NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092672

Metagenome / Metatranscriptome Family F092672

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092672
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 107 residues
Representative Sequence WKARLPELSGLTNLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHQVQPHGLDLKPIDMALACRNEKCTAEDVFALHTDLNRQCESAVSYISARP
Number of Associated Samples 104
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.93 %
% of genes near scaffold ends (potentially truncated) 95.33 %
% of genes from short scaffolds (< 2000 bps) 94.39 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.83

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(10.280 % of family members)
Environment Ontology (ENVO) Unclassified
(41.121 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(27.103 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 53.08%    β-sheet: 0.00%    Coil/Unstructured: 46.92%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.83
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.24.16.1: Kanamycin nucleotidyltransferase (KNTase), C-terminal domaind6un8a26un80.6098
a.285.1.1: MtlR-liked3brja13brj0.59119
a.24.16.0: automated matchesd1wola_1wol0.5819
a.24.16.4: Glutamine synthase adenylyltransferase GlnE, domain 2d1v4aa11v4a0.57786
a.24.16.2: Family 1 bi-partite nucleotidyltransferase subunitd1wtya_1wty0.57602


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF00701DHDPS 7.48
PF05721PhyH 1.87
PF01694Rhomboid 1.87
PF00248Aldo_ket_red 1.87
PF04909Amidohydro_2 1.87
PF02518HATPase_c 1.87
PF00291PALP 1.87
PF01844HNH 0.93
PF16804DUF5071 0.93
PF01370Epimerase 0.93
PF02353CMAS 0.93
PF08269dCache_2 0.93
PF01862PvlArgDC 0.93
PF13744HTH_37 0.93
PF02661Fic 0.93
PF12728HTH_17 0.93
PF14487DarT 0.93
PF00596Aldolase_II 0.93
PF02446Glyco_hydro_77 0.93
PF13432TPR_16 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 14.95
COG0705Membrane-associated serine protease, rhomboid familyPosttranslational modification, protein turnover, chaperones [O] 1.87
COG5285Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) familySecondary metabolites biosynthesis, transport and catabolism [Q] 1.87
COG16404-alpha-glucanotransferaseCarbohydrate transport and metabolism [G] 0.93
COG1945Pyruvoyl-dependent arginine decarboxylaseAmino acid transport and metabolism [E] 0.93
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.93
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 0.93
COG2230Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferasesLipid transport and metabolism [I] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664021|ICCgaii200_c0575044All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium660Open in IMG/M
3300000787|JGI11643J11755_11629247All Organisms → cellular organisms → Bacteria1625Open in IMG/M
3300000890|JGI11643J12802_10660879All Organisms → cellular organisms → Bacteria → Proteobacteria1147Open in IMG/M
3300002122|C687J26623_10210677All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium538Open in IMG/M
3300002124|C687J26631_10112661All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium919Open in IMG/M
3300004070|Ga0055488_10100685All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium704Open in IMG/M
3300004778|Ga0062383_10561123All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium576Open in IMG/M
3300005169|Ga0066810_10145070All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium563Open in IMG/M
3300005295|Ga0065707_10135367All Organisms → cellular organisms → Bacteria → Proteobacteria1850Open in IMG/M
3300005336|Ga0070680_100697439All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium873Open in IMG/M
3300005457|Ga0070662_101599303All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300005618|Ga0068864_102299903All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium545Open in IMG/M
3300005981|Ga0081538_10285668All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium611Open in IMG/M
3300006169|Ga0082029_1776695All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1262Open in IMG/M
3300006846|Ga0075430_100845348All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium754Open in IMG/M
