| Basic Information | |
|---|---|
| Family ID | F092546 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VLSEVQYRCVGRYREAVIVLLLTVLAFSVRLYRVDFNSLSEDEVA |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.07 % |
| % of genes from short scaffolds (< 2000 bps) | 91.59 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.374 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (15.888 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.776 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.991 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.90% β-sheet: 0.00% Coil/Unstructured: 41.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF00535 | Glycos_transf_2 | 22.43 |
| PF00196 | GerE | 0.93 |
| PF02954 | HTH_8 | 0.93 |
| PF13492 | GAF_3 | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.37 % |
| Unclassified | root | N/A | 19.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10073496 | Not Available | 1670 | Open in IMG/M |
| 3300000567|JGI12270J11330_10187015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300000650|AP72_2010_repI_A1DRAFT_1017121 | Not Available | 611 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1057557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300004091|Ga0062387_101236200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300004152|Ga0062386_101007971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300004152|Ga0062386_101735860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300005332|Ga0066388_108448219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300005435|Ga0070714_101266621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300005439|Ga0070711_100298763 | Not Available | 1280 | Open in IMG/M |
| 3300005439|Ga0070711_101737682 | Not Available | 547 | Open in IMG/M |
| 3300005466|Ga0070685_10132948 | Not Available | 1558 | Open in IMG/M |
| 3300005841|Ga0068863_100073211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3241 | Open in IMG/M |
| 3300006028|Ga0070717_11675373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300006052|Ga0075029_100359578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 939 | Open in IMG/M |
| 3300006052|Ga0075029_100581238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 747 | Open in IMG/M |
| 3300006086|Ga0075019_10065277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2062 | Open in IMG/M |
| 3300006086|Ga0075019_10268405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1021 | Open in IMG/M |
| 3300006102|Ga0075015_100782432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300006162|Ga0075030_100261971 | Not Available | 1385 | Open in IMG/M |
| 3300006162|Ga0075030_101131059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300006174|Ga0075014_100079359 | Not Available | 1485 | Open in IMG/M |
| 3300006914|Ga0075436_101516332 | Not Available | 509 | Open in IMG/M |
| 3300009521|Ga0116222_1033614 | Not Available | 2266 | Open in IMG/M |
| 3300009521|Ga0116222_1256643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300009521|Ga0116222_1383374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300009525|Ga0116220_10542243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300009624|Ga0116105_1025566 | Not Available | 1261 | Open in IMG/M |
