| Basic Information | |
|---|---|
| Family ID | F092626 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 47 residues |
| Representative Sequence | TEEDLDWFVSALEETVARAEKMPRALVRFVLQAARAGRTPRRRLARA |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.52 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.654 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (25.234 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.579 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.336 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.67% β-sheet: 0.00% Coil/Unstructured: 57.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF01061 | ABC2_membrane | 26.17 |
| PF02412 | TSP_3 | 5.61 |
| PF01243 | Putative_PNPOx | 5.61 |
| PF07883 | Cupin_2 | 2.80 |
| PF00005 | ABC_tran | 2.80 |
| PF00294 | PfkB | 1.87 |
| PF13304 | AAA_21 | 1.87 |
| PF13340 | DUF4096 | 0.93 |
| PF07992 | Pyr_redox_2 | 0.93 |
| PF09985 | Glucodextran_C | 0.93 |
| PF13669 | Glyoxalase_4 | 0.93 |
| PF12698 | ABC2_membrane_3 | 0.93 |
| PF13683 | rve_3 | 0.93 |
| PF00300 | His_Phos_1 | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.65 % |
| Unclassified | root | N/A | 9.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_106701350 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
| 3300000956|JGI10216J12902_109833765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 733 | Open in IMG/M |
| 3300000956|JGI10216J12902_118652007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 678 | Open in IMG/M |
| 3300002568|C688J35102_119376356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 683 | Open in IMG/M |
| 3300003321|soilH1_10143524 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
| 3300004156|Ga0062589_100956047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 795 | Open in IMG/M |
| 3300004479|Ga0062595_100069347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1722 | Open in IMG/M |
| 3300004479|Ga0062595_101065248 | Not Available | 702 | Open in IMG/M |
| 3300004643|Ga0062591_100445498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1090 | Open in IMG/M |
| 3300005164|Ga0066815_10055883 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005177|Ga0066690_10290510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1103 | Open in IMG/M |
| 3300005181|Ga0066678_10994127 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005343|Ga0070687_100100018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1622 | Open in IMG/M |
| 3300005356|Ga0070674_101006105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 732 | Open in IMG/M |
| 3300005435|Ga0070714_101005446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 811 | Open in IMG/M |
| 3300005441|Ga0070700_101306788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
| 3300005456|Ga0070678_100026127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3942 | Open in IMG/M |
| 3300005456|Ga0070678_100199115 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
| 3300005544|Ga0070686_100110124 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300005614|Ga0068856_102504855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300005843|Ga0068860_102104063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300006031|Ga0066651_10101785 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300006173|Ga0070716_100156300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1473 | Open in IMG/M |
