| Basic Information | |
|---|---|
| Family ID | F092623 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 43 residues |
| Representative Sequence | PETAALGHALVRKARHVPGVVAVRDRLTYPDTYPIVAGPVF |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.94 % |
| % of genes near scaffold ends (potentially truncated) | 98.13 % |
| % of genes from short scaffolds (< 2000 bps) | 87.85 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.654 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.430 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.430 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (33.645 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.84% β-sheet: 11.59% Coil/Unstructured: 69.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF00583 | Acetyltransf_1 | 24.30 |
| PF13607 | Succ_CoA_lig | 19.63 |
| PF13380 | CoA_binding_2 | 14.95 |
| PF13302 | Acetyltransf_3 | 12.15 |
| PF13420 | Acetyltransf_4 | 4.67 |
| PF00144 | Beta-lactamase | 1.87 |
| PF09364 | XFP_N | 0.93 |
| PF14691 | Fer4_20 | 0.93 |
| PF00990 | GGDEF | 0.93 |
| PF00571 | CBS | 0.93 |
| PF13185 | GAF_2 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 1.87 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.87 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 1.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.65 % |
| Unclassified | root | N/A | 9.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004977|Ga0072329_1029984 | Not Available | 514 | Open in IMG/M |
| 3300005175|Ga0066673_10717588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 575 | Open in IMG/M |
| 3300005345|Ga0070692_11227929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
| 3300005353|Ga0070669_101568990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
| 3300005436|Ga0070713_100045630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 3592 | Open in IMG/M |
| 3300005436|Ga0070713_100047863 | All Organisms → cellular organisms → Bacteria | 3517 | Open in IMG/M |
| 3300005436|Ga0070713_100060661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 3162 | Open in IMG/M |
| 3300005436|Ga0070713_102044995 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005437|Ga0070710_10712029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 709 | Open in IMG/M |
| 3300005439|Ga0070711_100642844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 889 | Open in IMG/M |
| 3300005445|Ga0070708_100682065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 967 | Open in IMG/M |
| 3300005471|Ga0070698_100801871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 886 | Open in IMG/M |
| 3300005566|Ga0066693_10224877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 738 | Open in IMG/M |
| 3300005618|Ga0068864_101195722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 759 | Open in IMG/M |
| 3300006028|Ga0070717_10320711 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300006173|Ga0070716_100178083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1393 | Open in IMG/M |
| 3300006173|Ga0070716_101484628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 554 | Open in IMG/M |
| 3300006603|Ga0074064_11763728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 664 | Open in IMG/M |
| 3300006954|Ga0079219_10700744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 770 | Open in IMG/M |
| 3300009176|Ga0105242_12957763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
| 3300009700|Ga0116217_10867490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 554 | Open in IMG/M |
| 3300010159|Ga0099796_10322948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 659 | Open in IMG/M |
| 3300010343|Ga0074044_10091216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2053 | Open in IMG/M |
| 3300010371|Ga0134125_10268612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1895 | Open in IMG/M |
| 3300010373|Ga0134128_10920102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 968 | Open in IMG/M |
| 3300010379|Ga0136449_100951140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1391 | Open in IMG/M |