3300006853|Ga0075420_101178785All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium658Open in IMG/M
3300006854|Ga0075425_100297549All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1857Open in IMG/M
3300006904|Ga0075424_100550797All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300009012|Ga0066710_102952086All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium GWB2_52_12665Open in IMG/M
3300009078|Ga0105106_10297893All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1168Open in IMG/M
3300009087|Ga0105107_10602267All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria765Open in IMG/M
3300009091|Ga0102851_13214792All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium525Open in IMG/M
3300009100|Ga0075418_12788232All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300009153|Ga0105094_10625453All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium629Open in IMG/M
3300009157|Ga0105092_10201006All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1113Open in IMG/M
3300009167|Ga0113563_13930382All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium503Open in IMG/M
3300010373|Ga0134128_12587514All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium559Open in IMG/M
3300010396|Ga0134126_12748648All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300010399|Ga0134127_11140840All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium844Open in IMG/M
3300010400|Ga0134122_11833751All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium639Open in IMG/M
3300010401|Ga0134121_11527194All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium684Open in IMG/M
3300010403|Ga0134123_13080852All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium535Open in IMG/M
3300011445|Ga0137427_10334859All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium637Open in IMG/M
3300012040|Ga0137461_1221328All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium554Open in IMG/M
3300012041|Ga0137430_1090421All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium859Open in IMG/M
3300012205|Ga0137362_11054488All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium691Open in IMG/M
3300012210|Ga0137378_11660480All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium546Open in IMG/M
3300012226|Ga0137447_1133920All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300012498|Ga0157345_1006696All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium924Open in IMG/M
3300012509|Ga0157334_1010954All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium856Open in IMG/M
3300012918|Ga0137396_10876776All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium659Open in IMG/M
3300012925|Ga0137419_11003479All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium692Open in IMG/M
3300012960|Ga0164301_11220412All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium605Open in IMG/M
3300012976|Ga0134076_10504336All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium553Open in IMG/M
3300012986|Ga0164304_11519323All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium555Open in IMG/M
3300013308|Ga0157375_11692587All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium749Open in IMG/M
3300014269|Ga0075302_1179817All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300014873|Ga0180066_1004069All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2219Open in IMG/M
3300015254|Ga0180089_1017637All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1288Open in IMG/M
3300015264|Ga0137403_11293013All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium575Open in IMG/M
3300015373|Ga0132257_103502627All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium571Open in IMG/M
3300018076|Ga0184609_10093547All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1343Open in IMG/M
3300018077|Ga0184633_10073434All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1756Open in IMG/M
3300018081|Ga0184625_10471678All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium639Open in IMG/M
3300018082|Ga0184639_10035622All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2549Open in IMG/M
3300018422|Ga0190265_10369182All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1526Open in IMG/M