| 3300006237|Ga0097621_101910294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 566 | Open in IMG/M |
| 3300006806|Ga0079220_10075893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1671 | Open in IMG/M |
| 3300006903|Ga0075426_11355365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300009098|Ga0105245_10036992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4338 | Open in IMG/M |
| 3300009137|Ga0066709_102773120 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300009137|Ga0066709_104134820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 528 | Open in IMG/M |
| 3300009156|Ga0111538_10339830 | All Organisms → cellular organisms → Bacteria | 1901 | Open in IMG/M |
| 3300009174|Ga0105241_10279565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1425 | Open in IMG/M |
| 3300009553|Ga0105249_12753669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300009553|Ga0105249_13559307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
| 3300010145|Ga0126321_1347771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 683 | Open in IMG/M |
| 3300010326|Ga0134065_10126905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 871 | Open in IMG/M |
| 3300010366|Ga0126379_10950637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 963 | Open in IMG/M |
| 3300010403|Ga0134123_11131899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 808 | Open in IMG/M |
| 3300012200|Ga0137382_10935549 | Not Available | 624 | Open in IMG/M |
| 3300012208|Ga0137376_11629093 | Not Available | 536 | Open in IMG/M |
| 3300012211|Ga0137377_11710122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 550 | Open in IMG/M |
| 3300012350|Ga0137372_10146506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1932 | Open in IMG/M |
| 3300012356|Ga0137371_10215415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1502 | Open in IMG/M |
| 3300012356|Ga0137371_10576566 | Not Available | 865 | Open in IMG/M |
| 3300012469|Ga0150984_104220277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300012492|Ga0157335_1004590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 936 | Open in IMG/M |
| 3300012985|Ga0164308_10610787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 929 | Open in IMG/M |
| 3300012985|Ga0164308_11426320 | Not Available | 633 | Open in IMG/M |
| 3300012987|Ga0164307_11470972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
| 3300013308|Ga0157375_11896688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 707 | Open in IMG/M |
| 3300014969|Ga0157376_11096292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 822 | Open in IMG/M |
| 3300015356|Ga0134073_10436250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 501 | Open in IMG/M |
| 3300015374|Ga0132255_100787170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1417 | Open in IMG/M |
| 3300015374|Ga0132255_104121633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
| 3300018051|Ga0184620_10306652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300018089|Ga0187774_10978206 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300019885|Ga0193747_1005287 | All Organisms → cellular organisms → Bacteria | 3133 | Open in IMG/M |
| 3300019887|Ga0193729_1170330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 770 | Open in IMG/M |