| 3300010379|Ga0136449_102162878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 813 | Open in IMG/M |
| 3300010379|Ga0136449_102739459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 698 | Open in IMG/M |
| 3300010400|Ga0134122_12992137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300010858|Ga0126345_1060146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1283 | Open in IMG/M |
| 3300010876|Ga0126361_10618416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1080 | Open in IMG/M |
| 3300011068|Ga0138599_1030136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 819 | Open in IMG/M |
| 3300011083|Ga0138560_1179503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 614 | Open in IMG/M |
| 3300012360|Ga0137375_11276377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 556 | Open in IMG/M |
| 3300012960|Ga0164301_10250134 | Not Available | 1163 | Open in IMG/M |
| 3300013296|Ga0157374_12276714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
| 3300014162|Ga0181538_10202768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1112 | Open in IMG/M |
| 3300014968|Ga0157379_10537581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1086 | Open in IMG/M |
| 3300015373|Ga0132257_102262416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 704 | Open in IMG/M |
| 3300017946|Ga0187879_10744966 | Not Available | 546 | Open in IMG/M |
| 3300017974|Ga0187777_10274885 | Not Available | 1147 | Open in IMG/M |
| 3300018001|Ga0187815_10095828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1250 | Open in IMG/M |
| 3300018007|Ga0187805_10591869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
| 3300018034|Ga0187863_10249629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 986 | Open in IMG/M |
| 3300018038|Ga0187855_10656984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 611 | Open in IMG/M |
| 3300018086|Ga0187769_10309718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1181 | Open in IMG/M |
| 3300021374|Ga0213881_10150802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1018 | Open in IMG/M |
| 3300021388|Ga0213875_10667289 | Not Available | 504 | Open in IMG/M |
| 3300021403|Ga0210397_10246321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1295 | Open in IMG/M |
| 3300021404|Ga0210389_10757335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 759 | Open in IMG/M |
| 3300021475|Ga0210392_10582798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 829 | Open in IMG/M |
| 3300022708|Ga0242670_1038920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 642 | Open in IMG/M |
| 3300022720|Ga0242672_1036000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 774 | Open in IMG/M |
| 3300024279|Ga0247692_1081462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300025905|Ga0207685_10820979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300025911|Ga0207654_10401890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 953 | Open in IMG/M |
| 3300025916|Ga0207663_10018078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3941 | Open in IMG/M |
| 3300025916|Ga0207663_10866624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 721 | Open in IMG/M |
| 3300025924|Ga0207694_10139237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1951 | Open in IMG/M |
| 3300025928|Ga0207700_10033255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3688 | Open in IMG/M |
| 3300025928|Ga0207700_10421112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1173 | Open in IMG/M |
| 3300025928|Ga0207700_11292852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 650 | Open in IMG/M |
| 3300025929|Ga0207664_10358723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1291 | Open in IMG/M |
| 3300025937|Ga0207669_10893120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 742 | Open in IMG/M |
| 3300025939|Ga0207665_10202832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1446 | Open in IMG/M |
| 3300025939|Ga0207665_11282566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 584 | Open in IMG/M |