| 3300009629|Ga0116119_1018880 | Not Available | 1927 | Open in IMG/M |
| 3300009637|Ga0116118_1223262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300009646|Ga0116132_1050380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1340 | Open in IMG/M |
| 3300009759|Ga0116101_1008136 | Not Available | 1846 | Open in IMG/M |
| 3300009824|Ga0116219_10711498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300009839|Ga0116223_10419694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
| 3300009839|Ga0116223_10530219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300010339|Ga0074046_10004525 | All Organisms → cellular organisms → Bacteria | 11330 | Open in IMG/M |
| 3300010339|Ga0074046_10387025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 846 | Open in IMG/M |
| 3300010339|Ga0074046_10538540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300010341|Ga0074045_10618098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300010343|Ga0074044_10624500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300010358|Ga0126370_11429308 | Not Available | 654 | Open in IMG/M |
| 3300010379|Ga0136449_101878260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 891 | Open in IMG/M |
| 3300010379|Ga0136449_102238625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
| 3300012960|Ga0164301_10155175 | Not Available | 1405 | Open in IMG/M |
| 3300014156|Ga0181518_10317494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| 3300014156|Ga0181518_10412202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300014162|Ga0181538_10616448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300014164|Ga0181532_10787082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300014498|Ga0182019_10979726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300015371|Ga0132258_10636069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2682 | Open in IMG/M |
| 3300015374|Ga0132255_103511439 | Not Available | 667 | Open in IMG/M |
| 3300016319|Ga0182033_11824235 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300017822|Ga0187802_10437575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300017823|Ga0187818_10300161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300017928|Ga0187806_1116369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 864 | Open in IMG/M |
| 3300017928|Ga0187806_1384061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300017934|Ga0187803_10233161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300017936|Ga0187821_10240162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300017943|Ga0187819_10190326 | Not Available | 1213 | Open in IMG/M |
| 3300017943|Ga0187819_10836412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300017955|Ga0187817_10292982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1038 | Open in IMG/M |
| 3300017975|Ga0187782_10425312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1011 | Open in IMG/M |
| 3300017995|Ga0187816_10091032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1305 | Open in IMG/M |
