYGAHPVSWKLFFRLRPAPMSMGGMHGTH |
| Ga0207703_101421861 | 3300026035 | Switchgrass Rhizosphere | IGSDLTFYSKPSLLDPIYGSNPVSWKLFFRLRPSQMKMGAMHGTH |
| Ga0207639_100505196 | 3300026041 | Corn Rhizosphere | IWNTGTTSFAIGSDLTFYSKPSLLDPIYGSNPVSWKLFFRLRPSQMNMGAMHGTH |
| Ga0207641_119553261 | 3300026088 | Switchgrass Rhizosphere | IWNTEKTSLAIGSDLTFYSKPSLLDPIYGSNPVSWKLFFRLRPSQMNMSAMHGTH |
| Ga0207648_102379404 | 3300026089 | Miscanthus Rhizosphere | SLAVGSDLTFYSKPSLLDPIYGSNPVSWKLFFRLRPNEMNMSGMHGTH |
| Ga0207648_105824503 | 3300026089 | Miscanthus Rhizosphere | GSDVTFYSKPSILDSIYGKNPVSWKFFIRLRPQKMTHGTH |
| Ga0207676_101237531 | 3300026095 | Switchgrass Rhizosphere | EKTSLAIGSDVTFYSKPSILDSIYGAHPVSWKLFVRVRPAAMNMTGMHSMH |
| Ga0207674_108062151 | 3300026116 | Corn Rhizosphere | SLAIGSDLTFYSKPSILDPIYGTNPVSWKIFVRLRPQKMSMSGMHGTH |
| Ga0207674_111947821 | 3300026116 | Corn Rhizosphere | SDVTFYSKPSILNPIYGSNPVSWKVFVRIRPGPMNMSSSMHGMH |
| Ga0207675_1001225095 | 3300026118 | Switchgrass Rhizosphere | FYSKPSILDSIYGKNPVSWKFFIRLRPQKMTHGTH |
| Ga0209387_10003141 | 3300027639 | Agricultural Soil | NTEKHSLAIGSDVTFYSKPSILDSIYGTNPVSWKIFFRLRPQKMSMSGMHGTH |
| Ga0209485_11493821 | 3300027691 | Agricultural Soil | SKPSILDSIYGTNPVSWKIFFRLRPQKMSMSGMHGTH |
| Ga0209177_102030181 | 3300027775 | Agricultural Soil | AVGSDVTFYSKPSLLDPIYGSHPVSWKLFFRLRPAPMNMSGMH |
| Ga0209382_113988691 | 3300027909 | Populus Rhizosphere | LAVGTDITFYSKPSILDSIYGTNPVSWKIFLRLRPQKMSMSGMHGTH |
| Ga0268264_100659266 | 3300028381 | Switchgrass Rhizosphere | KTSVAIGSDVTFYSKPPILDPIYGSNPVSWKVFVRVRPGPMSMSSSMHGTH |
| Ga0268264_109417531 | 3300028381 | Switchgrass Rhizosphere | IGAYTIGGARDIWNTEKTLLAIGSDVTFYSKPSLLDSVYGQNPVSWKLFVRIRPAPMNMSGMHSMH |
| Ga0268264_122889872 | 3300028381 | Switchgrass Rhizosphere | SILDPIYGSNPVSWKLFFRVRPAPMTMSRMMHGMH |
| Ga0307408_1002474401 | 3300031548 | Rhizosphere | VVTGGARDIWNPESTSVAIGSDVTFYSKPPILDSIYGSNPVSWKVFVRVRPGAMNMSSMHGTQ |
| Ga0307414_101599484 | 3300032004 | Rhizosphere | NTERTSLAIGSDVTFYSKPSLLDSVYGSNPVSWKVFFRLRPGPMSMTH |
| Ga0307471_1038096742 | 3300032180 | Hardwood Forest Soil | GAYTLGGARDIWNTEKTSLALGSDVTFYSKPSVLDSIYGDNPVSWKLFVRLRPSQMSMTH |
| Ga0310810_108025591 | 3300033412 | Soil | DVTFYSKPSILDPIYGSHPVSWKLFFRLRPAPMSMGGMHGTH |
| ⦗Top⦘ |