| 3300021078|Ga0210381_10213401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
| 3300022756|Ga0222622_10715368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 728 | Open in IMG/M |
| 3300023057|Ga0247797_1004528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1490 | Open in IMG/M |
| 3300024177|Ga0247686_1016989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 806 | Open in IMG/M |
| 3300024251|Ga0247679_1030778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 905 | Open in IMG/M |
| 3300024317|Ga0247660_1048445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 700 | Open in IMG/M |
| 3300025898|Ga0207692_10533336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 748 | Open in IMG/M |
| 3300025912|Ga0207707_11575371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300025917|Ga0207660_10341323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1199 | Open in IMG/M |
| 3300025927|Ga0207687_10899001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 758 | Open in IMG/M |
| 3300025932|Ga0207690_10651120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 863 | Open in IMG/M |
| 3300025935|Ga0207709_11406912 | Not Available | 578 | Open in IMG/M |
| 3300025942|Ga0207689_10977670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 714 | Open in IMG/M |
| 3300025945|Ga0207679_11700792 | Not Available | 577 | Open in IMG/M |
| 3300025961|Ga0207712_10731261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 866 | Open in IMG/M |
| 3300025961|Ga0207712_11337747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 640 | Open in IMG/M |
| 3300026023|Ga0207677_10187831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1632 | Open in IMG/M |
| 3300026300|Ga0209027_1257502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
| 3300026325|Ga0209152_10091483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1135 | Open in IMG/M |
| 3300026343|Ga0209159_1092323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1334 | Open in IMG/M |
| 3300028145|Ga0247663_1006188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1582 | Open in IMG/M |
| 3300028381|Ga0268264_12382677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300028596|Ga0247821_11034285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 552 | Open in IMG/M |
| 3300028705|Ga0307276_10039348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1014 | Open in IMG/M |
| 3300028715|Ga0307313_10258195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300028717|Ga0307298_10014732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1985 | Open in IMG/M |
| 3300028722|Ga0307319_10239134 | Not Available | 597 | Open in IMG/M |
| 3300028744|Ga0307318_10247821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300028768|Ga0307280_10014544 | All Organisms → cellular organisms → Bacteria | 2192 | Open in IMG/M |
| 3300028768|Ga0307280_10354585 | Not Available | 542 | Open in IMG/M |
| 3300028782|Ga0307306_10089584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 809 | Open in IMG/M |
| 3300028784|Ga0307282_10064656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1654 | Open in IMG/M |
| 3300028787|Ga0307323_10087457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1113 | Open in IMG/M |
