Basic Information | |
---|---|
Family ID | F092652 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 107 |
Average Sequence Length | 42 residues |
Representative Sequence | MNGTASKKRELSKRGKKPSTYRRIVTGNVNGKAVVQSDE |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 98.13 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 94.39 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.17 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.589 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (32.710 % of family members) |
Environment Ontology (ENVO) | Unclassified (35.514 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.140 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 14.93% Coil/Unstructured: 85.07% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF13561 | adh_short_C2 | 18.69 |
PF05368 | NmrA | 5.61 |
PF08240 | ADH_N | 3.74 |
PF00106 | adh_short | 2.80 |
PF00107 | ADH_zinc_N | 2.80 |
PF01370 | Epimerase | 1.87 |
PF02082 | Rrf2 | 0.93 |
PF13602 | ADH_zinc_N_2 | 0.93 |
PF13365 | Trypsin_2 | 0.93 |
PF03466 | LysR_substrate | 0.93 |
PF12680 | SnoaL_2 | 0.93 |
PF02321 | OEP | 0.93 |
PF00724 | Oxidored_FMN | 0.93 |
PF04248 | NTP_transf_9 | 0.93 |
PF12697 | Abhydrolase_6 | 0.93 |
PF13460 | NAD_binding_10 | 0.93 |
PF13581 | HATPase_c_2 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
---|---|---|---|
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.87 |
COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.93 |
COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.93 |
COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.93 |
COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.93 |
COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.93 |
COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.93 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.93 |
COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.93 |
COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 0.93 |
COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.93 |
COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.59 % |
Unclassified | root | N/A | 8.41 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2035918004|FACENC_F56XM5W01EQIKQ | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
2065487018|GPINP_F5MS3JC02IR200 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101501254 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300002917|JGI25616J43925_10043639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 1958 | Open in IMG/M |
3300005445|Ga0070708_100328208 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
3300005542|Ga0070732_10945569 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300005557|Ga0066704_10184184 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
3300005591|Ga0070761_11043046 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300005712|Ga0070764_10290827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 940 | Open in IMG/M |
3300006052|Ga0075029_100973643 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 584 | Open in IMG/M |
3300006172|Ga0075018_10406244 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 693 | Open in IMG/M |
3300006176|Ga0070765_101050880 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300009038|Ga0099829_10500660 | Not Available | 1009 | Open in IMG/M |
3300009088|Ga0099830_11746363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300009089|Ga0099828_11393469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
3300009090|Ga0099827_11680165 | Not Available | 553 | Open in IMG/M |
3300010159|Ga0099796_10266266 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
3300010336|Ga0134071_10125055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1238 | Open in IMG/M |