3300018422|Ga0190265_13042462All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium560Open in IMG/M
3300018476|Ga0190274_11599278All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium744Open in IMG/M
3300020064|Ga0180107_1122711All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300020197|Ga0194128_10162966All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1251Open in IMG/M
3300021078|Ga0210381_10091276All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium977Open in IMG/M
3300021090|Ga0210377_10523038All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium681Open in IMG/M
3300021344|Ga0193719_10321966All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium646Open in IMG/M
3300025146|Ga0209322_10401596All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium528Open in IMG/M
3300025160|Ga0209109_10016832All Organisms → cellular organisms → Bacteria3933Open in IMG/M
3300025165|Ga0209108_10033263All Organisms → cellular organisms → Bacteria2899Open in IMG/M
3300025167|Ga0209642_10212720All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1112Open in IMG/M
3300025313|Ga0209431_10542053All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium880Open in IMG/M
3300025313|Ga0209431_10745514All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium718Open in IMG/M
3300025324|Ga0209640_10770784All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium760Open in IMG/M
3300025325|Ga0209341_10115640All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2262Open in IMG/M
3300025326|Ga0209342_10890279All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium690Open in IMG/M
3300025907|Ga0207645_10789310All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium646Open in IMG/M
3300025917|Ga0207660_10624152All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium878Open in IMG/M
3300025933|Ga0207706_10665858All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium891Open in IMG/M
3300025937|Ga0207669_10519128All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium956Open in IMG/M
3300025953|Ga0210068_1072641All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium540Open in IMG/M
3300025985|Ga0210117_1074365All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium592Open in IMG/M
3300026051|Ga0208911_1017791All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium679Open in IMG/M
3300026285|Ga0209438_1063304All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1216Open in IMG/M
3300026485|Ga0256805_1030750All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium655Open in IMG/M
3300027513|Ga0208685_1121526All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium560Open in IMG/M
3300027722|Ga0209819_10184538All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium728Open in IMG/M
3300027819|Ga0209514_10329234All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium686Open in IMG/M
3300027840|Ga0209683_10265180All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium790Open in IMG/M
3300027843|Ga0209798_10412737All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium629Open in IMG/M
3300027875|Ga0209283_10214525All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1278Open in IMG/M
3300027876|Ga0209974_10222200All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium703Open in IMG/M
3300027909|Ga0209382_12116968All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium535Open in IMG/M
3300027979|Ga0209705_10423446All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium660Open in IMG/M
3300030619|Ga0268386_10431134All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium919Open in IMG/M
3300031198|Ga0307500_10107807All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium755Open in IMG/M
3300031547|Ga0310887_10635744All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium657Open in IMG/M
3300031547|Ga0310887_10728401All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium618Open in IMG/M
3300031716|Ga0310813_10194477All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1659Open in IMG/M
3300031720|Ga0307469_11615078All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium623Open in IMG/M