| 3300028793|Ga0307299_10196686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 758 | Open in IMG/M |
| 3300028793|Ga0307299_10314922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
| 3300028807|Ga0307305_10163638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1026 | Open in IMG/M |
| 3300028807|Ga0307305_10261350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
| 3300028814|Ga0307302_10027338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2610 | Open in IMG/M |
| 3300028819|Ga0307296_10664543 | Not Available | 570 | Open in IMG/M |
| 3300028876|Ga0307286_10013249 | All Organisms → cellular organisms → Bacteria | 2579 | Open in IMG/M |
| 3300028876|Ga0307286_10172613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 779 | Open in IMG/M |
| 3300028880|Ga0307300_10077856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 975 | Open in IMG/M |
| 3300028881|Ga0307277_10274058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 746 | Open in IMG/M |
| 3300028884|Ga0307308_10618344 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300028885|Ga0307304_10269278 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300031995|Ga0307409_100101962 | All Organisms → cellular organisms → Bacteria | 2383 | Open in IMG/M |
| 3300032180|Ga0307471_101918007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 741 | Open in IMG/M |
| 3300032770|Ga0335085_10171437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2693 | Open in IMG/M |
| 3300032782|Ga0335082_10856111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 771 | Open in IMG/M |
| 3300033004|Ga0335084_11752323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 25.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.48% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.87% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.87% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023057 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6 | Environmental | Open in IMG/M |
| 3300024177 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27 | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300024317 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK01 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1067013501 | 3300000956 | Soil | VVTEEDLEWFVAALEQTVARAEKMPRALVRFALTAARAGRPSRLRPVRA* |
| JGI10216J12902_1098337653 | 3300000956 | Soil | EDLEWFASALDETVARAEKMPRALVRFAVGAARAGRTPRRKLARA* |
| JGI10216J12902_1186520071 | 3300000956 | Soil | LVVTEDDLDWFVSALEDTVARAEKMPRALVRFAVQAARSGRAPRPRRRLVRA* |
| C688J35102_1193763561 | 3300002568 | Soil | DEDDLDWFVTALDETVSRAEKMPRALVRFALHAARAGRTPRKRLARA* |
| soilH1_101435244 | 3300003321 | Sugarcane Root And Bulk Soil | HGLNVIKAIPPLVITEDDLEQFSGALDETVARAEKMPRALVRFALGAARAGRTPRRRPLARA* |
| Ga0062589_1009560473 | 3300004156 | Soil | LEWFASALDETVARAEKMPRALVRFAVGAARAGRTPRRKLARA* |
| Ga0062595_1000693471 | 3300004479 | Soil | LVVTEEDVDWFGSALEDTIARAEKMPRALVRFALRAASGRPRSAPRRASRLARAR* |
| Ga0062595_1010652482 | 3300004479 | Soil | TEEDVDWFVSALEETITSAEKMPRALVRFALQAARAGRTPKRRLARA* |
| Ga0062591_1004454981 | 3300004643 | Soil | TEDDLDWFVTALEETISKAEHMPRALVRFALGAARAGRGPRRRLVRA* |
| Ga0066815_100558832 | 3300005164 | Soil | VVTEDDIEWLVAGLDDTIARAEKMPRALVRFGLTAARAGRTKRPRLARA* |
| Ga0066690_102905103 | 3300005177 | Soil | IPPLVVIEEDVDWFVSALEETITRAEKMPRALVRFALQAARAGRTPRRRLARA* |