| 3300025942|Ga0207689_11121743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 663 | Open in IMG/M |
| 3300026067|Ga0207678_11702451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 554 | Open in IMG/M |
| 3300026142|Ga0207698_12158050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 570 | Open in IMG/M |
| 3300026552|Ga0209577_10443247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 909 | Open in IMG/M |
| 3300027915|Ga0209069_10910313 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 533 | Open in IMG/M |
| 3300028714|Ga0307309_10146165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 595 | Open in IMG/M |
| 3300028828|Ga0307312_10069380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2137 | Open in IMG/M |
| 3300031035|Ga0074026_11066345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 726 | Open in IMG/M |
| 3300031543|Ga0318516_10032389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2767 | Open in IMG/M |
| 3300031549|Ga0318571_10376402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
| 3300031668|Ga0318542_10077081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1572 | Open in IMG/M |
| 3300031719|Ga0306917_10404567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1066 | Open in IMG/M |
| 3300031744|Ga0306918_10740138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 769 | Open in IMG/M |
| 3300031768|Ga0318509_10571900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 630 | Open in IMG/M |
| 3300031771|Ga0318546_10785096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 670 | Open in IMG/M |
| 3300031771|Ga0318546_11002798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 587 | Open in IMG/M |
| 3300031832|Ga0318499_10010258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3020 | Open in IMG/M |
| 3300031833|Ga0310917_10739229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 666 | Open in IMG/M |
| 3300031890|Ga0306925_10828892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 957 | Open in IMG/M |
| 3300031890|Ga0306925_11755370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 596 | Open in IMG/M |
| 3300031912|Ga0306921_10662493 | Not Available | 1202 | Open in IMG/M |
| 3300031941|Ga0310912_10996482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 643 | Open in IMG/M |
| 3300031942|Ga0310916_10186532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1730 | Open in IMG/M |
| 3300031946|Ga0310910_11092650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
| 3300032041|Ga0318549_10307358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 715 | Open in IMG/M |
| 3300032055|Ga0318575_10019284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2829 | Open in IMG/M |
| 3300032055|Ga0318575_10059611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1772 | Open in IMG/M |
| 3300032063|Ga0318504_10073862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1486 | Open in IMG/M |
| 3300032066|Ga0318514_10129115 | Not Available | 1300 | Open in IMG/M |
| 3300032090|Ga0318518_10163570 | Not Available | 1133 | Open in IMG/M |
| 3300032160|Ga0311301_11377754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 882 | Open in IMG/M |
| 3300032261|Ga0306920_104099522 | Not Available | 527 | Open in IMG/M |
| 3300032770|Ga0335085_10986723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 911 | Open in IMG/M |
| 3300032782|Ga0335082_10083020 | All Organisms → cellular organisms → Bacteria | 3215 | Open in IMG/M |
| 3300032783|Ga0335079_10037829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5541 | Open in IMG/M |
| 3300032805|Ga0335078_11169772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 892 | Open in IMG/M |
| 3300032805|Ga0335078_12047714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
| 3300032829|Ga0335070_11314597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 661 | Open in IMG/M |
| 3300032898|Ga0335072_10580500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1134 | Open in IMG/M |