3300031949|Ga0214473_10075552All Organisms → cellular organisms → Bacteria3942Open in IMG/M
3300032005|Ga0307411_12296400All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium507Open in IMG/M
3300032012|Ga0310902_10258430All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1053Open in IMG/M
3300032075|Ga0310890_10744821All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium771Open in IMG/M
3300032157|Ga0315912_10746958All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium779Open in IMG/M
3300032174|Ga0307470_10775561All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium740Open in IMG/M
3300032783|Ga0335079_10787553All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium986Open in IMG/M
3300034147|Ga0364925_0271972All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium632Open in IMG/M
3300034150|Ga0364933_115692All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium684Open in IMG/M
3300034417|Ga0364941_148868All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium588Open in IMG/M
3300034894|Ga0373916_0079724All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.28%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil7.48%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil6.54%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment5.61%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.61%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.61%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.61%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.74%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.80%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment2.80%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.80%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.80%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.87%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.87%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.87%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.87%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.87%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.93%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.93%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.93%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.93%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300002122Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2EnvironmentalOpen in IMG/M
3300002124Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3EnvironmentalOpen in IMG/M
3300004070Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012040Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2EnvironmentalOpen in IMG/M
3300012041Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2EnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012226Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2EnvironmentalOpen in IMG/M
3300012498Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410Host-AssociatedOpen in IMG/M
3300012509Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014269Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1EnvironmentalOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300015254Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10DEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300020064Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT27_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020197Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65mEnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300025146Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025953Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025985Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026051Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026485Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 F6EnvironmentalOpen in IMG/M
3300027513Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)EnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027819Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M
3300034417Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17EnvironmentalOpen in IMG/M