3300011270|Ga0137391_10769422 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
3300012169|Ga0153990_1008445 | All Organisms → cellular organisms → Bacteria | 2145 | Open in IMG/M |
3300012203|Ga0137399_11485442 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300012205|Ga0137362_11185106 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300012205|Ga0137362_11593420 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300012361|Ga0137360_11670422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. AZCC_0083 | 542 | Open in IMG/M |
3300012363|Ga0137390_10819298 | Not Available | 888 | Open in IMG/M |
3300012683|Ga0137398_10785452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 665 | Open in IMG/M |
3300012917|Ga0137395_10309060 | Not Available | 1121 | Open in IMG/M |
3300012917|Ga0137395_10536627 | Not Available | 844 | Open in IMG/M |
3300012918|Ga0137396_11263734 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300012929|Ga0137404_10461582 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
3300012930|Ga0137407_11304588 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300012944|Ga0137410_11302685 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300012944|Ga0137410_11938795 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300014495|Ga0182015_10556506 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300015264|Ga0137403_10266543 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1618 | Open in IMG/M |
3300017933|Ga0187801_10027864 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
3300018433|Ga0066667_10118790 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
3300020199|Ga0179592_10009163 | All Organisms → cellular organisms → Bacteria | 4259 | Open in IMG/M |
3300020579|Ga0210407_11017285 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300020579|Ga0210407_11322451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 537 | Open in IMG/M |
3300020581|Ga0210399_10397424 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300020581|Ga0210399_11499157 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300020582|Ga0210395_10447974 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300020582|Ga0210395_10898702 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 658 | Open in IMG/M |
3300020582|Ga0210395_11304794 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300020582|Ga0210395_11352882 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300020583|Ga0210401_11611911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 506 | Open in IMG/M |
3300021168|Ga0210406_11353560 | Not Available | 510 | Open in IMG/M |
3300021170|Ga0210400_11306002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 581 | Open in IMG/M |
3300021170|Ga0210400_11502761 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300021171|Ga0210405_10193544 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
3300021178|Ga0210408_10542172 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300021401|Ga0210393_10590432 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300021403|Ga0210397_10787625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
3300021403|Ga0210397_11333817 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300021405|Ga0210387_10761622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 856 | Open in IMG/M |
3300021406|Ga0210386_11298610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 613 | Open in IMG/M |
3300021407|Ga0210383_10564513 | Not Available | 982 | Open in IMG/M |
3300021407|Ga0210383_10837107 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
3300021420|Ga0210394_10064289 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3185 | Open in IMG/M |
3300021420|Ga0210394_10970436 | Not Available | 737 | Open in IMG/M |
