| Basic Information | |
|---|---|
| Family ID | F092628 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MRTVNNGTMRGTRVGAGPAGEPYGRGFAVAKVVVLYHCANKHQTLV |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.93 % |
| % of genes from short scaffolds (< 2000 bps) | 0.93 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (13.084 % of family members) |
| Environment Ontology (ENVO) | Unclassified (17.757 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.794 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.62% β-sheet: 0.00% Coil/Unstructured: 78.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF00440 | TetR_N | 6.54 |
| PF05973 | Gp49 | 4.67 |
| PF13302 | Acetyltransf_3 | 2.80 |
| PF08241 | Methyltransf_11 | 1.87 |
| PF12680 | SnoaL_2 | 1.87 |
| PF01243 | Putative_PNPOx | 0.93 |
| PF00561 | Abhydrolase_1 | 0.93 |
| PF05685 | Uma2 | 0.93 |
| PF03704 | BTAD | 0.93 |
| PF02381 | MraZ | 0.93 |
| PF13714 | PEP_mutase | 0.93 |
| PF01047 | MarR | 0.93 |
| PF03551 | PadR | 0.93 |
| PF00293 | NUDIX | 0.93 |
| PF00296 | Bac_luciferase | 0.93 |
| PF00196 | GerE | 0.93 |
| PF13087 | AAA_12 | 0.93 |
| PF14246 | TetR_C_7 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 4.67 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 4.67 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.93 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.93 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.93 |
| COG2001 | MraZ, DNA-binding transcriptional regulator and inhibitor of RsmH methyltransferase activity | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.93 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.93 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.93 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005591|Ga0070761_10408590 | Not Available | 829 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 13.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.28% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.35% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.35% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.48% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.54% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.87% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.87% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.93% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028742 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_00436470 | 2170459010 | Grass Soil | MRTANNGTMRGTRVGAGPAGEPYGRGFAVAKVVVL |
| FD1_07775870 | 2170459024 | Grass Soil | MEAFMRTVNNGIMQGTRVGAGPAGEPIGRGIAVARVVVLYHCANKHQTLVPFIWTVTPPSQW |
| JGI1027J12803_1008233092 | 3300000955 | Soil | MRTVNSGTMRGTRVGAGPAGEPYGRGVTVAKVVVLYHCANKHQTLVPFIWT |