3300034894Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.2EngineeredOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICCgaii200_057504422228664021SoilRGILYAARLIYTWDNLAVDSNDRAVAYLHQVQPEGVDLKPIDMALACRNEKCSVEDVFALGTDFNRQYQSAVSYISGRP
JGI11643J11755_1162924713300000787SoilVPLLRGVKAIFRRPSKGEIHEEQLQSIERSWKSRLPELSQLMRLEAKDRKPYIRGILYAARLIYTWDNLAVDSNDRAVAYLHQVQPEGVDLKPIDMALACRNEKCSVEDVFALGTDFNRQYQSAVSYISGRP*
JGI11643J12802_1066087913300000890SoilLRGVKAIFRRPSKGEIHEEQLQSIERSWKSRLPELSQLMRLEAKDRKPYIRGILYAARLIYTWDNLAVDSNDRAVAYLHQVQPEGVDLKPIDMALACRNEKCSVEDVFALGTDFNRQYQSAVSYISGRP*
C687J26623_1021067713300002122SoilLYAARLIYTWDNLAVDSNDRAVEYLHQVQPPGLDLKPIDMALACRNKQCTAEDVFALRVDLSRQYESAISYISVNRS*
C687J26631_1011266113300002124SoilKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHQVQPPGLDLKPIDMALACRNKQCTAEDVFALRVDLSRQYESAISYISVNRS*
Ga0055488_1010068523300004070Natural And Restored WetlandsVIDRLDLLDHGVALLYGIKPSLRRPTKDEIHREQLQSIERSWKPRLPELSGLTSLEPKDRKPYIRAILYAARLIYTWDNLVVGSNDSAVEYLHQVRPAGLDLQPIDMALECRKGNCDAEDVLRLGADLNRQCESALRYVLARP*
Ga0062383_1056112323300004778Wetland SedimentWKPRLPELSGLTALTPENRKPYIRAILYAARLIFSWDNLAMESNDRAVAYLHQVQPPGLDLKPIDMALACRQENCTAEDVFVLGTDLCRQCDSAVSYISNHA*
Ga0066810_1014507013300005169SoilLIYTWDNLVVGSNDSAVEYLHQVRSEGLDLKAIDMALMCRRGECSAEDVMRLGSDLNRHCDSAMSYVLGRP*
Ga0065707_1013536733300005295Switchgrass RhizospherePAFRRPNKDEIHQEQLQSIERSWKSRLPELGRLTNLEPRNRKPYIRAILYAARLIYTWDTLAVGSNDRAVEYLHQVQPPGLDLKPIDMALACRNEKCTAEDVFALHTNLIGQCESAVRYISANR*
Ga0070680_10069743913300005336Corn RhizosphereLTTLEPKDRKPYIRAILYAARLIYTWDKLAVDSNDCAVEYLHQVQPSRLDLKPIDMALACRNEKYTAEDVFALRTDLIRQCQSAVRYVSVHGN*
Ga0070662_10159930313300005457Corn RhizosphereHQALRESIEKSWQPRIPELQALTRLEAKDRKPYVRAILYAARLIFTWDKLAVDSNDRAVEYLHQVQPPGLDLEPIDRALACRRERCSVEDVFALRTDLNRQVQSALSYISKRT*
Ga0068864_10229990313300005618Switchgrass RhizosphereKSWKPRLPELNRLTTLEPKDRKPYIRAILYAARLIYTWDKLAVDSNDCAVEYLHQVQPSRLDLKPIDMALACRNEKYTAEDVFALRTDLIRQCQSAVRYVSVHGN*
Ga0081538_1028566823300005981Tabebuia Heterophylla RhizospherePLLRGVKPGFRRPTKEEIHQEQLQSIERSWKSRLPELTRLTALKAKDCKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHQVQPPGLDLGPIDMALACRKGICTAEDVFAVRTDLDAQCQSALSYIAARS*
Ga0082029_177669533300006169Termite NestRPTQVEVHRALRESIEKSWLPRVPELQALTRLEATDREPCVRAILYAARLIFTWDKLAVDSNDRAVEYLHRVQPPGLELEPIDGALACRREQCSVEDVFALRPDLNRQAQSALRYISKRS
Ga0075430_10084534813300006846Populus RhizosphereANFTRPAQVEVHQALRESIEKSWQSRIPELQALTRLDAKDRKPYVRAILYAARLIFTWDKLAVDSNDRAVEYLHQIQPPGLDLEPIDRALACRQDRCTAEDVFALGTDLKGQVHSAVSYISKRT*
Ga0075420_10117878523300006853Populus RhizosphereLQSIEKSWRSRLPELNRLTRLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHEVQPSGLALKPIDMALACRNGKCAAEDVFGLPIDLNRQCEAALNYISDDRP*
Ga0075425_10029754913300006854Populus RhizosphereSRLKTLEPKDRKPYIRAILYAARLIYTWDNLTVDSNDRAVEYLHQVQPSGLDLKPIDMALACRNGKCVAEDVFALRTDLIGECESAVGYISPGDKLV*
Ga0075424_10055079713300006904Populus RhizosphereRKSYIRAILYAARLIYTWDNLTVDSNDRAVEYLHQVQPSGLDLKPIDMALACRNGKCVAEDVFALRTDLIGECESAVGYISPGDKLV*
Ga0066710_10295208623300009012Grasslands SoilRSSKPELPELSRLKTLQPTDRQPYTRAILSAPRRIYTWDNLTVDSNDRAVEYLHQVQPPGLDLEPIDMALACRNGKCKAEEVFAHRADLERQCESATAYIRGLP
Ga0105106_1029789323300009078Freshwater SedimentYGIKPSLRRPTKDEIHREQLQSVERSWKPRLPELSGLTSLEPKDRKPYIRAILYAARLIYTWDNLVVGSNDSAVEYLHQVRPDGLDLQPIEMALACRKGNCEAEDVLRLGADLNRQCESALRYVLGRP*
Ga0105107_1060226723300009087Freshwater SedimentARLIYTWDNLVVGSNDSAVEYLHQVRPDGLDLRPIDMALSCRRGECSAEDVMRVSAYLNRQCESALRYVLGRP*
Ga0102851_1321479213300009091Freshwater WetlandsLPVIDRLDLLDHGVALLYGIKPSLRRPTKDEIHREQLQSIERSWKPRLPELTGLSSLEPKDRKPYIRAILYAARLIYTWDNLVVGSNDRAVEYLHQVRPVGLDLKPIDMALACRSGNCDAEDALRLGADLNRQYESAMRYVLGHP*
Ga0075418_1278823213300009100Populus RhizosphereELSQLMRLEAKDRKPYIRGILYAARLIYTWDNLAVDSNDRAVEYLHQVQPEGVDLKPIDMALACRNEKCSVEDVFALGTDFNRQYQSAVSYISGRP*
Ga0105094_1062545323300009153Freshwater SedimentRKPYIRAILYAARLIYTWDNLTVDSNDRAVEYLHQVQPPGLDLKPIDRALACRNEECTAEEVFALHTDLNRQCESAIRYVSTGS*
Ga0105092_1020100613300009157Freshwater SedimentSKEEIHQEQLQSIERSWRSRLPELNSLTTLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHQVRPARLDLKPIDMALACRNDMCNAEDVFALRTDLNGQYDSSVSYISTRP*
Ga0113563_1393038213300009167Freshwater WetlandsRPSKDEIHREQLQSVERSWKPKLPELTRLKSLGPKDRKPYIRAILYAARLIYTWDNLVVGSNDRAVEYLHQVRPVGLDIKPIDMALACRSGNCDAEDALRLGADLNRQYESAMRYVLGHP