3300021432|Ga0210384_10689384 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
3300021433|Ga0210391_10829223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
3300021433|Ga0210391_11010742 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300021474|Ga0210390_10372020 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
3300021477|Ga0210398_10419302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 1091 | Open in IMG/M |
3300021477|Ga0210398_10831672 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300021479|Ga0210410_10847084 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300022717|Ga0242661_1075638 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300025910|Ga0207684_11422212 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300025916|Ga0207663_11408446 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300025929|Ga0207664_11855343 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300025986|Ga0207658_10930123 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300026035|Ga0207703_11191289 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300026088|Ga0207641_10486942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1196 | Open in IMG/M |
3300026088|Ga0207641_11527330 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300026481|Ga0257155_1076107 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300026496|Ga0257157_1091899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 528 | Open in IMG/M |
3300026499|Ga0257181_1002269 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
3300026557|Ga0179587_11064862 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300027105|Ga0207944_1006469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 1044 | Open in IMG/M |
3300027181|Ga0208997_1001273 | All Organisms → cellular organisms → Bacteria | 2669 | Open in IMG/M |
3300027388|Ga0208995_1065232 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300027521|Ga0209524_1057730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 816 | Open in IMG/M |
3300027562|Ga0209735_1007739 | All Organisms → cellular organisms → Bacteria | 2029 | Open in IMG/M |
3300027575|Ga0209525_1060527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 917 | Open in IMG/M |
3300027591|Ga0209733_1162796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
3300027629|Ga0209422_1130890 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300027655|Ga0209388_1017618 | All Organisms → cellular organisms → Bacteria | 1978 | Open in IMG/M |
3300027660|Ga0209736_1020277 | All Organisms → cellular organisms → Bacteria | 2041 | Open in IMG/M |
3300027671|Ga0209588_1240802 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300027698|Ga0209446_1092677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 774 | Open in IMG/M |
3300027701|Ga0209447_10154398 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300027862|Ga0209701_10200449 | Not Available | 1190 | Open in IMG/M |
3300027903|Ga0209488_10144851 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
3300028906|Ga0308309_11322024 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300028906|Ga0308309_11676120 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300030730|Ga0307482_1240413 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300030862|Ga0265753_1101748 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300030991|Ga0073994_10019321 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300031122|Ga0170822_10685571 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300031128|Ga0170823_11257586 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300031715|Ga0307476_10806148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 694 | Open in IMG/M |