| JGI12635J15846_106875392 | 3300001593 | Forest Soil | MRTANHGTVRGTRVGAGPAREPNGRGSAVAKAVVLYYCASRHRTTVP |
| Ga0062384_1002794202 | 3300004082 | Bog Forest Soil | MRTVHNGALRAKRVGAGPAGEPPGRELTVARIGVLYHCANKHQTLVPF |
| Ga0062389_1039515381 | 3300004092 | Bog Forest Soil | MRTANHGTMQGTRVGAGPVSDPYGRGFTVAKVVVLYHCASGHRTTVP |
| Ga0070674_1019005661 | 3300005356 | Miscanthus Rhizosphere | MRTVNNGIMQGTRVGAGPAGEPYGRGTAVAKVVVLYHCANKHQTLVPFIWTA |
| Ga0070709_101083286 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTVNNGIMQGTRVGAGPAGEPIGRGIAVARVVVLYHCANKHQT |
| Ga0070714_1007332163 | 3300005435 | Agricultural Soil | MRTVNTGTMKGTRVGAGPAGEPIGRGIAVARVVVLYHCANKHQT |
| Ga0070713_1009526571 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAAKNGTMRGTRAGAGPAGEPDGHGFTVAKVVVLYHCAN |
| Ga0070706_1002708984 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTVNNGIMRGTRVGAGPAGEPYGREFPVAKVVVLYHCANKHQTVVPFIWTASPP |
| Ga0070704_1014626912 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MRISNNGIMQGTRVGAGPAGEPYDRGSTVAKIVVIYHCANKHQTLVPFIW |
| Ga0068855_1007675473 | 3300005563 | Corn Rhizosphere | MRISNNGIMQGTRVGAGPAGEPYDRGSTVAKVVVIYHCANKHQTLVPFIWTA |
| Ga0070761_104085903 | 3300005591 | Soil | MRTVNSGPLQATRVGAGPAGEPYDRGLPVGKIAVLYHCANQHQTLIPFICTVTPPL |
| Ga0070763_108878292 | 3300005610 | Soil | MRTVSNGAIRGTRVGAGPAGDPYGRGFAVAKIVVHYHCANEHQTVVPFIGTV |
| Ga0070764_105417922 | 3300005712 | Soil | MRTANHGAMRGTRVGAGPVGEPYGRGLAVDKVVVL |
| Ga0070764_105987751 | 3300005712 | Soil | MRTVNSGPLQATRVGAGPAGEPYDRGLPVGKIAVLYHCANQHQTLIPFICTVTP |
| Ga0068860_1011856583 | 3300005843 | Switchgrass Rhizosphere | MRISNNGIMQGTRVGAGPAGEPYDRGSTVAKVVVIYHCANKHQTVVPFIWT |
| Ga0070717_114226961 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTAKNGTMQGTRVGAGPPGEPYGRGSTVAKVVVLYHCANKHQTVVPFIWT |
| Ga0075024_1008175011 | 3300006047 | Watersheds | MRTANNGAMRGTRVGAGPAGEPYVRGFPVGKVVVHYHCANKHQTVVPFI |
| Ga0075017_1006330813 | 3300006059 | Watersheds | MRTANNGTMRGTRAGAGPAGELYSRGFAVAKVVVLYHCANKHQTLVPFIWTVT |
| Ga0075019_107402582 | 3300006086 | Watersheds | MRTANNGTMRGTRVGAGPAGEPYGRGFAVAKVVVLYHC |
| Ga0075015_1006077352 | 3300006102 | Watersheds | MRTANHGTIRGTRVGAGPAGEPHGRGFAVAKVVVLYH |
| Ga0075015_1008137471 | 3300006102 | Watersheds | MRTVNNGTMQGTRVGAGPAGEPYGRGFAVAKVVVLYHCA |
| Ga0075015_1008820751 | 3300006102 | Watersheds | MRTVNNGTMRGTRVGAGPAGEPYGRGFAVAKVVVLYHC |
| Ga0075030_1016359242 | 3300006162 | Watersheds | MRTANNGTMRGTRVGAGPAGEPYGRGFAVAKVVVLYHCA |
| Ga0070716_1001390935 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTVNNGIMQGTRVGAGPAGEPIGRGIAVARVVVLYHCANKHQTRVPF |
| Ga0070716_1006176751 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTVSSGTMKGTRVGAGPAGEPIGRGIAVARVVVLYHCANKHQTRVPFIWT |