| Ga0066678_109941271 | 3300005181 | Soil | TTPPLVVTEQDVDWFVAALEETISRAEKMPRALVRFALGAARAGRAPRRRLARA* |
| Ga0070687_1001000181 | 3300005343 | Switchgrass Rhizosphere | LPPLVIDEDDLDWFVTALDETVARAERMPRALVRFALQAARAGRTPRRRLVRS* |
| Ga0070674_1010061051 | 3300005356 | Miscanthus Rhizosphere | LDWFVTALDETVARAEKMPRALVRFALQAARAGRTPRGRLVRS* |
| Ga0070714_1010054463 | 3300005435 | Agricultural Soil | TEDDLDWFVGSLEETVAQAEKMPRALVRFALQAARAGAPRRRPVRA* |
| Ga0070700_1013067881 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VTEDDLDWFVSALEETITRAERMPRALVRFALGAARAGRTPRRRLMRA* |
| Ga0070678_1000261271 | 3300005456 | Miscanthus Rhizosphere | PLVVTEDDLDWFVGSLEETVAQAEKMPRALVRFALQAARAGAPRRRPVRA* |
| Ga0070678_1001991151 | 3300005456 | Miscanthus Rhizosphere | LPPLVVDEDDLDWFVTALDETVSKAEKMPRALVRFALTAARAGRTPRKRLARA* |
| Ga0070686_1001101241 | 3300005544 | Switchgrass Rhizosphere | PPLVVDEDDLDLFVAALDETVSKAEKMPRALVRFALTAARAGRTPRKRLARA* |
| Ga0068856_1025048552 | 3300005614 | Corn Rhizosphere | TQDDLDWFVSSLEETIMRAERMPRALVRFALGAARAGRTPRRRLTRA* |
| Ga0068860_1021040631 | 3300005843 | Switchgrass Rhizosphere | LPPLVVDGDDLDWFVTALDETVARAEKMPRALVRFGLQAARAGRTPRKRLARVSS* |
| Ga0066651_101017853 | 3300006031 | Soil | VTAEDVDWFVSALEETVADAEKMPRALVRFALGAARAGRPKRKRLVRA* |
| Ga0070716_1001563003 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GLNVLKALPPLVVIEDDLDWFVGSLEETVAQAEKMPRALIRFALQAARAGRTPRSRMARA |
| Ga0097621_1019102942 | 3300006237 | Miscanthus Rhizosphere | VGSLEETVAQAEKMPRALVRFALQAARAGAPRRRPVRA* |
| Ga0079220_100758931 | 3300006806 | Agricultural Soil | LVVDEDDLDWFVAALDETVLKAEKMPRALVRFALTAARAGRTPRKRLARA* |
| Ga0075426_113553651 | 3300006903 | Populus Rhizosphere | ETIGKAEHMPRALVRFALGAARAGRGPRRRLVRA* |
| Ga0105245_100369929 | 3300009098 | Miscanthus Rhizosphere | LDWFVTALDETVARAEKMPRALVRFALQAARAGRTPRRRLVRS* |
| Ga0066709_1027731201 | 3300009137 | Grasslands Soil | NVVKALPPLVVTGDDLDGFVSALEETIDRAEKMPRALVRFALTAARAGRTPKRRLARA* |
| Ga0066709_1041348202 | 3300009137 | Grasslands Soil | ETVAGAEKMPRALVRFALQAARAGRTPRRRLARA* |
| Ga0111538_103398301 | 3300009156 | Populus Rhizosphere | LNVIKAIPPLVVSEDDLDWFASALEETIAKAEHMPRALVRFALGTARAGRGPRRRLVRA* |
| Ga0105241_102795654 | 3300009174 | Corn Rhizosphere | FVAALDETVSKAEKMPRALVRFALTAARAGRTPRKRLARA* |
| Ga0105249_127536691 | 3300009553 | Switchgrass Rhizosphere | FVSALEETIARAEKMPRALVRFALQAARAGRTPRRRPARV* |
| Ga0105249_135593072 | 3300009553 | Switchgrass Rhizosphere | DLEWFAAALDETVARAEKMPRALVRFAVGAARAGRTPRRKLARA* |
| Ga0126321_13477711 | 3300010145 | Soil | TEEDLDWFVSALEETVARAEKMPRALVRFVLQAARAGRTPRRRLARA* |
| Ga0134065_101269052 | 3300010326 | Grasslands Soil | VTEEDVDWFVTALEETIARAEKMPRALVRFALGAARAGRSPRRKLARV* |
| Ga0126379_109506371 | 3300010366 | Tropical Forest Soil | IPPLVVTEEDVDWFVSALEETIASAEKMPRALVRLALQAARAGRTPRRRPARV* |
| Ga0134123_111318992 | 3300010403 | Terrestrial Soil | EEDLDWFVSALEETIARAEKMPRALVRFALQAARSGRTPKRRLARA* |
| Ga0137382_109355492 | 3300012200 | Vadose Zone Soil | LVVNGDDLDGFVTALEETIDRSEKMPRALVRFALTAARAGRTPKRRLARA* |
| Ga0137376_116290931 | 3300012208 | Vadose Zone Soil | WFVSALEETVARAEKMPRALVRFALRAARAGRAPRRRLTRA* |
| Ga0137377_117101221 | 3300012211 | Vadose Zone Soil | IPPLVVMEEDVDWFVSALEETITQAEKMPRALVRFALQAARAGRTPRRRLTRA* |
| Ga0137372_101465061 | 3300012350 | Vadose Zone Soil | KAIPPLVVIEEDLDWFVSALEETVAGAEKMPRALVRFALQAARAGRPQRRRLARA* |