Ga0134128_1258751423300010373Terrestrial SoilIRAILYAARLIYTWDKLAVDSNDCAVEYLHQVQPSRLDLKPIDMALAYRNEKYTAEDVFALRTDLIRQCQSAVRYVSVHGN*
Ga0134126_1274864813300010396Terrestrial SoilPVIDRLDLLDHGVALLDGIRPAFRRPSADEIHLEQLQSIEKSWKPRLPELSSLTALEPKDRKPYIRAVLYAARLIYTWDKLAVASNDRAVEYLHEVRPAGLELAPIDRALACRKGECSAEEVFALRADLQRQCECALRYIRAR*
Ga0134127_1114084013300010399Terrestrial SoilKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHHIQPPGLDLEPIAMALACRNEKCTAEEVFALHTDFKRQCESAISYISVNRS*
Ga0134122_1183375113300010400Terrestrial SoilESIERSWKSRLPELSRLKTLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHHIQPPGLDLEPIAMALACRNEKCTAEEVFALHTDFKRQCESAISYISVNRS*
Ga0134121_1152719413300010401Terrestrial SoilPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHHIQPPGLDLEPIAMALACRNEKCTAEEVFALHTDFKRQCESAISYISVNRS*
Ga0134123_1308085223300010403Terrestrial SoilRAILYAARLIYTWDNLEVGSNDRAVEYLHQVQPPGLDLKAIDLALACRNGRCTAEEVFALATDLHRQCEIAVRYISRRP*
Ga0137427_1033485923300011445SoilAVLYAARLIYTWDNLVVGSNDNAVEYLHKVRPIGLDLKPIDMALACRNGNCDAEAVLRLGSDLDRQCESAMRYILGHP*
Ga0137461_122132813300012040SoilGVSLLKGHKPEFLRPTKQEIRDELLRSIEKSWKPRLPELNALTELAPANRKPYIRAILYAARLIFSWDNLAMESNDRAVEYLHQVQPPDLDLKPIDMALACRQENCTADDVFALHTDLIRQCESAVSYISARP*
Ga0137430_109042123300012041SoilHGIKPPLRRPSREEIHQEQLQSIERSWRPRLPELNRLTSLEPKDRKPYIRAILYAARLIYTWDNLMVGSNDSAVEYLHRVRPDGLDLRPIDMALACRKGNCEPEDVLRLGADLNRQCESALRYILARP*
Ga0137362_1105448813300012205Vadose Zone SoilLDSIERSWKSRLPELSRLKTLEPKDRKPYIRAILYAARLIYTWDNLTVDSNDRAVEYLHQVQPSGLDLKPIDMALACRNGKCVAEDVFALRTDLIGECESAVGYISQGDKLV*
Ga0137378_1166048013300012210Vadose Zone SoilGVPLLRGIKPTFRRPSKDEIHHEQRENIERSWKSRLPEFSSLTRLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHQVQPSGLDLKPIDMALACRNGKCVAEDVFALRTDLIGECESAVGYISQGDKLV*
Ga0137447_113392013300012226SoilQHKPYIRAILYAARLIYTWDNLLVASNDCAVEYLRRVRPARLDLNAIEMALACRNEQRSVDEVFALRCDLGRLSDSALSYIARNRSE*
Ga0157345_100669623300012498Arabidopsis RhizosphereLPELSRLKTLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHHIQPPGLDLEPIAMALACRNEKCTAEEVFALQTDFKRQCESAISYISVNRS*
Ga0157334_101095423300012509SoilSWKSRLPELSRLKTLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHHIQPPGLDLEPIAMALACRNEKCTAEEVFALHTDFKRQCESAISYISVNRS*
Ga0137396_1087677613300012918Vadose Zone SoilNEIHQEQLDSIERSWKSRLPELSRLKTLEPKDRKPYIRAILYAARLIYTWDNLTVDSNDRAVEYLHQVQPSGLDLKPIDMALACRNGKCVAEDVFALRTDLIGECESAVGYILQGDKLV*
Ga0137419_1100347913300012925Vadose Zone SoilHGVPLLHAFKPTFRRPTKNEIHQEQLDSIERSWKSRLPELSRLKTLEPKDRKPYIRAILYAARLIYTWDNLTVDSNDRAVEYLHQVQPPGLDLEPIDMALACRNGKCVAEDVFALRTDLIGECESAVGYISQGDKLV*
Ga0164301_1122041223300012960SoilLESIERSWKSRLPELSRLHTLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHHIQPPGLDLEPIAMALACRNEKCTAEEVFALHTDFKRQCESAIGYISVNRS*
Ga0134076_1050433613300012976Grasslands SoilAARLIYTWDNLAVDSNDRAVEYLHQVQPHGLDLKPIDMALACRNEKCTAEDVFALHTDLNRQCESAVSYISARP*
Ga0164304_1151932313300012986SoilPELSRLKTLESKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHHIQPPGLDLEPIGMALACLNEKCTAEEVFALHTDFKRQCESAISYISVNRS*
Ga0157375_1169258713300013308Miscanthus RhizosphereKHEIHQEQLESIERSWKSRLPELSRLKTLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHHIQPPGLDLEPIAMALACRNEKCTAEEVFALHTDFKRQCESAISDISVNHS*
Ga0075302_117981713300014269Natural And Restored WetlandsVIDRLDLLDHGVSLLHGIKADLRRPSKNEIRQALRESIAKSWQPKLPELSSLKSLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVDYLHQVQPPGLDLKPIDMALACRQEKSTAEEVFSLHTDLTRQCESAVSYISAGR*
Ga0180066_100406953300014873SoilERSWKSRLPELSRLTTLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAIEYLHQVQPPGLDLKPIDMALACRNEKCTAEDVFALQVDLKRQCESAVSYISVNRS*
Ga0180089_101763723300015254SoilFRRPTKDEIHQEQLQSIERSWKSRLPELRRLTTLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAIEYLHQVQPPGLDLKPIDMALACRNEKCTAEDVFALQVDLNRQCESAIRYISVNRS*
Ga0137403_1129301323300015264Vadose Zone SoilWKARLPELSGLTNLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHQVQPHGLDLKPIDMALACRNEKCTAEDVFALHTDLNRQCESAVSYISARP*
Ga0132257_10350262713300015373Arabidopsis RhizosphereNLRRPSKDEIHQEQLQSIERSWKPRLPELSRLKNLEAKDRKPYIRAILYAARLIYTWDNLLVGSNDAAVQYLHQVRPDGLDLKPIDLALACRQGNCSAEEVLSLATDLNRQCESAMFYVMGRR*
Ga0184609_1009354723300018076Groundwater SedimentKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHQVQPPGLDLKPIDMALVCRNEKCTAEEVFALRTDFNRQCESAISYISTRP