| Ga0070765_1000072611 | 3300006176 | Soil | MRTVSNGPIQGTRVGAGPAGEPYGRGFAVAKIVVLYHCANKHQTLVPFIWTVTPP |
| Ga0070765_1004098813 | 3300006176 | Soil | MRTVSSGAIQGTRVGAGPAGEPYDRGLAVAKIVVLYHCANK |
| Ga0066659_118056281 | 3300006797 | Soil | MRTVNSGTMRGTRVGAGPAGEPHGRGFTVAKVVVLYHC |
| Ga0079221_104894681 | 3300006804 | Agricultural Soil | MRTVSSGTMKGTRAGAGPAGEPLGRGIAVARVVVLY |
| Ga0075425_1027088593 | 3300006854 | Populus Rhizosphere | MRTVNNGIMQGTRVGAGPAGEPYGRGTAVAKVVVLYHCANKHQTLVP |
| Ga0075426_109124331 | 3300006903 | Populus Rhizosphere | MRTVSSGTMKGTRVGAGPAREPYGRGIAVAKVVVLY |
| Ga0099827_106381023 | 3300009090 | Vadose Zone Soil | MQGTSVGAGPAGEPYGRGFTVAKVVVPYHCANKHQTLVPF |
| Ga0099792_104284481 | 3300009143 | Vadose Zone Soil | MRGTRVGAGPAGEPYGRGFAVAKIVVLYHCANKHQTVVPFIWT |
| Ga0075423_130960351 | 3300009162 | Populus Rhizosphere | MRTVSSGTMRGTRVGAGPAAEPHGRGFTVAKVVVLYHCAKK |
| Ga0116225_13083522 | 3300009524 | Peatlands Soil | MRTVSNGAMRATRVGAGPAGEPYGRGFAVAKIVVLYHCANKHQTLVPF |
| Ga0116220_1000062017 | 3300009525 | Peatlands Soil | MRTVSNGAMRATRVGAGPAGEPYGRGFAVAKVVVLYHCANKHQT |
| Ga0116220_103250912 | 3300009525 | Peatlands Soil | MRTAHNGAMKGTRVGAGPAGEPYGRGFAVAKVVVLYHCANKHQT |
| Ga0116224_106358321 | 3300009683 | Peatlands Soil | MRGTRAGAGPAGELYGRGLAVGKVVVLYHCANKHQTLVPFIWTV |
| Ga0116217_105002971 | 3300009700 | Peatlands Soil | MRTVNYGAVQGTRVGAGPSGDPHGRGLTVAKVVVIYHCANGHGTTVPFIWTAT |
| Ga0074044_105327551 | 3300010343 | Bog Forest Soil | MRVNGGIMRTVNNGIMQGTRVGAGPAGEPYGRGNTVAKVI |
| Ga0074044_107219881 | 3300010343 | Bog Forest Soil | VGAGPAGEPYGRGFAVAKAVVLYHCANKHQTLVPFIWTATP |
| Ga0136449_1038519312 | 3300010379 | Peatlands Soil | MRGTRVGAGPAGELYGRGFAVAKVVVLYHCANKHQTLVPFIWT |
| Ga0137391_111237091 | 3300011270 | Vadose Zone Soil | MQGTSVGAGPAGEPYGRGFTVAKVVVLYHCANKHQTLVP |
| Ga0137382_107722631 | 3300012200 | Vadose Zone Soil | MRRGNSGTVEGRRVGAGPAGEPHGRGFPVARVVVIYHCANKHQTVVPFIWTASP |
| Ga0137365_101451483 | 3300012201 | Vadose Zone Soil | MRTAKNGTMQGTRVGAGPAGEPYGRGFTVAKVVVLYHCANKHQTLVPFIWT |
| Ga0137381_111851311 | 3300012207 | Vadose Zone Soil | MRGTRVGAGPAGEPYGRGFTVAKVVVLYHCANKHQTLVPFIWTVT |
| Ga0137384_100883335 | 3300012357 | Vadose Zone Soil | MRTVNSGTMRGTRVGAGPAGEPYGRGFTVAKVVVLYHCANKHQTLVPFIW |
| Ga0137361_114435803 | 3300012362 | Vadose Zone Soil | MRTVNSGTMRGTRVGAGPAGEPYGRGFTVAKVVVLYHCA |
| Ga0164307_114411723 | 3300012987 | Soil | MRTVSSGTMKGIRAGAGPAGEPLGRGITVARVVVLYHCAN |
| Ga0157376_119486103 | 3300014969 | Miscanthus Rhizosphere | MRISNNGIMQGTRVGAGPAGEPYDRGSTVAKVVVIYH |
| Ga0132255_1017265642 | 3300015374 | Arabidopsis Rhizosphere | MRTVNSGTMRGTRVGAGPAGEPYGRGVTVAKVVVLYH |
| Ga0187818_100801561 | 3300017823 | Freshwater Sediment | MRTVNYGAVQGTRVGAGPAGDPHGRGLAVAKVVVIYHCANGHRTTVP |