| Ga0137371_102154153 | 3300012356 | Vadose Zone Soil | NVLKAIPPLVVTEEDLDWFVSALEETVAGAEKMPRALVRFALQAARAGRPQRRRLARA* |
| Ga0137371_105765663 | 3300012356 | Vadose Zone Soil | EETIARAEKTPRALVRFALGAARAGRTPRRRLARA* |
| Ga0150984_1042202772 | 3300012469 | Avena Fatua Rhizosphere | LKAIPPLVVTEEDVDWFANALDETIARAEKMPRALVRFALGAARAGRAPKRKLARERATA |
| Ga0157335_10045901 | 3300012492 | Arabidopsis Rhizosphere | PPLVVSEDDLDWFVSALEETIGKAERMPRALVRFALGAARAGRGPRRRLARA* |
| Ga0164308_106107871 | 3300012985 | Soil | ALDETVTRAEKMPRALVRFGLQAARAGRTPRKRLARA* |
| Ga0164308_114263201 | 3300012985 | Soil | LVIDEDDLDWFVAALDETVARAETMPRALVRFALHAASAGRTPRKRLARA* |
| Ga0164307_114709722 | 3300012987 | Soil | PLVVTEEDVDWFATALDETIGRAEKMPRALVRFALGAARAGRAPKRKLARV* |
| Ga0157375_118966881 | 3300013308 | Miscanthus Rhizosphere | DLDWFVTALEETVSKAEKMPRALMRFALTAARAGRTPRKRLARA* |
| Ga0157376_110962923 | 3300014969 | Miscanthus Rhizosphere | LVVDEDDLDWFVTALEETVSKAEKMPRALMRFALTAARAGRTPRKRLARA* |
| Ga0134073_104362502 | 3300015356 | Grasslands Soil | LDWFVSALEETIGRAEKMPRALVRFALRAARAGRTPRRRPVRA* |
| Ga0132255_1007871704 | 3300015374 | Arabidopsis Rhizosphere | VLKALPPLVVDEDDLDWFVTALDETVGRAEKMPRALVRFALQAARGGRTPRKRLARA* |
| Ga0132255_1041216332 | 3300015374 | Arabidopsis Rhizosphere | KAIPPLVVSEDDLDWFVSALDETIGKAEHMPRALVRFALGAARAGRGPRRRPARA* |
| Ga0184620_103066522 | 3300018051 | Groundwater Sediment | LPPLVVTEEDLDSFASALEGTIGRAERMPRALVRFALGAARAGGKPRRRMARA |
| Ga0187774_109782061 | 3300018089 | Tropical Peatland | HGVNVIKAIPPLVVTEEDVDWLASALEETIAHAEKMPRALVRFALTAARAGRTKRRRLAR |
| Ga0193747_10052871 | 3300019885 | Soil | CELVTGDDLDGFVVALEETIDRAEKMPRALVRFALTAARAGRTPKRRLARA |
| Ga0193729_11703301 | 3300019887 | Soil | LDSFASALEDTVSRAERMPRALVRFALGAARASGRPRRRLTRV |
| Ga0210381_102134011 | 3300021078 | Groundwater Sediment | DLDWFVSALEETITRAERMPRALVRFALGAARAGRTPRRRLMRA |
| Ga0222622_107153681 | 3300022756 | Groundwater Sediment | WFVSALEETVTKAERMPRALVRFALQAARAGRAPRRRPVRA |
| Ga0247797_10045281 | 3300023057 | Soil | EDDLEWFASALDETVARAEKMPRALVRFAVGAARAGRNPRRKLARA |
| Ga0247686_10169891 | 3300024177 | Soil | LEETVAQAEKMPRALVRFALQAARAGAPRRRPVRA |
| Ga0247679_10307783 | 3300024251 | Soil | FVGSLEETVAQAEKMPRALVRFALQAARAGAPRRRPVRA |
| Ga0247660_10484451 | 3300024317 | Soil | LVVTEDDLDWFVGSLEETVAQAEKMPRALVRFALQAARAGAPRRRPVRA |
| Ga0207692_105333363 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | DLDWLVGSLEETVAQAEKMPRALVRFALQAARAGAPRRRPVRA |
| Ga0207707_115753712 | 3300025912 | Corn Rhizosphere | VVTEDDLDWFVGSLEETVAQAEKMPRALVRFALQAARAGAPRRRPVRA |
| Ga0207660_103413231 | 3300025917 | Corn Rhizosphere | WFANALDETIARAEKMPRALVRFALGAARAGRAPKRKLVRA |
| Ga0207687_108990013 | 3300025927 | Miscanthus Rhizosphere | VSALEETITRAERMPRALVRFALGAARAGRTPRRRLMRA |
| Ga0207690_106511203 | 3300025932 | Corn Rhizosphere | KALPPLVIDEDDLDWFVTSLDETVVRAERMPRALVRFALQAARAGRTPRRRLVRS |
| Ga0207709_114069123 | 3300025935 | Miscanthus Rhizosphere | LVIDEDDLDWFVTALDETVARAERMPRALVRFALQAARAGRTPRRRLVRS |
| Ga0207689_109776701 | 3300025942 | Miscanthus Rhizosphere | DDLDWFVAALEETVSKAEKMPRALVRFALTAARAGRTPRKRLARA |
| Ga0207679_117007923 | 3300025945 | Corn Rhizosphere | LNVLKALPPLVVTEDDLDWFVGSLEKTVTQAEKMPRALVRFALTAARAGRTPRKRLARA |
| Ga0207712_107312613 | 3300025961 | Switchgrass Rhizosphere | ALPPLVIDEDDLDWFVTALDETVARAERMPRALVRFALQAARAGRTPRRRLVRS |