| 3300033134|Ga0335073_10780678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1029 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 18.69% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.61% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.87% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.93% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004977 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011068 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011083 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 45 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300022708 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024279 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031035 | Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus N1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0072329_10299841 | 3300004977 | Peatlands Soil | VTVAGSPETAALGHHIVHKVQHVQGVVAVRDHLSYPDVYPIVAGPVL* |
| Ga0066673_107175882 | 3300005175 | Soil | APETASFGRALIRKARHVPGVVAVRDRLSYPDVYPVAAGPVF* |
| Ga0070692_112279291 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | GSPETAALGHDIVRKIRHVPGVVAVHDQLGYPDIYPIVAGPVF* |
| Ga0070669_1015689901 | 3300005353 | Switchgrass Rhizosphere | TMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDTYPVVAGPVF* |
| Ga0070674_1009225481 | 3300005356 | Miscanthus Rhizosphere | VTVQTGVVTAQGSPETAALGRDIVRKIRHVPGVVAVHQLSYPDTYPIVAGPVF* |
| Ga0070713_1000456301 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | TPETAALGHALIRKARHVPGVVAVRDRLSYPDAYPVVAEPVF* |
| Ga0070713_1000478633 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ESGVVTMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDTHPVVAGPVF* |
| Ga0070713_1000606611 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | PETAAFGRALIRKVRHVPGVVAVRDRLSYSDVYPVVAGPVF* |
| Ga0070713_1020449951 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ESGVVTMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDTYPVVAGPVF* |
| Ga0070710_107120291 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | AGVVTVQGSPETAALGHDIVRKIRHVPGVVAVHDQLGYPDIYPIVAGPVF* |
| Ga0070711_1006428441 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GVVTLEGTPETAALGRSLVRKARHVRGVVAVRDRLSYPDVYPVIAGPVC* |
| Ga0070708_1006820651 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVQGSPETAALGHDIVRKIRHVPGVVAVHDELSYPDTYPIVAGPVF* |
| Ga0070698_1008018712 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GSPETAALGHDIVRKIRHVPGVVAVHDELSYPDTYPIVAGPVF* |
| Ga0066693_102248771 | 3300005566 | Soil | EGTPETAALGRALIRKARHVPGVVAVRDRLSYPDVYPVVAGPVF* |
| Ga0068864_1011957222 | 3300005618 | Switchgrass Rhizosphere | LGHALIRKARHVPGVVAVRDRLSYPDTHPVVAGPVF* |
| Ga0070717_103207113 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ESGVVTMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDAYPVVAEPVF* |
| Ga0070716_1001780831 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AALGHALIRKARHVPGVVAVRDRLSYPDTYPVVAGPVF* |
| Ga0070716_1014846281 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GVVTLEGTPETAALGRALVRKARHVRGVVAVRDLLSYPDVYPVIAGPVC* |
| Ga0074064_117637282 | 3300006603 | Soil | GHALIRKARHVPGVVAVRDRLSYPDTYPVVAGPVF* |
| Ga0079219_107007441 | 3300006954 | Agricultural Soil | TAALGRTLIRKARHVSGVVAVRDRLSYPDTYPVVAGPVF* |
| Ga0105242_129577631 | 3300009176 | Miscanthus Rhizosphere | AALGHALIRKARHVPGVVAVRDRLSYPDVYPVVAGPVF* |
| Ga0116217_108674901 | 3300009700 | Peatlands Soil | TAALGHHIVGKVRHVQGVVAVRDQLSYPDVYPIVAGPVL* |
| Ga0099796_103229482 | 3300010159 | Vadose Zone Soil | MEGIPETAALGHALIRKARHVPGVVAVRDRLSYPDIYPVVASPVF* |
| Ga0074044_100912161 | 3300010343 | Bog Forest Soil | AALGHHIVDKVRDIQGVVAVRDQLSYPDVYPIVAGPVL* |
| Ga0134125_102686121 | 3300010371 | Terrestrial Soil | GTPETAALGQALIRKARHVPGVVAVRDRLSYPDTYPVVAGPVF* |
| Ga0134128_109201022 | 3300010373 | Terrestrial Soil | GSPETAALGHDIVRKIRHVPGVVAVHDQLSYPDTYPIVAGPVF* |
| Ga0136449_1009511402 | 3300010379 | Peatlands Soil | VTVAGSPETAALGHHIVGKVRHVQGVVAVRDQLSYPDVYPIVAGPVL* |
| Ga0136449_1021628781 | 3300010379 | Peatlands Soil | LQGSPETAALGHHIVRKIRHVQGVVAVRDSLSYPEVYPIVAGPVL* |
| Ga0136449_1027394592 | 3300010379 | Peatlands Soil | ETAALGHHIVHKVQHVQGVVAVRDHLSYPDVYPIVAGPVL* |