Ga0184633_1007343423300018077Groundwater SedimentMPVTKTDAAHLIYTWGNLAVDFNDRAVEYLHQVQPPGLDLKPIDMALACRQEKFKAEDVFALRADFNCQCESAVSYISARP
Ga0184625_1047167823300018081Groundwater SedimentVPLLHGVKPSFRRPTKHEIHQEQLESIERSWKSRLPELSRLKTLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHHIQPPGLDLEPIAMALACRNEKCTAEEVFALHTDFKAQCESAIGYISVNRS
Ga0184639_1003562213300018082Groundwater SedimentQSIERSWKSRLPELSRLKTLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHQVQPPGLDLKPIEMALACRNEQCIAEDVFALRADLNRQSESALSYILVNRS
Ga0190265_1036918213300018422SoilDRLDMLDYGIPLLHGVKPTFRRPTKEEIHREQLQSIERSWKSRLPELGHLKRLEPKDRKPYIRAILYAARLIYTWDNLIVASNDRAVEYLHKVQPPGLDLRPIGMALACRNEKCTADEVFALRTNLNQQGESAIRYISTRS
Ga0190265_1304246213300018422SoilDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHKVEPSGLDLKPIDMALACRIGKCTAEDVFALRTDLNRQCESALSYISKAPTLTPR
Ga0190274_1159927823300018476SoilEIHREQLLSIEKSWKPRLPELNRLTTLEPKDRKPYIRAILYAARLIYTWDKLAVDSNDCAVEYLHQVQPSRLDLKPIDMALACRNEKYTAEDVFALRTDLIRQCQSAVRYVSVHRN
Ga0180107_112271123300020064Groundwater SedimentSKDRKPYIRAILYAARLIYTWDNLVVGSNDSAVEYLHRVRPDGLDLQPIDMALACRNGNAEAEDVLRLGADLNRQCESAMRYILGYP
Ga0194128_1016296613300020197Freshwater LakeNGHKPRFRRPTKQEIRDELLRSIEKSWKPRLPELNSLKELAPENRKPYIRAILYAARLIHSWDNLAMESNDRAVEYLHQVQPPGLDLKPIDMALACRHDGCTADDVFALRTDLVRQCESSVAYLGARDLT
Ga0210381_1009127623300021078Groundwater SedimentQLLSIEKSWKPRLPELNRLTTLEPKDRKPYIRAILYAARLIYTWDKLAVDSNDRAVEYLHQVQPSGLDLKPIDMALACRNEKYTAEDVFALRTDLIRQCQSAVRYVSVHGN
Ga0210377_1052303813300021090Groundwater SedimentEIHEEQLQSIERSWKPRLPELSRLTALEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHQVQPSGLDLKPIDMALDCRNEKCTAEEVFALQSDLDRQCESAVSYVSTRR
Ga0193719_1032196623300021344SoilIERSWKSRLPELSRLKTLEPKDRKPYIRAILYAARLIYTWDNLTVDSNDRAVEYLHQVQPSGLDLKPIDMALACRNGKCVAEDVFALRTDLIGECESAVGYISQGDKPV
Ga0209322_1040159613300025146SoilGVKPSFRRPTKDEIHREQQQSIERSWKSRLPELSRLTTLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHQVQPPGLDLKPIDMALACRNEKCTAEDVFALRADLSRHCERAISYISVNGR
Ga0209109_1001683273300025160SoilLYAARLIYTWDNLAVDSNDRAVEYLHQVQPPGLDLKPIDMALACRNEKCSAEDVFALHTDLKRQCESAISYISANPAEWRV
Ga0209108_1003326373300025165SoilTTLEPKDRKPYIRAILYAARLIYTWDNLTVNSNDRAVEYLHQVQPPGLDLKPIDMALACRNEICTAEDVFALQVDLNRQCESAVRYISVNRS
Ga0209642_1021272013300025167SoilILYAARLIYTWDNLAVDSNDRAVEYLHQVQPPGLDLKPIDMALACRNEKCTAEDVFALRADLSRHCERAINYISVNGR
Ga0209431_1054205333300025313SoilPELSRLTTLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHQVQPPGLDLKPIDMALACRNKQCTAEDVFALRVDLSRQYESAISYISVNRS
Ga0209431_1074551413300025313SoilRLPELSRLTTLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDLAVEYLHQVQPPGLDLKPIDMALACRKEKCSAEDVFALHTDLSGQCESAISYVSVNRR
Ga0209640_1077078413300025324SoilTKDEIHQEQIQSIERSWKSRLPELSRLPKLEPKDRKPYIRAILYAARLIYTWDNLSVDSNDRAVEYLHQVQPPGLELKPVDLALACRNEICTAEDVFALHTDLNRQCESTLSYISVNRI
Ga0209341_1011564053300025325SoilSRLPELSRLTTLEPKHRKPYIRAILYAARLIYTWDKLAVDSNDRAVEYLHQVQPPGLDLKLIDMALACRNEKCTAEDVFALQVDLNRQCESAVRYLSVNRG
Ga0209342_1089027913300025326SoilQSIERSWKSRLPELSRLTTLEPKHRKPYIRAILYAARLIYTWDKLAVDSNDRAVEYLHQVQPPGLDLKLIDMALACRNEKCTAEDVFALQVDLNRQCESAVRYLSVNRG
Ga0207645_1078931023300025907Miscanthus RhizosphereLEAKDRKPYVRAILYAARLIFTWDKLAVDSNDCAVEYLHQVQPPGLDLEPIDRALACRRERCSVEDVFALRTDLNRQVQSALSYISKRT
Ga0207660_1062415223300025917Corn RhizosphereELNRLTTLEPKDRKPYIRAILYAARLIYTWDKLAVDSNDCAVEYLHQVQPSRLDLKPIDMALACRNEKYTAEDVFALRTDLIRQCQSAVRYVSVHGN
Ga0207706_1066585813300025933Corn RhizosphereVRAILYAARLIFTWDKLAVDSNDRAVEYLHQVQPPGLDLEPIDRALACRRERCSVEDVFALRTDLNRQVQSALSYISKRT
Ga0207669_1051912813300025937Miscanthus RhizosphereTRLEAKDRKPYVRAILYAARLIFTWDKLAVDSNDCAVEYLHQVQPPGLDLEPIDRALACRRERCSVEDVFALRTDLNRQVQSALSYISKRT
Ga0210068_107264123300025953Natural And Restored WetlandsLQSIERSWKPRLPELSGLTSLEPKDRKPYIRAILYAARLIYTWDNLVVGSNDSAVEYLHQVRPAGLDLQPIDMALECRKGNCDAEDVLRLGADLNRQCESALRYVLARP
Ga0210117_107436513300025985Natural And Restored WetlandsGVALLAGQKPKFRRPNRDEIRSELLRSIERSWKPRLPELNGLTVLTPENRKPYIRAILYAARLIFSWDNLAMESNDRAVSYLHQVRPAGLDLKPIDMALACRQGNCPADDVFALRTDLCRQCESALSYISNHA
Ga0208911_101779113300026051Natural And Restored WetlandsKPYIRAILYAARLIYTWDNLKVNSNDRAVAYLHDVRPDGLDLKPIDMALDCRDGKCTAEQVFALGTDLNRQCEAALIYLGSAALK
Ga0209438_106330413300026285Grasslands SoilRLPELSRLTTLEPKDRKPYIRAILYAARLIYTWDNLVVDSNDRAVEYLHQVQPPGLDLKPIDMALACRNGICTAEDVFSLRADLDRQCESAISYISVNRG