| Ga0187807_11577562 | 3300017926 | Freshwater Sediment | MRTVNNGAMRATRVGAGPAGEPYGRGFAVAKIAVLYHCANKHQTLVPFIWTVTPPA |
| Ga0187806_13906912 | 3300017928 | Freshwater Sediment | MRTVNSGTMRGTRVGAGPASEPYGRGFTVAKVVVLYHC |
| Ga0187822_100876333 | 3300017994 | Freshwater Sediment | MRTVNNGAMRATRVGAGPAGEPYGRGFAVAKIAVLYHCSNKHQTL |
| Ga0187883_103912762 | 3300018037 | Peatland | MRTMNTGAMRATRVGAGPAGEPYDGGFTVAKVVVLYHCANGHRTAVPFI |
| Ga0187855_106691561 | 3300018038 | Peatland | MRTVNSGPLQATRVGAGPAGEPYDRGLPVGKISVLYHCANKHQTLIPFICTVTPPLQWEC |
| Ga0210395_107612082 | 3300020582 | Soil | MRTVTSGTMKGTRIGAGPAGDPYGRGFTVARVVVLYHCANKHQTLVP |
| Ga0210405_107381281 | 3300021171 | Soil | MRTVNSGTMRGTRVGAGPAGEPYGRGFAVAKVVVFYHCANKHQTRVPFIWTATPPP |
| Ga0210396_111632111 | 3300021180 | Soil | MRTGNNGPMQGTRVGAGPAGEPYGRGFAVAKIVVLYHCA |
| Ga0210388_112940782 | 3300021181 | Soil | MRTANHGAMRGTRVGAGPVGEPDGRGLAVAKVVVLYH |
| Ga0210385_106545331 | 3300021402 | Soil | MRTVNTGIMRATRVGAGPAGEPYGRGSTVAKVVVLYH |
| Ga0210397_107990912 | 3300021403 | Soil | MRTANNGTMKGTRVGAGPAGEPYGRGFAVAKVVVLYHCANKHQTLVPFIWTVTPP |
| Ga0210383_111691271 | 3300021407 | Soil | MRTVNSSAIQGTRAGAGPASEPYGRGFAVAKIVVVYHCANKHQTSVPFIWTVTPPR |
| Ga0210391_108143391 | 3300021433 | Soil | MRTGNNGPMQGTRVGAGPAGEPYGRGFAVAKIVVLYHCANKHQTLVPFIWTVTRPTQWE |
| Ga0210390_105886251 | 3300021474 | Soil | MRTANNGPMQGTRVGAGPAGEPYGRGFAVAKIVVLYHCANKHQTIVPFIWTVT |
| Ga0210410_116820141 | 3300021479 | Soil | MRTANHGAMRGTRVGAGPVGEPYGRGLAVDKVVVLYHCANG |
| Ga0210409_112946311 | 3300021559 | Soil | MRTVNSSAIQGTRAGAGPASEPYGRGFAVAKIVVVYHCANKH |
| Ga0208589_10641551 | 3300025634 | Arctic Peat Soil | MRTVNNGTMQGTRVGAGPASDPYGRGFTVAKVVVLYHCANGHRTT |
| Ga0207692_110840431 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTVNSGTMRGTRVGAGPAGEPYGRGFAVAKVVVF |
| Ga0207699_103900341 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTVNSGTMRGTRVGAGPAGEPYGRGFAVAKVVVFYHCANKHQ |
| Ga0207699_113467102 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTVNNGIMQGTRVGAGPAGEPYGRGFAVAKVVVLYHCANKHQTRVPFIGTVTPPPQWE |
| Ga0207663_106748551 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAAKNGTMRGTRAGAGPAGEPDGHGFTVAKVVVLYHCANKHQTLVP |
| Ga0207700_112069441 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTAKNGTMQGTRVGAGPAGEPYGRGFTVAKVVVLYHCANKHQTLVPFIWTATPP |
| Ga0207700_113669291 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTVNSGTMRGTRVGAGPAGEPHGRGFTVAKVVVLYHCANKHQTPVPFIWTATPP |
| Ga0207669_110360721 | 3300025937 | Miscanthus Rhizosphere | MRTVNNGIMQGTRVGAGPAGEPYGRGTAVAKVVVLYHCANKHQTLVPFIWT |
| Ga0207665_104769143 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTVNNGIMQGTRVGAGPAGEPIGRGIAVARVVVLYHCANKHQTPVPFIWTVTPPPQWE |