| Ga0134122_129921371 | 3300010400 | Terrestrial Soil | ETAALGHDIVRKIRHVPGVVAVHDQLSYPDTYPIVAGPVF* |
| Ga0126345_10601461 | 3300010858 | Boreal Forest Soil | TMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDIYPVVAGPVF* |
| Ga0126361_106184161 | 3300010876 | Boreal Forest Soil | ALGHDIVRKIRHVQGVVAVRDRLSYPDAYPIVAGPLC* |
| Ga0138599_10301361 | 3300011068 | Peatlands Soil | HHIVHKVQHVQGVVAVRDHLSYPDVYPIVAGPVL* |
| Ga0138560_11795031 | 3300011083 | Peatlands Soil | PETAALGHHIVHKVQHVQGVVAVRDHLSYPDVYPIVAGPVL* |
| Ga0137375_112763771 | 3300012360 | Vadose Zone Soil | LGRALIRKARHVPGVVAVRDRLSYPDIYPVVAGPVF* |
| Ga0164301_102501342 | 3300012960 | Soil | HDIVRKIRHVPGLVAVHDQLGYPDTYPIVAGPVF* |
| Ga0157374_122767141 | 3300013296 | Miscanthus Rhizosphere | GVVTVQGSPETAALGHDIVRKIRHVPGLVAVHDQLGYPDTYPIVAGPVF* |
| Ga0181538_102027682 | 3300014162 | Bog | PETAALGHHIVHKVQHVEGVVAVRDHLSYPDVYPIVAGPVL* |
| Ga0157379_105375812 | 3300014968 | Switchgrass Rhizosphere | AALGHDIVRKIRHVPGVVAVHQLSYPDTYPIVAGPVF* |
| Ga0132257_1022624161 | 3300015373 | Arabidopsis Rhizosphere | TPETAAFGRSLVRKARHVPGVVAVRDRLAYSDDYPVVAGPVL* |
| Ga0187879_107449661 | 3300017946 | Peatland | SLGQDLVRKIRHVQGVVAVRDRLSYPEAFPIVAGPLF |
| Ga0187777_102748851 | 3300017974 | Tropical Peatland | AAALGHALVRKARHVPGVVAVRDRLTYPDTTPVVAGPVS |
| Ga0187815_100958281 | 3300018001 | Freshwater Sediment | LGHHIVGKVRHVQGVVAVRDQLSYPDVYPIVAGPVL |
| Ga0187805_105918692 | 3300018007 | Freshwater Sediment | VEDGVVTLAGSPETAALGHHIVGKVRHVQGVVAVRDQLSYPDVYPIVAGPVL |
| Ga0187863_102496292 | 3300018034 | Peatland | SLGQDLVRKIRHVQGVVAVRDRLSYPEVFPIVAGPIF |
| Ga0187855_106569842 | 3300018038 | Peatland | GHDLVEKVRHVQGVVAVRDRLSYPDAFPVVVGPVF |
| Ga0187769_103097182 | 3300018086 | Tropical Peatland | GRDLVRKARHVPGVVAVRDRLTYPDTYPVASGPLS |
| Ga0213881_101508022 | 3300021374 | Exposed Rock | GRALVRKARHVPGVVAVRDRLSYSDDYPIAAGPVF |
| Ga0213875_106672891 | 3300021388 | Plant Roots | EGTPETAALGHHLMHRARHVAGVVAVRDRLSYPDTYPIVAGPQF |
| Ga0210397_102463211 | 3300021403 | Soil | GVVTVQGSPETAALGHDIVRKIRHVPGVVAVHDQLSYPDTYPIVAGRVF |
| Ga0210389_107573352 | 3300021404 | Soil | QGSPETAALGHDIARKIRHVPGVVAVHDQLSYPDTYPIVAGPVF |
| Ga0210392_105827982 | 3300021475 | Soil | VVTLEGNAETAALGHVIVRKVRHVQGVVAVRDRLTYPDVYASIAGPDSDPAIGRPR |
| Ga0242670_10389201 | 3300022708 | Soil | ALGHALVRKARHVPGVVAVRDRLTYPDNYPVVAGPVF |
| Ga0242672_10360001 | 3300022720 | Soil | ATAALGHDMVRRIRHVQGVVAVRDRLSYPDGYPIVAGPVF |
| Ga0247692_10814622 | 3300024279 | Soil | AALGHALIRKARHVPGVVAVRDRLSYPDTYPVVAGPVF |
| Ga0207685_108209793 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | TMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDIYPVVAGPVF |
| Ga0207654_104018902 | 3300025911 | Corn Rhizosphere | TVESGVVTMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDTYPVVAGPVF |
| Ga0207663_100180783 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | EGTPETAAFGRALIRKVRHVPGVVAVRDRLSYSDVYPVVAGPVF |
| Ga0207663_108666241 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | EGIPETAALGRALVRKARHIRGVVAVRDRLSHPVVAGPVF |
| Ga0207694_101392371 | 3300025924 | Corn Rhizosphere | ESGVVTMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDTHPVVAGPVF |
| Ga0207700_100332551 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | TMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDTHPVVAGPVF |
| Ga0207700_104211121 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | EGTPETAALGHALIRKARHVPGVVAVRDRLSYPDAYPVVAEPVF |
| Ga0207700_112928522 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GVVTLEGTPETAALGRSLVRKARHVPGVVAVRDRLSYSDDYPIVAGPVF |
| Ga0207664_103587231 | 3300025929 | Agricultural Soil | PETAAFGRALIRKVRHVPGVVAVRDRLSYQDVYPVVAGPVF |
| Ga0207669_108931202 | 3300025937 | Miscanthus Rhizosphere | TVESGVVTMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDTHPVVAGPVF |
| Ga0207665_102028322 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ALGHALIRKARHVPGVVAVRDRLSYPDTYPVVAGPVF |
| Ga0207665_112825662 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | SGVVTMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDTYPVVAGPVF |
| Ga0207689_111217432 | 3300025942 | Miscanthus Rhizosphere | TMEGTPETAALGHALIRKARHVPGVVAVRDRLSYPDTYPVVAGPVF |
| Ga0207678_117024512 | 3300026067 | Corn Rhizosphere | TVIVEDGVVTLEGIPETVALGRALVRKARHIRGVVAVRDRLSHPVVAGPVF |
| Ga0207698_121580501 | 3300026142 | Corn Rhizosphere | GSPETAALGHDIVRKIRHVPGVVAVHDQLGYPDIYPIVAGPVF |
| Ga0209577_104432471 | 3300026552 | Soil | PETAAFGRALIRKARHVPGVVAVRDRLSYPDVYPVVAGPVF |
| Ga0209069_109103132 | 3300027915 | Watersheds | MEGCPETAALGRDLVRKARHVPGVVAVLDRLSYPDSYPVVGAPLS |
| Ga0307309_101461651 | 3300028714 | Soil | EGTPETAALGHTLIRKARHVPGVVAVRDRLSYPDVYPVVAGPVFGAGFS |
| Ga0307312_100693803 | 3300028828 | Soil | GRTLIRKARHVPGVVAVRDRLSYPDIYPVVAGPVL |
| Ga0074026_110663451 | 3300031035 | Soil | FQAGVVTLEGRPETAALGHDMVRRVRRVQGVVAVRDRLSYPDAYPVVAGPVSLTR |
| Ga0318516_100323891 | 3300031543 | Soil | SGVVTMEGCPETAALGRALVRKARHVRGVVAVRDRFTYPDTYPVVAGPVF |
| Ga0318571_103764021 | 3300031549 | Soil | GHALVRKARHVPGVVAVRDRLTYPDTSPVVAGPVF |
| Ga0318542_100770811 | 3300031668 | Soil | SGVVTMEGCPETAALGHALVRKARHVPGVVAVRDRLTYPDNYSIVSGPVF |
| Ga0306917_104045672 | 3300031719 | Soil | TMEGTPETAALGHALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVL |
| Ga0306918_107401382 | 3300031744 | Soil | LGRALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVV |
| Ga0318509_105719002 | 3300031768 | Soil | AALGRALVRKARHVPGVVAVRDRLTYPDTSPVVAGPVF |
| Ga0318546_107850961 | 3300031771 | Soil | SGVVTMEGCPETAALGRALVRKARHVPGVVAVRDRLTYPDTSPVVAGPVF |
| Ga0318546_110027981 | 3300031771 | Soil | PETAALGHALVRKARHVPGVVAVRDRLTYPDTYPIVAGPVF |
| Ga0318499_100102583 | 3300031832 | Soil | VVTMEGCPETAALGHALVRKARHVPGVVAVRDRLTYPDNYSIVSGPVF |
| Ga0310917_107392291 | 3300031833 | Soil | PETAALGHALVRKARHVPGVVAVRDRLTYPDNYSIVSGPVF |
| Ga0306925_108288922 | 3300031890 | Soil | VTMEGCPETAALGHALVRKARHVPGVVAVRDRLTYPDNYSIVSGPVF |
| Ga0306925_117553702 | 3300031890 | Soil | GHALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVL |
| Ga0306921_106624932 | 3300031912 | Soil | GTPETAALGHALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVL |
| Ga0310912_109964822 | 3300031941 | Soil | MEGTPETAALGHALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVL |
| Ga0310916_101865322 | 3300031942 | Soil | GCPETAALGHALVRKARHVPGVVAVRDRLTYPDNYSIVSGPVF |
| Ga0310910_110926501 | 3300031946 | Soil | AALGHALVRKARHVPGVVAVRDRLTYPDTYPIVAGPVF |
| Ga0318549_103073581 | 3300032041 | Soil | TMEGTPETAALGRALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVF |
| Ga0318575_100192841 | 3300032055 | Soil | CPETAALGHALVRKARHVPGVVAVRDRLTYPDNYSIVSGPVF |
| Ga0318575_100596111 | 3300032055 | Soil | RGNPETTELGHEIVRKVRHVPGVVAVRDRLSYPDDAPVAAAPLF |
| Ga0318504_100738622 | 3300032063 | Soil | VVTMEGCPETAALGHALVRKARHVPGVVAVRDRLTYPDTYPIVAGPVF |
| Ga0318514_101291151 | 3300032066 | Soil | EGTPETAALGHALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVL |
| Ga0318518_101635701 | 3300032090 | Soil | GHALVRKARHVPGVVAVRDRLTYPDNYSIVSGPVF |
| Ga0311301_113777541 | 3300032160 | Peatlands Soil | LGHHIVHKVQHVQGVVAVRDHLSYPDVYPIVAGPVL |
| Ga0306920_1040995222 | 3300032261 | Soil | VTMEGCPETAALGRALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVV |
| Ga0335085_109867231 | 3300032770 | Soil | VVTLQGKPETAALGHEIVRKVRHVPGVVAVRDRLSYPDESPVVAAPLF |
| Ga0335082_100830203 | 3300032782 | Soil | EAGVVTLEGSPETTALGREIVRRVRHVPGVVAVRDRLSYPDDSPVVAAPLF |
| Ga0335079_100378295 | 3300032783 | Soil | VVTMEGTPETAALGRALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVF |
| Ga0335078_111697722 | 3300032805 | Soil | PETAAFGRALIRKVRHVPGVVAVRDRLSYSDVYPVVAGPVF |
| Ga0335078_120477141 | 3300032805 | Soil | SGVVTMEGCPETTALGRALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVF |
| Ga0335070_113145971 | 3300032829 | Soil | ESGVVTMEGCPETAALGHALVRKARHVPGVVAVRDRFTYPDTYPVVAGPVL |
| Ga0335072_105805001 | 3300032898 | Soil | ESGVVTMEGTPETAALGRALVRKARHVPGVVAVRDRLTYPDTYPVVAGPVL |
| Ga0335073_107806783 | 3300033134 | Soil | TVESGVVTLEGTPETAAFGHALIRKVRHVPGVVAVRDRLSYPDVYPVVAGPVF |
| ⦗Top⦘ |