Ga0256805_103075013300026485SedimentVPVIDRLDLLDHGVALLHGIKPSLGRPSKVEIHQEQLQSIERSWKPRLPELNRLTNLEPKDRKPYIRAILYAARLIYTWDNLVVGSNDSAVEYLHQVRPEGLDLEPIDMALACRQEKCTADDVFNLHTDLNRQCEWAVKYISNNR
Ga0208685_112152623300027513SoilLLHGIKPSLRRPSKDEIHQEQLQSIERSWNSRLPELSRLTSLEPKDRKPYIRAILYAARLIYTWDNLVVGSNDSAVEYLHRVRPDGLHLQPIDMALACRSGNAEAEDVLRLGADLNRQCESAMRYILGHP
Ga0209819_1018453823300027722Freshwater SedimentSKEEIHQEQLQSIERSWRSRLPELNSLTTLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHQVRPARLDLKPIDMALACRNDMCNAEDVFALRTDLNGQYDSSVSYISTRP
Ga0209514_1032923423300027819GroundwaterKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHQVQPPGFDLKPIDMALACRNDKCTAEDVFALQVDLNRQCESAVSYISVNRS
Ga0209683_1026518013300027840Wetland SedimentVIDRVDLLDHGVALLHGIKPSLRRPTKEEIHQEQLQSIERSWKPRLPELSGLTNLDLKDRKPYIRAILYAARLIYTWDNLTVGSNDSAVAYLHSAKPAGLDLVPIDRALLCRKGGCSADEVFRLGTDLMRQCDSALRYIAAQR
Ga0209798_1041273713300027843Wetland SedimentIRNELLRSIDRSWKPRLPELSGLTALTPENRKPYIRAILYAARLIFSWDNLAMESNDRAVAYLHQVQPPGLDLKPIDMALACRQENCTAEDVFVLGTDLCRQCDSAVSYISNHA
Ga0209283_1021452523300027875Vadose Zone SoilPYIRAILYAARLIYTWDSLAVDSNDRAVDYLHQVQPPGLDLKPIDMALACRQEKCTAEEVFALRTDLNRQRESAVSYISARH
Ga0209974_1022220013300027876Arabidopsis Thaliana RhizosphereQPRIPELQALTRLEAKDRKPYVRAILYAARLIFTWDKLVVDSNDRAVEYLHQVQPPGLELAPIDRALACRRDQCSVEEVFALRADLNRQVQSALSYISKRT
Ga0209382_1211696823300027909Populus RhizosphereRGVKPIFRRPSKGEIHEEQLQSIERSWKSRLPELSQLMRLEAKDRKPYIRGILYAARLIYTWDNLAVDSNDRAVEYLHQVQPEGVDLKPIDMALACRNEKCSVEDVFALGTDFNRQYQSAVSYISGRPM
Ga0209705_1042344623300027979Freshwater SedimentIRAILYAARLIYTWDNLVVGSNDSAVEYLHQVRPDGLDLQPIEMALACRKGNCEAEDVLRLGADLNRQCESALRYVLGRP
Ga0268386_1043113413300030619SoilIHRALEESIENSWKPRIAELQGLTRLEASQRKPYVRAILYAARLIYTWDKLVVNSNDEAVHYLHQVRPRGLDLRAIDAALACRRGQCTAEDVLHLRTDLERQLQAAAAYIAEQR
Ga0307500_1010780723300031198SoilPDLSRLKTLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHHIQPPGLDLEPIAMALACRNEKCTAEEVFALHTDFKRQCESAIGYISVNRS
Ga0310887_1063574423300031547SoilLDLLDHGVALLHGIKPPLRRPSKQEIHHEQLQSIERSWKPRLPELNRLTSLEPKDRKPYIRAILYAARLIYTWDNLVVGSNDSAVEYLHQVRPEGLDLKAIDMALMCRKGECSAEDVMRLGSDLNRHCDSAMSYVLGRP
Ga0310887_1072840113300031547SoilGDHIADFPRPTRVEVHQALRESIEKSWQPRIPELQALTRLEAKDRKPYVRAILYAARLIFTWDKLAVDSNDRAVEYLHQVQPPGLDLEPIDRALACRRERCSVEDVFALRTDLNRQVQSALSYISKRS
Ga0310813_1019447743300031716SoilRKPYIRAILYAARLIYTWDKLAVASNDRAVEYLHEVQPAELDLAPIDRALACRKGECFAEDVFALRADLMGQCEGALRYIHAR
Ga0307469_1161507823300031720Hardwood Forest SoilLSRLKTLEPKDRKSYIRAILYAARLIYTWDNLTVDSNDRAVEYLHQVQPSGLDLKPIDMALACRNGKCVAEDVFALRTDLIGECESAVGYLSQGDKLV
Ga0214473_1007555243300031949SoilVPLLKGVKPSFRRPTKDEIHQEQIQSIERSWKSRLPELSRLTTLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHQVQPPGLDLKPIDMALACRNEKCTAEDVFALRVDLSRQYESAISYISVNRS
Ga0307411_1229640023300032005RhizosphereEAKDRKHYVRAILYAARLIFTWDKLAVDSNDRAVEYLHQVQPPGLDLKPIDMALACRQDQCTAEEVFTLRTDLNRQVQSALSYISKRT
Ga0310902_1025843023300032012SoilPYIRAILYAARLVYSWDNLAMDSNDRAVEYLHQIEPAGLDLKPIDMALACRQAKCSAEDVFNLQTDLNRQCESAVKYISKRV
Ga0310890_1074482113300032075SoilILYAARLVYSWDNLAMDSNDRAVEYLHQIEPAGLDLKPIDMALACRQAKCSAEDVFNLQTDLNRQCESAVKYISKRV
Ga0315912_1074695813300032157SoilPELNRLTSLEPKDRKPYIRAILYAARLIYTWDNLMVGSNDSAVEYLHRVRPDGLDLRPIDMALACRKGNCEPEDVLRLGADLNRQCESALRYILARP
Ga0307470_1077556113300032174Hardwood Forest SoilELSRLKTLEPKDRKPYIRAILYAARLIYTWDNLAVDSNDRAVEYLHHIQPPGLDLEPIAMALACRNEKCTAEEVFALHTDFKRQCESAISYISVNRS
Ga0335079_1078755323300032783SoilPGLNALTELTPENRKPYIRAILYAARLIFSWDNLAMDSNDRAVEYLHQVQPPGLDLKPIDVALACRQEKCTADDVFALHTDLFRQCDSAVSYILSKH
Ga0364925_0271972_2_3613300034147SedimentPTKQEIHREQLQSIERSWKPRLPELSPLTSLEPKDRKPYIRAVLYAARLIYTWDNLVVGSNDNAVEYLHQVRPIGLDLKPIDMALACRNGNCDAEAVLRLGSDLDRQCESAMRYILGHP
Ga0364933_115692_340_6843300034150SedimentQEQLLSIEKSWKPRLPELSRLTTLEPKDRKPYIRAILYAARLIYTWDNIAVDSNDRAVDYLHQVQPSGLDLKPIDMALACRNEKCTAEDVFALGTDLIRQCQSAIRYLSVTETE
Ga0364941_148868_3_2903300034417SedimentRLTTLEPKDRKPYIRAILYAARLIYTWDNIAVDSNDRAVDYLHQVQPSGLDLKPIDMALACRNEKCTAEDVFALGTDLIRQCQSAIRYLSVTETE
Ga0373916_0079724_83_5143300034894Sediment SlurryVIDRLDMLDHGVSLLHGIRPTFRRPTKDEIHEEQLQSLEQSWQSRLPELSRLTSLESKDSKPYIRAILYAARLIYTWDNLTVASNDRAVEYLHQVQPPGLDLKPIDMALACRNDKCTAEDVFALRPDLNRQCESAVSYISTRP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.