| 3300018006|Ga0187804_10227647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
| 3300018007|Ga0187805_10186800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 945 | Open in IMG/M |
| 3300018008|Ga0187888_1316271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300018012|Ga0187810_10143424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 956 | Open in IMG/M |
| 3300018012|Ga0187810_10172043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300018013|Ga0187873_1173901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 814 | Open in IMG/M |
| 3300018020|Ga0187861_10134730 | Not Available | 1154 | Open in IMG/M |
| 3300018026|Ga0187857_10531238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300018030|Ga0187869_10471110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300018057|Ga0187858_10523578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300018062|Ga0187784_11386184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300018085|Ga0187772_10438475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 914 | Open in IMG/M |
| 3300021403|Ga0210397_10154516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1606 | Open in IMG/M |
| 3300021406|Ga0210386_11811723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300021444|Ga0213878_10196493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 848 | Open in IMG/M |
| 3300021479|Ga0210410_10030499 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4673 | Open in IMG/M |
| 3300025915|Ga0207693_11336754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300025941|Ga0207711_10297379 | Not Available | 1488 | Open in IMG/M |
| 3300025981|Ga0207640_10750383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
| 3300026035|Ga0207703_11929013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300027073|Ga0208366_1004468 | Not Available | 1354 | Open in IMG/M |
| 3300027516|Ga0207761_1055744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 767 | Open in IMG/M |
| 3300027783|Ga0209448_10003209 | All Organisms → cellular organisms → Bacteria | 5051 | Open in IMG/M |
| 3300027812|Ga0209656_10361237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300027824|Ga0209040_10232151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 936 | Open in IMG/M |
| 3300027824|Ga0209040_10358185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300027825|Ga0209039_10319811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300027905|Ga0209415_10553075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
| 3300027905|Ga0209415_10723257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300027911|Ga0209698_10668544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300030659|Ga0316363_10365256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300030688|Ga0311345_10473596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1088 | Open in IMG/M |
| 3300030706|Ga0310039_10184638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300030706|Ga0310039_10293912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300030707|Ga0310038_10396549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300031446|Ga0170820_17376275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1001 | Open in IMG/M |