3300031718|Ga0307474_11408101 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300031823|Ga0307478_10545216 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300031823|Ga0307478_11153162 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300031962|Ga0307479_10344464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1473 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 32.71% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.30% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.35% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.61% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.80% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.87% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.87% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.87% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.87% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.87% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027105 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF018 (SPAdes) | Environmental | Open in IMG/M |
3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FACENCA_2387610 | 2035918004 | Soil | MNRTAPKKSELAKRHKKPVTYRRIVTGNVNGKSVV |
GPINP_03944950 | 2065487018 | Soil | MNGRAAKKKELSKRGGQPSAYRRVVTENVNGKAVVRSDEPL |
JGIcombinedJ26739_1015012541 | 3300002245 | Forest Soil | MNGRASRTGELSKRSEQPKTYRRIVTGNVNGKSVVQSDEPLLAY |
JGI25616J43925_100436391 | 3300002917 | Grasslands Soil | MNRTASTKTEFSKHSKRPSTYRRVVTANVDGKSILRSDEQLQAY |
Ga0070708_1003282081 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRTASKERRRGKKPTTYRRVVTGNANGKSVVQSDEPLLAYQ |
Ga0070732_109455691 | 3300005542 | Surface Soil | MNGTSSKKTELSERDKKPSTCRRIVTGNVNGKAVVQSDEPL |
Ga0066704_101841841 | 3300005557 | Soil | MNGAVSKKPELSKRGKKSSTYRRIVTGNVNGRSVVQSDEQMQAYQFKTV |
Ga0070761_110430461 | 3300005591 | Soil | MNGKASRKKESSKRDEKPSAYRRVVTANVNGKAVIQSDEPLPAYEF |
Ga0070764_102908271 | 3300005712 | Soil | MKGTASKKTELSKRGKQPSTYRRIVTGNVNGKAVVQSD |
Ga0075029_1009736431 | 3300006052 | Watersheds | MNGTASKKKELSKRGEKPSAYRRVVTGNVRGKSVVQSDEPLP |
Ga0075018_104062441 | 3300006172 | Watersheds | MNGTASKKKDLSKRGEKPSAYRRVVTGNVKGKSVVQSDEPLLA |
Ga0070765_1010508801 | 3300006176 | Soil | MNGAVAKRRELLKLGKKPSTYRRIVAGNVNGRPVVQSDELLPAYKF |
Ga0099829_105006601 | 3300009038 | Vadose Zone Soil | MNGTASKKRKLSKHSKRPSTYRRVVTANVDGKSILRSDEQLQAY |
Ga0099830_117463631 | 3300009088 | Vadose Zone Soil | MNGTASKKRKLSKHSKRPSTYRRVVTANVDGKSILRSDEQLQAYE |
Ga0099828_113934692 | 3300009089 | Vadose Zone Soil | MNGTASKKRKFSKHGKRPSTYRRVVTANVNGKSILRSDEQLQAYEFRSVP |
Ga0099827_116801652 | 3300009090 | Vadose Zone Soil | MNGRASWKKEFSKRREKASTYRRVVTENVNGKSVVQSDEPLLA |
Ga0099796_102662662 | 3300010159 | Vadose Zone Soil | MSRTASKKRELPKRGEKPSTYRRIVTGNVNGKAVVQSDEQLPAY |
Ga0134071_101250553 | 3300010336 | Grasslands Soil | MNGRASKKRELYSRGKKPSTYRRIVTGNVNGKSVVQTDEQMQAY |
Ga0137391_107694223 | 3300011270 | Vadose Zone Soil | MNGRASKKRELSSRGKKPSTFRRIVTGNVNGKSVVQTDEQMQAYQF |
Ga0153990_10084453 | 3300012169 | Attine Ant Fungus Gardens | MNGRASSKKELSKCGERPSTYRRVVAVNVNGKAVVQSDEPLPAYEFKTVP |
Ga0137399_114854421 | 3300012203 | Vadose Zone Soil | MNRTASKERELTKRGKKPTTYRRIVTGNVNGKSVVQSD |
Ga0137362_111851062 | 3300012205 | Vadose Zone Soil | MNGRATRKRELSKRGKKPSTYRRVVTENVNGKSVVQSDGPMEAYEFR |
Ga0137362_115934202 | 3300012205 | Vadose Zone Soil | MNGTASKKRELSKRGKKPSTYRRIVTGNVNAKSIVLSDGQMQT |
Ga0137360_116704221 | 3300012361 | Vadose Zone Soil | MNTTAPKKRELSKRGKKPSTYRRIVTGNVNGKSVVQSDEQLQAYEF |
Ga0137390_108192982 | 3300012363 | Vadose Zone Soil | MNGANSKKRKFGKKPHIYRRIVTGNANGKAVVQSD |
Ga0137398_107854521 | 3300012683 | Vadose Zone Soil | MNTTAPKKRELSKRGKKPSTYRRIVTGNVNGKSVVQ |
Ga0137395_103090602 | 3300012917 | Vadose Zone Soil | MNGTASKKRKLSKHSKRPSTYRRVVTANVDGKSILRSDEQLQAYQF |