| Ga0208603_10705411 | 3300027109 | Forest Soil | MRTVNSSAIQGTRAGAGPASEPYGRGFAVAKIVVVYHCANKHQTSVPFIWTV |
| Ga0209530_12247292 | 3300027692 | Forest Soil | MRTANHGTVRGTRVGAGPAREPNGRGSAVAKAVVLYYCASRHR |
| Ga0209178_11920582 | 3300027725 | Agricultural Soil | MRTANNGIMQGTRVGAGPAGEPYGRGSTVAKVVVIYHCANKHQTLVP |
| Ga0209328_101411631 | 3300027727 | Forest Soil | MRTANSGTMRGTRVGAGPAGEPYGRGFAVAKVVVLYHCANKHQTLVP |
| Ga0209580_102303282 | 3300027842 | Surface Soil | MRNVNHGAVQGTRVGAGPASDPHGRGLTVAKVVVIYHCANGHRTTVPLIWTAIPPP |
| Ga0209274_104262782 | 3300027853 | Soil | MRTVNSGPLQATRVGAGPAGEPYDRGLPVGKIAVLYHCA |
| Ga0209590_104680981 | 3300027882 | Vadose Zone Soil | MRTVNNGTMQGTSVGAGPAGEPYGRGFTVAKVVVPYHCANKHQTLVPFI |
| Ga0209488_101844006 | 3300027903 | Vadose Zone Soil | MRTVNNGTMQGTSVGAGPAGEPYGRGFTVAKVVVPYHCANKHQTLVPFIWTATPP |
| Ga0209415_106596291 | 3300027905 | Peatlands Soil | MRTVNYGAVQGTRVGAGPSGDPHGRGLTVAKVVVIYHCANGHGTTVPFIWTA |
| Ga0209069_108765451 | 3300027915 | Watersheds | MRTANNGIMQGTRVGAGPAGEPYGRGSTVAKVSVIYH |
| Ga0302220_103371422 | 3300028742 | Palsa | MRTVNTGIMRATRVGAGPAGEPYGRGSAVAKVVVLYHCANGHTTT |
| Ga0307282_104400122 | 3300028784 | Soil | MRTANNGIMQGTRVGAGPAGEPYDRGSTVAKVVVIYHCANKHQTLVPFIWTATPP |
| Ga0302228_103673891 | 3300028808 | Palsa | MRTVNHGTMRGTRVGSGPAGEPNGRGATVTKVVVPY |
| Ga0311340_104535441 | 3300029943 | Palsa | MRTVNHGTVRGTRVGAGPARERNGREAAVAKVVVLYYCASRHRTRVPFLWTATPP |
| Ga0302182_104685631 | 3300030054 | Palsa | MRTVNSGPLQATRVGAGPAGEPYDRGLPVGKISVLYHCANQH |
| Ga0302179_103072881 | 3300030058 | Palsa | MRTVTTGIMRATRVGAGPAGEPYGRGATVAKAVVPYYCANGH |
| Ga0310037_104325751 | 3300030494 | Peatlands Soil | MRTVNNGTMRGTRVGAGPAGEPYGRGFAVAKVVVLYHCANKHQTLV |
| Ga0311357_106215153 | 3300030524 | Palsa | MRIVNHGTLRGTRVGAGPGGEPLGRGTAVVKVVVPYYCASGHR |
| Ga0302325_110137491 | 3300031234 | Palsa | MRTVKHGSVRGTRVGAGPAREPNGRGLTVAKVVVLYYCASGHRTTVPFIWTATP |
| Ga0302325_127226802 | 3300031234 | Palsa | MRTVNNGIMQGTRVGAGPAREPYDRGYTVAKVVVHYRCAN |
| Ga0302324_1021391421 | 3300031236 | Palsa | MRTASHSSVRGTRVGAGPAREPNGRGANVAKIVVPYYCA |
| Ga0302326_118684673 | 3300031525 | Palsa | MRTVSSGPIQGTRVGAGPAGEPYDRGLAVAKIVVLY |
| Ga0310686_1000206171 | 3300031708 | Soil | MRTANRGALRGTRAGSGPAGEPYGRGLAVAKVVVLY |
| Ga0310686_1052698551 | 3300031708 | Soil | MRTSNNGAMRGTRVGAGPAGEPYGRGFAVAKVVVLYHCANKHQTLVP |
| Ga0307476_105943021 | 3300031715 | Hardwood Forest Soil | MRTVNSSAIQGTRAGAGPAGEPYGRGFAVAKVVVVYHCANKHQTSVPFIWTVTPPRQ |
| Ga0307470_105645951 | 3300032174 | Hardwood Forest Soil | MRISNNGIMQGTRVGAGPAGEPYDRGSTVAKVVVIYHCANKHQTLVPFIWTASPP |
| Ga0307471_1026376121 | 3300032180 | Hardwood Forest Soil | MRTANNGTMQGTRVGAGPAGEPHGRGFPVARVVVIYHCANEHQTVVPF |
| ⦗Top⦘ |