| 3300031942|Ga0310916_11502990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300032180|Ga0307471_101837714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300032770|Ga0335085_12531403 | Not Available | 508 | Open in IMG/M |
| 3300032805|Ga0335078_11895916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300032892|Ga0335081_12325470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300032893|Ga0335069_10255020 | Not Available | 2107 | Open in IMG/M |
| 3300032893|Ga0335069_11087039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 882 | Open in IMG/M |
| 3300033561|Ga0371490_1010643 | All Organisms → cellular organisms → Bacteria | 3392 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 15.89% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 13.08% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 8.41% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 7.48% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.61% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.67% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 4.67% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.93% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000650 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A1 | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100734961 | 3300000567 | Peatlands Soil | VPSEHQYRCVGRYREAVIVFLLTVLAFSVRIYRVDFNSLSEDEVAKWAAVQEYRHG |
| JGI12270J11330_101870151 | 3300000567 | Peatlands Soil | VLTDVQFRCVGRYREALLVLLLTALALSVRLYRVDFNSLSEDE |
| AP72_2010_repI_A1DRAFT_10171212 | 3300000650 | Forest Soil | VLNQIRHRRLENYRKSAIVLLLTVLAFGVRVHRVDFNSLS |
| AP72_2010_repI_A001DRAFT_10575572 | 3300000893 | Forest Soil | VLSENQCRCLGRYREPAIVLLLTVIAFAVRLYHVDFNSLSEDESAK |
| Ga0062387_1012362001 | 3300004091 | Bog Forest Soil | VLSEVQYRWVGRHREAVIVLLLTVLAFSVRLYRVDFNSLSEDE |
| Ga0062386_1010079712 | 3300004152 | Bog Forest Soil | VLSEVQCRCLGRYREPAIVLLLTILAFAVRMYRVDFNSLSEDE |
| Ga0062386_1017358603 | 3300004152 | Bog Forest Soil | LTEIPDRPFGQYRELGIVLLLTVLAFAVRLYRVDFNSLSEDESAKWAAVQEY |
| Ga0066388_1084482191 | 3300005332 | Tropical Forest Soil | VLSERQYRWAGRYWEAGIVIVLTIAAFGFRFDRVDFNSLSEDESAKWAAVQ |
| Ga0070714_1012666212 | 3300005435 | Agricultural Soil | VLSELQYRCLRRYREPAIVLLLTLLAFAIRVYRVDFNSLSEDESAKWAAVQEYRHG |
| Ga0070711_1002987632 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSELQYRCLGRYRELAIVFLLTLLAFAVRVYRVDFNSLSEDESAKW |
| Ga0070711_1017376821 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSEVQYRWLGRYRELAIVLLLTVLAFAVRVYRVDFNSLSEDESAKW |
| Ga0070685_101329481 | 3300005466 | Switchgrass Rhizosphere | VLSELQYRWVGRHREAVILLMLTVLAFSVRFYRVDFNSLSEDEVAKW |
| Ga0068863_1000732111 | 3300005841 | Switchgrass Rhizosphere | VLSEVPYRCLGRYREPAIVLLLTVLAFAVRVYRVDFNSLSEDESAKWTAIQEYRHGHF |
| Ga0070717_116753732 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSEVQYRFLRRYREPAIVLLLTLLAFAVRVYRVDFNSLSEDESAKWAAVQEYR |
| Ga0075029_1003595781 | 3300006052 | Watersheds | VLSEVQNRWVGRYREAVIVLLLTVLAFSVRLYRVDFNSLSEDEVAKWAAVQEYRHGHF |