Ga0137395_105366271 | 3300012917 | Vadose Zone Soil | MNGTASKKRELSKRGKKTSTYRRIVTGNVNGKAVVQSDEPLLAYEFKT |
Ga0137396_112637342 | 3300012918 | Vadose Zone Soil | MNRTASKERELPKRGKKPTTYRRIVTENVNGKSVVQSDEPLLAYQFKTVPG |
Ga0137404_104615822 | 3300012929 | Vadose Zone Soil | MNGTAPKKRELPKRGKKSSTYRRIVTGNVNDKSVVQRDE |
Ga0137407_113045882 | 3300012930 | Vadose Zone Soil | MNRTASKERELRKRGKKTSTYRRVVTGNVNGKSVVQSDEPLLAY |
Ga0137410_113026851 | 3300012944 | Vadose Zone Soil | MHRTASKERELPKRGKKPTTYRRIVTGNVNARSVVQSD |
Ga0137410_119387951 | 3300012944 | Vadose Zone Soil | MAMNGRAYRKGELSKGGKQPSTYRRVVTENVNGKSVVQSDGPMEAY |
Ga0182015_105565061 | 3300014495 | Palsa | MNKTASKKRESRKRGMKPTTYRRIVTGSLKGEAVFQSDKPL |
Ga0137403_102665431 | 3300015264 | Vadose Zone Soil | MNGTISKKTELSKRGKKSSTYRRVVTGNVNGKSVVQ |
Ga0187801_100278641 | 3300017933 | Freshwater Sediment | MNGPPSKKSELSKHGKKRGTYRRIVTGNVNGKAVVRSDERLLAYQFKT |
Ga0066667_101187903 | 3300018433 | Grasslands Soil | MHRTPSKKRELSKRGKKPSTYRRIVTGNVNGKAVVQSDE |
Ga0179592_100091631 | 3300020199 | Vadose Zone Soil | MNRTASTKTEFSKHRKRPSTYRRVVTANVDGKSILRSDEQLQAYEFKSVPSYEHT |
Ga0210407_110172852 | 3300020579 | Soil | MNRTASNERELPKRGKKPTTYRRIVTANANGKAVVQ |
Ga0210407_113224511 | 3300020579 | Soil | MNTTAPKKRELSKRGKKPSTYRRIVTGNVNGKSVVQSDE |
Ga0210399_103974241 | 3300020581 | Soil | MNRTAYKKRELPKGSKKASTYRRIVAGNANGKSIVQSDEP |
Ga0210399_114991571 | 3300020581 | Soil | MNGRASRKKEFSKRVEKSSTYRRVATENVNGKSVVQSDE |
Ga0210395_104479741 | 3300020582 | Soil | MNRTASKKSELPKRCKKPSTYRRIVTGNVNGKSVVQSDEPLPAYEFKTVPG |
Ga0210395_108987022 | 3300020582 | Soil | MNGTASKKKDLSKRGEKPSAYRRVVTGNVKGKSVVQSDEPLL |
Ga0210395_113047942 | 3300020582 | Soil | MNTTAFTKKGLSKRGKKPSAYRRIVTGNLNGKSVVQGDVP |
Ga0210395_113528822 | 3300020582 | Soil | MNGTASKKTRLSERGKKQSAFRRVVTGNVSGKSVVQSDEP |
Ga0210401_116119112 | 3300020583 | Soil | MNTTAPKKRELSKRAKKPSTYRRIVTGNVNGKSVVQ |
Ga0210406_113535601 | 3300021168 | Soil | MNGTASKKRALFKRDKKPRTYRRIVTGNVDGKSIVQTDERIQA |
Ga0210400_113060022 | 3300021170 | Soil | MNRTASRKKESSKRSKRPTTYRRVVTANVDGKSILRS |
Ga0210400_115027612 | 3300021170 | Soil | MNGTVSKKRELSKRGKKPSAYRRIVTGNVNGKAVFRSDESLSA |
Ga0210405_101935441 | 3300021171 | Soil | MNGTASKKTRLSERGKKPSTYRRIVTRNVNGKSVIQSDEQMQTYEFKTVP |
Ga0210408_105421721 | 3300021178 | Soil | MNGTASKKRELSKRDKKPSTYRRIVTRNVNGKSVIQSDEQMQTYEFKTVPGY |
Ga0210393_105904321 | 3300021401 | Soil | MNGTASRNRELSKRGEKPSTYRRIVTGNANGKSVVKSDE |
Ga0210397_107876251 | 3300021403 | Soil | TESTKRQLFKRGKKPSTYDRIVIGNVNGTAVVQSDEPLLA |
Ga0210397_113338172 | 3300021403 | Soil | MNGTASKKRELPERGKKPSSYRRIVTANANGKSSVQSDESMPAYE |
Ga0210387_107616221 | 3300021405 | Soil | VNTTAPKKRELSKRGKKSSTHRRIVTGNVNGKSVVQSDEQ |
Ga0210386_112986102 | 3300021406 | Soil | MKGTASKKTELSKRGKQPSTYRRIVTGNVNGKAVVQ |
Ga0210383_105645132 | 3300021407 | Soil | MNGAAARKTESSRSKKPCVYRRIVTENVSGKSVVQSDEHI |
Ga0210383_108371071 | 3300021407 | Soil | MNTTAFTKKGLSKRGKKPSAYRRIVTGNLNGKSVVQGDVPL |
Ga0210394_100642891 | 3300021420 | Soil | MSGTISEETKVSKRKKKTSTYRRVVTGSVNGKPIVQSDEKM |
Ga0210394_109704362 | 3300021420 | Soil | MNGTTSKKREVLKRGKKPSTYRRIVTGNVNGRSVVQTDEQMEAYQ |
Ga0210384_106893842 | 3300021432 | Soil | MNGTFSKKTELSERDNKPSTYRRIVTGNVNGKAVVQS |
Ga0210391_108292231 | 3300021433 | Soil | MNGRASRKKESSKRGEKPSTYRRVVTENVNGKAVVQSDEPLPAYEFKTVPG |
Ga0210391_110107422 | 3300021433 | Soil | MDRMASKERTRAKLTTYRRIVTGNVNGKSVVQSDEPMLAYE |
Ga0210390_103720201 | 3300021474 | Soil | MNATASKKRELHERGKKPSTYCRIVTANLNGKSSIQSDES |
Ga0210398_104193021 | 3300021477 | Soil | MNTTVPKKRELSKRGKKPSTYRRIVTGNVNGKSVVQ |
Ga0210398_108316722 | 3300021477 | Soil | MNRTASKKRELPKGGKKPRTYRRIVTGNVNGRAVVESDEPL |
Ga0210410_108470842 | 3300021479 | Soil | MNATASKKRELCERGKKPSSYRRIVTENVNGKSSVQ |
Ga0242661_10756382 | 3300022717 | Soil | MNGTASKKTRLSERGKTPSTCRRIVTRNVNGKSVIQSDEQIQT |