| Ga0207712_113377473 | 3300025961 | Switchgrass Rhizosphere | DLEWFAAALDETVARAEKMPRALVRFAVGAARAGRTPRRKLARA |
| Ga0207677_101878311 | 3300026023 | Miscanthus Rhizosphere | KALPPLGVDEDDLDWFVAALDETVSKAEKMPRALVRFALTAARAGRTPRKRLARA |
| Ga0209027_12575022 | 3300026300 | Grasslands Soil | EEAVAGAEKMPRALVRFALGAAKAGRPARKRLTRA |
| Ga0209152_100914831 | 3300026325 | Soil | PLVVGEDDLDWFATALDDTVARAEKMPRALVRFALHAARAGRKPRKRLARA |
| Ga0209159_10923231 | 3300026343 | Soil | VVTEEDVDWFVSALEETVAGAEKMPRALVRFALGAAKAGRTPGKRVARA |
| Ga0247663_10061884 | 3300028145 | Soil | EDDLDWFVGSLEETVAQAEKMPRALVRFALQAARAGAPRRRPVRA |
| Ga0268264_123826771 | 3300028381 | Switchgrass Rhizosphere | LPPLVVDGDDLDWFVTALDETVARAEKMPRALVRFGLQAARAGRTPRKRLARVSS |
| Ga0247821_110342851 | 3300028596 | Soil | FVTALDETVARAEKMPRALVRFALQAARAGRTPRKRLARV |
| Ga0307276_100393481 | 3300028705 | Soil | TEEDLDSFASALEDTVRRAERMPRALVRFALGAARAGGKPRGRLTRV |
| Ga0307313_102581951 | 3300028715 | Soil | PLVVTEDDLDWFVSALEETITRAERMPRALVRFALGAARAGRTPRRRLMRA |
| Ga0307298_100147321 | 3300028717 | Soil | VDEDDLDWFVTALDETVTRAEKMPRALVRFALQAARAGRTPRKRLARA |
| Ga0307319_102391343 | 3300028722 | Soil | LVVTDDDLDWFVSALEETVTKAERMPRALVRFALQAARAGRAPRRRPVRA |
| Ga0307318_102478213 | 3300028744 | Soil | PFASALEETIGRAERMPRALVRFALGAARAGGKPRRRLIRA |
| Ga0307280_100145441 | 3300028768 | Soil | LVVDADDLDWFVSALDETVARAEKMPRALVRFGLQAARAGRTPRKRLARA |
| Ga0307280_103545851 | 3300028768 | Soil | EETVTKAERMPRALVRFALQAARAGRAPRRRPVRA |
| Ga0307306_100895843 | 3300028782 | Soil | NVLKALPSLVVDADDLDWFVSALDETVARAEKMPRALVRFGLQAARAGRTPRKRLARA |
| Ga0307282_100646561 | 3300028784 | Soil | VDADDLDWFVSALDETVARAEKMPRALVRFGLQAARAGRTPRKRLARA |
| Ga0307323_100874571 | 3300028787 | Soil | WFVSALEETITRAERMPRALVRFALGAARAGRTPRRRLIRA |
| Ga0307299_101966862 | 3300028793 | Soil | LVVTEDDVDWFANALDETIARAEKMPRALVRFALGAARAGRAPKRKLARV |
| Ga0307299_103149221 | 3300028793 | Soil | VVDEDDLDWFVTALDETVTRAEKMPRALVRFALQAARAGRTPRKRLARA |
| Ga0307305_101636383 | 3300028807 | Soil | LEGTIGRAERMPRALVRFALGAARAGGKPRRRMARA |
| Ga0307305_102613503 | 3300028807 | Soil | DLDWFVSALDETVARAEKMPRALVRFGLHAARVGRTPRKRLARA |
| Ga0307302_100273381 | 3300028814 | Soil | ALEETVARAEKMPRALVRFALQAARAGRTPRRRSLARA |
| Ga0307296_106645433 | 3300028819 | Soil | DADALDWFVSALDETVARAEKMPRALVRFGLQAARAGRTPRKRLARA |
| Ga0307286_100132491 | 3300028876 | Soil | DDLDWFVTALDETVTRAEKMPRALVRFALQAARAGRTPRKRLARA |
| Ga0307286_101726131 | 3300028876 | Soil | DLDWFVSALEETITRAERMPRALVRFALGAARAGRTPRRRLIRA |
| Ga0307300_100778561 | 3300028880 | Soil | LDETVARAEKMPRALVRFALQATRAGRSPRRRPVRA |
| Ga0307277_102740582 | 3300028881 | Soil | EDDLDWFVAALDETVSRAEKMPRALVRFALHAARAGRSPRRRPVRA |
| Ga0307308_106183441 | 3300028884 | Soil | DVDWFVSALEETIASAEKMPRALVRFALQAARSGRAPKRRLART |
| Ga0307304_102692781 | 3300028885 | Soil | EETIARAEKMPRALVRFALQAARAGRTPRRRLARA |
| Ga0307409_1001019621 | 3300031995 | Rhizosphere | LNVLKGLPPLVIGEDDLDWFVSGLEDTVSRAERMPRALVRFALHAARAGRTSRRRLVRA |
| Ga0307471_1019180071 | 3300032180 | Hardwood Forest Soil | DLDWFVSALEETIARAEKMPRALVRFALQAARAGRTPRRRPARV |
| Ga0335085_101714375 | 3300032770 | Soil | DLDGFVVALEETIERAEKMPRALVRFALTAARAGRMPRRRLARA |
| Ga0335082_108561112 | 3300032782 | Soil | KAIPPLVVTGDDLDGFVVALEETIERAEKMPRALVRFALGAARAGRMPKRRLARA |
| Ga0335084_117523232 | 3300033004 | Soil | DLDGFVVALEETIERAEKMPRALVRFALGAARAGRMPKRRLARA |
| ⦗Top⦘ |