| Ga0075029_1005812382 | 3300006052 | Watersheds | VTSDVQYRCVGRYREAVILLLLTVLAFSVRLYRVDFNS |
| Ga0075019_100652775 | 3300006086 | Watersheds | VLSEVQYRCLGRYREPAIVLLLTVLAFAVRAYRVDFNSLSEDEVAKWAAVQEYRH |
| Ga0075019_102684053 | 3300006086 | Watersheds | VLSEVQNRWVGRHREAVIVLLLTVLAFSVRLYHVDFNSLSEDEVAKWTAVQEYR |
| Ga0075015_1007824321 | 3300006102 | Watersheds | MSEVQYRCVGRYREAVVVLLLTVLAFSVRLYRVDFNSLSEDEVAK |
| Ga0075030_1002619713 | 3300006162 | Watersheds | VLSEVQYRWLGRYREPAIVLLLTVLAFAVRVYRVDFNSLSEDESAKWTAVQEYRHGH |
| Ga0075030_1011310592 | 3300006162 | Watersheds | VLTEIQSRYIGRYREAVIVLLLTVLALSARLYRVDFNSLSEDEVAKWAA |
| Ga0075014_1000793593 | 3300006174 | Watersheds | VLSEVQYRCLGRYRERAIVLLLTVLAFAVRAYRVDFNSLSEDEVAKWAAVQEYR |
| Ga0075436_1015163321 | 3300006914 | Populus Rhizosphere | VLSETPDRRLGHYWELGIVLLLTLLAFSIRVYRVDFNSLSE |
| Ga0116222_10336141 | 3300009521 | Peatlands Soil | VLSEVQYRCLARNRERGIVLLLTFLRFAVRLYGVDFTSLSGAG |
| Ga0116222_12566431 | 3300009521 | Peatlands Soil | VLSAVQFRYLGRYREPAIVLLLTILAFSVRLYHVDFNSLSEDEVANGWPCK |
| Ga0116222_13833742 | 3300009521 | Peatlands Soil | VLSEVQYRWVGRYREAVIVLLMTVLAFSVRLYRVDFNSLSE |
| Ga0116220_105422431 | 3300009525 | Peatlands Soil | VLSEVQYRCLGRYREPAIVLLLTVLAFAVRLYWVDFNSLSEDESAKWA |
| Ga0116105_10255663 | 3300009624 | Peatland | VLSEVQYRCVGWYREAVIVLLLTVLAFSVRLYRVDFNSLS |
| Ga0116119_10188801 | 3300009629 | Peatland | VLTEIQYRRVGQYREAVIVLLLTVLAFSVRLYRVD |
| Ga0116118_12232621 | 3300009637 | Peatland | VLSEVQYRCVGRHREAVIVLLLTVLAFSIRLYRVDF |
| Ga0116132_10503803 | 3300009646 | Peatland | VLSEVQYRCVGRYREAVIVLLLTVLAFSVRLYRVDFNSLSEDEVAKWAAVQ |
| Ga0116101_10081365 | 3300009759 | Peatland | VLSEIQYRCDDRYREAVIVLLLTVLAFSVRLYRVDFNSLSEDEVAKW |
| Ga0116219_107114981 | 3300009824 | Peatlands Soil | VLSEVQYRWVGRHREAVIVILLTVLAFSVRLYRVDFNSLSEDE |
| Ga0116223_104196941 | 3300009839 | Peatlands Soil | VLSEVQYRCVGRHREAVIVLLLTVLAFSVRLYRVDFNSLSE |
| Ga0116223_105302192 | 3300009839 | Peatlands Soil | VPSEHQYRCVGRYREAVIVFLLTVLAFSVRLYRVDFNSLS |
| Ga0074046_1000452514 | 3300010339 | Bog Forest Soil | VLTEIPDRPFGQYRELGIVLLLTVLAFAVRLYRVDFNSLSEDESAKWAAVQEYRH |
| Ga0074046_103870252 | 3300010339 | Bog Forest Soil | VLSEIQYRCVGRYREAVIVLLLTVLAFSVRLYRVDFNSLSEDEVAKWAAVQ |
| Ga0074046_105385402 | 3300010339 | Bog Forest Soil | VLSEVQYRCVGRYREAVIVLLLTVLAFSVRLYRVDFNSLSE |
| Ga0074045_106180982 | 3300010341 | Bog Forest Soil | VLSEVQYRCVGRYREAVIVLLLTVLAFSVRLYRVDFNSLSEDEVA |
| Ga0074044_106245001 | 3300010343 | Bog Forest Soil | VLNAVQYRCLGRYREPAIVLLLTVLAFAVRVHRVDFNSLSEDESAKWTA |
| Ga0126370_114293083 | 3300010358 | Tropical Forest Soil | VLKEVSYRCLACHREPAIALLLMVLAFAVRVQRVDFNSLSEDES |
| Ga0136449_1018782603 | 3300010379 | Peatlands Soil | VLSEVQYRWVGRHREAVIVLLLTVLAFSVRLYRVDFNSLSEDEVAKWAAVQEY |
| Ga0136449_1022386251 | 3300010379 | Peatlands Soil | VLSEVQYRCVGWYREAVIVLLLTVLAFSVRLYRVDFNSLSEDEVAKW |
| Ga0164301_101551752 | 3300012960 | Soil | VLSEVQYRWFGRYREAVIVLLLTVLAFSVRLYHVDFNSL |
| Ga0181518_103174943 | 3300014156 | Bog | VLSEVQYRCVGRHREAVIVLLLTVLAFSIRLYRVDFNSLSE |
| Ga0181518_104122021 | 3300014156 | Bog | VLSEVQYRWVGRYREAVIVLLLTVLAFSVRLYRVDFNSLSEDE |
| Ga0181538_106164481 | 3300014162 | Bog | VLSEVQYRCVGRYREAVIVLLLTVLAFSVRLYRVD |