Ga0207684_114222122 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGTPSKKREFSKRGKKPSTYRRIVTGNVNGKAVVQ |
Ga0207663_114084462 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MNATASKKRELSKRGKKPSTYRRIVTGNVNGKAVVQGDEPLLAYQF |
Ga0207664_118553432 | 3300025929 | Agricultural Soil | MKGTASKKTELPKRGKQPGTYRRIVTGNVNGKAVVQSD |
Ga0207658_109301231 | 3300025986 | Switchgrass Rhizosphere | MNRTASKERRRGKKPTTYRRVVTGNANGKSVVQSDEPLLAYEFKTIS |
Ga0207703_111912892 | 3300026035 | Switchgrass Rhizosphere | MNRTASKERKRGKKPTTYRRVVTGNANGKSVVQSDE |
Ga0207641_104869421 | 3300026088 | Switchgrass Rhizosphere | MNGRAAEKKKLSRHGGKPSTYRRVVTENVGGKAVVQSDGPLLAYEFKT |
Ga0207641_115273302 | 3300026088 | Switchgrass Rhizosphere | MNRTASKERKRGKKPTTYRRVVTGNANGKSVVQSDEPLLAYQFDTV |
Ga0257155_10761071 | 3300026481 | Soil | MNKTASKKRESPKRGKKPTTYRRIVTENVNGKAVVQ |
Ga0257157_10918991 | 3300026496 | Soil | MNTTAPKKRELSKRGKKPSTYRRIVTGNVNGKSVVQSDEQLQAYEFKSVPN |
Ga0257181_10022691 | 3300026499 | Soil | MNKTASKKRESPKRGKKPTTYRRIVTENVNGKAVQSDE |
Ga0179587_110648622 | 3300026557 | Vadose Zone Soil | MNKTASKKRESPKRGKKPTTYRRIVTENVNGKAVQSD |
Ga0207944_10064692 | 3300027105 | Forest Soil | MNRTASKKRESSKRTKQPSTYRRIVTLNVSGKSIVQSDEQLQAYQFRSVPD |
Ga0208997_10012735 | 3300027181 | Forest Soil | MNGRASSKRELSKRSKKPSTYRRVVTENVNGKSVVQSDGPMEA |
Ga0208995_10652321 | 3300027388 | Forest Soil | MNGRATRKRELSKRGKKPSTYRRVVTENVNGKSVVQSDGPMEAYEFRT |
Ga0209524_10577301 | 3300027521 | Forest Soil | MNTTAPKKRELSKRGKKPSTYRRIVTGNVNGKSVV |
Ga0209735_10077391 | 3300027562 | Forest Soil | MSAMNKTASKKRELSKRSKQPRTYRRIVTADVDGKS |
Ga0209525_10605271 | 3300027575 | Forest Soil | MNTTAPKKRELSQRAKKPSTYRRIVTGNVNGKSVVQSDEQLQAYE |
Ga0209733_11627961 | 3300027591 | Forest Soil | MNGTAFKKRESSKRGKQPRTYRRIVTGTVNGKSFVQGDEHMQ |
Ga0209422_11308902 | 3300027629 | Forest Soil | MNGTTSKKRELSKRDKKPSTYRRIVTGNVNGRAVVQSDEPLPAYQFKT |
Ga0209388_10176184 | 3300027655 | Vadose Zone Soil | MNKTASKKRESPKRGKKPTTYRRIVTENVNGKAVVQS |
Ga0209736_10202773 | 3300027660 | Forest Soil | MNRTDSKKRELSKRSRQPSTYRRIVTSNVDGKSILQSDEQ |
Ga0209588_12408021 | 3300027671 | Vadose Zone Soil | MNGRASRKEESSKRGDQPSSYRRVVTENVNGKAVIQRDESLPAYEFK |
Ga0209446_10926772 | 3300027698 | Bog Forest Soil | MNRAASKKRELSKRSKQPSMYRRVVTGNVDGKSILQSDEQLPAYQF |
Ga0209447_101543981 | 3300027701 | Bog Forest Soil | MNRTASKKQELSKRGKQPSTYRRIVTGNADGKSVV |
Ga0209701_102004492 | 3300027862 | Vadose Zone Soil | MNGTASKKRELSKRGKKPSTYRRIVTGNVNGKAVVQSDE |
Ga0209488_101448513 | 3300027903 | Vadose Zone Soil | MNKTASKKRESPKRGKKPTTYRRIVTENVNGKAVVQSDEPLLAY |
Ga0308309_113220241 | 3300028906 | Soil | MNGTASKKRELSKHGKKPSTYRRIVTRNVNGKSVIQSDEQMQTYQF |
Ga0308309_116761202 | 3300028906 | Soil | MNGTASKKTELSERDNKPSTYRRIVTGNVNGKAVVQS |
Ga0307482_12404132 | 3300030730 | Hardwood Forest Soil | MNGTASTKRELSKRGKEPSTYRRIVTGNVNGKSAVQSDEPLPAYEFKTV |
Ga0265753_11017481 | 3300030862 | Soil | MNGTSSKKTELSERENKPRTYRRIVTGNVNGKAVVQSDEPLPAYEFR |
Ga0073994_100193211 | 3300030991 | Soil | MNGTASKKRKLSKRGKKPSTYRRIVTGNVNGKSVVQTDEHMQAYEFKTVPG |
Ga0170822_106855712 | 3300031122 | Forest Soil | MNVTASKKREFPERGAKPSTYRRIVTEDVNGKSVVQSDESLP |
Ga0170823_112575861 | 3300031128 | Forest Soil | MNGAASRKTRLSERGKKPTTYRRIVTENVNGKSVVQSDEQMQTYEFKTVPG |
Ga0307476_108061481 | 3300031715 | Hardwood Forest Soil | MKGTASQKRELSKRSKHPSTYRRIVTGNVNGKSVV |
Ga0307474_114081011 | 3300031718 | Hardwood Forest Soil | MNGTISKKTDLSKRGKKPSTYRRFVTGNVSGQAVVQS |
Ga0307478_105452162 | 3300031823 | Hardwood Forest Soil | MNATASKKRELSERGKKPSSYRRIVTANVNGKSSVQSDESMPAYE |
Ga0307478_111531621 | 3300031823 | Hardwood Forest Soil | MNGTTYKKRELSKRDKKPSTYRRIVTGNVNGKAVVQSDAPLPAYEFKTVPG |
Ga0307479_103444643 | 3300031962 | Hardwood Forest Soil | MNGTASEKTELSKRGKKPGTYRRIVTETVNGKSVVQSDEHLQAYEFKT |
⦗Top⦘ |