| Ga0181532_107870823 | 3300014164 | Bog | VLSEVQYRWVGRYREAVIVLLLTVLAFSVRLYRVDFNSLSEDEVAKWTAV |
| Ga0182019_109797262 | 3300014498 | Fen | VLTEVQYRWVGRYREAVIVLLLTVLAFSVRLYRVDFN |
| Ga0132258_106360694 | 3300015371 | Arabidopsis Rhizosphere | VLSEVQYRCLGRYRELASVLLLTLLAFAVRVYRVDFNSLSEDESA |
| Ga0132255_1035114391 | 3300015374 | Arabidopsis Rhizosphere | VLSEIPDRRLRHYWEVGIVLLLTVLAFSVRVYRVDFNSLSEDEVAKWVAVQE* |
| Ga0182033_118242351 | 3300016319 | Soil | VLSAAQNRSFSWHREAAIALLLGFLAFAIRVYRVDFNSLSEDEVAKWAAVQ |
| Ga0187802_104375751 | 3300017822 | Freshwater Sediment | VLSEVQYRSHGWYREPAIVLLLTVLAFSVRLYRVDFNSLSEDEVAKWAAV |
| Ga0187818_103001611 | 3300017823 | Freshwater Sediment | VLSEVQYRWVGRHREAVIVLLLTVLAFSVRLYRVDFNSLSE |
| Ga0187806_11163693 | 3300017928 | Freshwater Sediment | VLSEFQYRWVGRYREALIVLALTILSLSVRLYHVDFNSLSEDEVA |
| Ga0187806_13840611 | 3300017928 | Freshwater Sediment | VLSEIQYRWVGRYREAVIVLLLTVLAFSVRLYHVDFNSLSEDEVAKW |
| Ga0187803_102331611 | 3300017934 | Freshwater Sediment | VLSEVQYRWVGRHREAVIVLLLTVLAFSVRLYRVDFNSLSEDEVAKW |
| Ga0187821_102401622 | 3300017936 | Freshwater Sediment | VLAEFQYRCVGRYREAVILLFLTVLAFSVRAYQVDFNSLS |
| Ga0187819_101903262 | 3300017943 | Freshwater Sediment | MLTDVRYRWFGRYREAVFVILLTVLAFSVRLYRVDFNSLS |
| Ga0187819_108364121 | 3300017943 | Freshwater Sediment | VLSEVQYRCVGRHREAVIVLLLTVLAFSVRLYRVDFNSLSEDEV |
| Ga0187817_102929823 | 3300017955 | Freshwater Sediment | VLSEVQYRCVGRYREAVIVLLLTVLAFSVRLYRVDFNSLSEDEVAKWAAVQEYR |
| Ga0187782_104253121 | 3300017975 | Tropical Peatland | VLSEAQSRWIGQHREAAIVLLLTFLAFSVRLYQVDFNSLSEDEVAKWAAVQEYRHG |
| Ga0187816_100910321 | 3300017995 | Freshwater Sediment | VLSEFQYRWVGRYREALIVLALTILSLSVRLYHVDFNSLSEDE |
| Ga0187804_102276473 | 3300018006 | Freshwater Sediment | VLSEIPDRRPGHYWEVGIVLLLTVLAFSVRLYRVDFNSLSEDEVAKWAAVQ |
| Ga0187805_101868001 | 3300018007 | Freshwater Sediment | VLSEVQYRWLGRYREPAIVLLLTVLAFAVRVYRVDFNSLSEDESAKWAAV |
| Ga0187888_13162712 | 3300018008 | Peatland | VLSDVQYRCVGRYREAVIVLLLTVLAFSVRLYRVDFN |
| Ga0187810_101434243 | 3300018012 | Freshwater Sediment | VLSEIPDRRPGHYWEVGIVLLLTVLAFSVRLYRVDFNSLSEDEVAKWAAVQEYRH |
| Ga0187810_101720431 | 3300018012 | Freshwater Sediment | VLSEVQYRCVGRYREAVIVLLLTVLALSVRLYRVDFNSLSEDEVAK |
| Ga0187873_11739011 | 3300018013 | Peatland | VLSEVQYRCVGRYREAAIVLLLTVLAFSVRLYRVDFNSLSEDEVAKWT |
| Ga0187861_101347301 | 3300018020 | Peatland | VLSDVQYRCVGRYRKAVIVLLLTVLAFSVRLYRVDFNSLSE |
| Ga0187857_105312381 | 3300018026 | Peatland | VLSEVQYRCVGRHREAVIVLLLTVLAFSIRLYRVDFNSLSEDEVAKWAAVQEYRHGRF |
| Ga0187869_104711102 | 3300018030 | Peatland | VLSDVQYRCVGRYREAVIVLLLTVLAFSVRLYRVDFNSLSDDEVAKWAAVQVYR |
| Ga0187858_105235783 | 3300018057 | Peatland | VLSEVQYRCVGRHREAVIVLLLTVLAFSIRLYRVDFNSLSEDEVAKWAAVQ |
| Ga0187784_113861841 | 3300018062 | Tropical Peatland | VLSEIQYRCVGRYRELAIVLLLTVLAFSVRVYHVDFNSLSEDEVAKWAAVQEYR |
| Ga0187772_104384752 | 3300018085 | Tropical Peatland | VLSEVQYRWAGRYREAATVLLLTVLAFSVRLYRVDFNSLSEDEVAKWTAIQE |
| Ga0210397_101545163 | 3300021403 | Soil | VLSGLQFRCLGRYRELAIVFLLTVLAFAVRVYRVDFNSLSE |
| Ga0210386_118117232 | 3300021406 | Soil | VLTELQSRYIGRYREAVIVLLLTVLALSARLYRVDFNSLSEDEV |
| Ga0213878_101964932 | 3300021444 | Bulk Soil | VLSAVQSRAVNWHREAAIAVLLAFLAFAIRVYRVDFNSLSEDEVAKWLAVQDYGR |
| Ga0210410_100304999 | 3300021479 | Soil | VLSGLQFRCLGRYRELAIVFLLTVLAFAVRVYRVDFN |
| Ga0207693_113367541 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VLSEFQYRFLGRYQELVIVVLLTILAFTVRVYRVDFNSLSEDEVAKWQAVQEYRQGH |
| Ga0207711_102973791 | 3300025941 | Switchgrass Rhizosphere | VLSEVQYRWVGRHREAVILLMLTVLAFSVRFYRVDFNSLSEDEVAKW |
| Ga0207640_107503831 | 3300025981 | Corn Rhizosphere | VLSEVQYRCAGRYREAVIVLLLTVLALSVRLYRVDFNSLSEDEVAKWSAV |
| Ga0207703_119290131 | 3300026035 | Switchgrass Rhizosphere | VLSEVQYRCVGRRREAVIVLLLTVLAFSVRLYRVDFNSLSEDEVAKWAAV |
| Ga0208366_10044683 | 3300027073 | Forest Soil | VLSEVQYRCVGRHREAVIVLLLTVLAFSVRLYRVDFNSL |
| Ga0207761_10557441 | 3300027516 | Tropical Forest Soil | VLSDFQYCGLRRYREAVIVLLLTVLAFAARFYRVDFNSLSEDESAKWAAVQEYR |
| Ga0209448_100032091 | 3300027783 | Bog Forest Soil | VLSEVQYRCVGRYREAVIVLLLTVLAFSVRLYRVDFNSLSEDEVAKWTAVQEYRHG |
| Ga0209656_103612372 | 3300027812 | Bog Forest Soil | VLTEIQNRCVGRYREAAIVLLLTVLAFSVRLYRVDFNSLSE |
| Ga0209040_102321512 | 3300027824 | Bog Forest Soil | VLSEVQHRWVGRYREAVILLLLTVLAFSVRLYRVDFNSLSEDEVAKWAAVQEYRHGHF |
| Ga0209040_103581851 | 3300027824 | Bog Forest Soil | VLSEIPYRRFGQYREIGIVLLLTVLAFGVRLYRVDFNSLSEDEVA |
| Ga0209039_103198111 | 3300027825 | Bog Forest Soil | VLSEIHNRCVGWYREAVIMLLLTVLAFAVRVYRVDFNSLSED |
| Ga0209415_105530751 | 3300027905 | Peatlands Soil | VLSEVQYRCVGRYREAVIVLLLTVLAFSVRLYRVDFNSLSEDEVAKWA |
| Ga0209415_107232573 | 3300027905 | Peatlands Soil | VTSEVQYRCVGRCREAVILLLLTVLAFSVRLYRVDFNSLSEDEVAK |
| Ga0209698_106685443 | 3300027911 | Watersheds | VLSEIPDRRLGHYWDVGIVLLLTVLAFSVRFYRVDFNS |
| Ga0316363_103652561 | 3300030659 | Peatlands Soil | VPSEHQYRCVGRYREAVIVFLLTVLAFSVRIYRVDFNSLSEDEVA |
| Ga0311345_104735961 | 3300030688 | Bog | VLNEFQYRCFGRYREAGIVVLLTVLALSVRLYRVDFNSLSEDEVTK |
| Ga0310039_101846383 | 3300030706 | Peatlands Soil | VLSEVQYRCVGRYREAVIVLLLTVLALSVRLYRVDFNSLSEDEVA |
| Ga0310039_102939122 | 3300030706 | Peatlands Soil | VLSEVQYRCVGRHREAVIVLLLTVLAFSVRLYRVDFNSLSEDEVAKW |
| Ga0310038_103965493 | 3300030707 | Peatlands Soil | VLSAVQFRYLGRYREPAIVLLLTILAFSVRLYHVDFNSLSED |
| Ga0170820_173762751 | 3300031446 | Forest Soil | VLNEFQYRCLGRYREPAIVLLLTLLAFAVRVYRVDFNSLSEDESAKWAAVQEYR |
| Ga0310916_115029901 | 3300031942 | Soil | VLSLLQNRSWRWHRDAAIVLLLTVLACAIRLNHVGFNSLSEDESAK |
| Ga0307471_1018377141 | 3300032180 | Hardwood Forest Soil | VLSGLQFRYLGRYRELAIVFLLTVLAFAVRVYRVDFNSLSEDESAKWAA |
| Ga0335085_125314033 | 3300032770 | Soil | VLSEIQYRCLGRYRDLALVLLLTVLALAVRIYRVDFNSLSED |
| Ga0335078_118959161 | 3300032805 | Soil | VLIEAQYRWFGRYRGAVIVFLLTVLAFSVRLYRVDFNSLSEDEVAKW |
| Ga0335081_123254702 | 3300032892 | Soil | VLSEFQYRWVGRYREAVIVLALTILSLSVRLYHVD |
| Ga0335069_102550204 | 3300032893 | Soil | VLTAVKSRWLARYREWVIVCFLMVLAFGVRVHRIDFNSLSEDESAKWAAIQEYS |
| Ga0335069_110870392 | 3300032893 | Soil | VLTSFKSRCQAKYREWVIVCFLMVLAFGVRVHRIDFNSLSEDESAKWAAIQEYS |
| Ga0371490_10106435 | 3300033561 | Peat Soil | VLSEVPYRCVGRYREAVIVLLLTVLALSVRLYRVDFNS |
| ⦗Top⦘ |