| Basic Information | |
|---|---|
| Family ID | F092517 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 43 residues |
| Representative Sequence | AAETVKRARHAPAATSYEAATDDALARLEAVTELKTAWHPVGA |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.46 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (57.944 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (26.168 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.037 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.140 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.99% β-sheet: 0.00% Coil/Unstructured: 69.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF04191 | PEMT | 9.35 |
| PF00248 | Aldo_ket_red | 6.54 |
| PF13556 | HTH_30 | 3.74 |
| PF00891 | Methyltransf_2 | 2.80 |
| PF13338 | AbiEi_4 | 2.80 |
| PF13460 | NAD_binding_10 | 1.87 |
| PF08592 | Anthrone_oxy | 1.87 |
| PF01872 | RibD_C | 1.87 |
| PF11706 | zf-CGNR | 1.87 |
| PF02653 | BPD_transp_2 | 0.93 |
| PF16864 | Dimerisation2 | 0.93 |
| PF07336 | ABATE | 0.93 |
| PF09286 | Pro-kuma_activ | 0.93 |
| PF08989 | DUF1896 | 0.93 |
| PF05988 | DUF899 | 0.93 |
| PF01048 | PNP_UDP_1 | 0.93 |
| PF07238 | PilZ | 0.93 |
| PF08818 | DUF1801 | 0.93 |
| PF01761 | DHQ_synthase | 0.93 |
| PF00155 | Aminotran_1_2 | 0.93 |
| PF08281 | Sigma70_r4_2 | 0.93 |
| PF02608 | Bmp | 0.93 |
| PF06224 | HTH_42 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.87 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.87 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.93 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.93 |
| COG1744 | Lipoprotein Med, regulator of KinD/Spo0A, PBP1-ABC superfamily, includes NupN | Signal transduction mechanisms [T] | 0.93 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.93 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.93 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.93 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.93 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG5516 | Uncharacterized conserved protein containing a Zn-ribbon-like motif, possibly RNA-binding | General function prediction only [R] | 0.93 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 57.94 % |
| Unclassified | root | N/A | 42.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_100091519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 861 | Open in IMG/M |
| 3300000956|JGI10216J12902_119566210 | Not Available | 648 | Open in IMG/M |
| 3300001538|A10PFW1_10300867 | Not Available | 587 | Open in IMG/M |
| 3300002568|C688J35102_120973095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3917 | Open in IMG/M |
| 3300003373|JGI25407J50210_10159502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 555 | Open in IMG/M |
| 3300004153|Ga0063455_100223571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
| 3300004157|Ga0062590_102563995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 541 | Open in IMG/M |
| 3300005166|Ga0066674_10404530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 632 | Open in IMG/M |
| 3300005180|Ga0066685_10767250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 656 | Open in IMG/M |
| 3300005329|Ga0070683_100783290 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300005345|Ga0070692_10493194 | Not Available | 792 | Open in IMG/M |
| 3300005347|Ga0070668_101899245 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005455|Ga0070663_102073647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 512 | Open in IMG/M |
| 3300005529|Ga0070741_10314385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1465 | Open in IMG/M |
| 3300005537|Ga0070730_10839858 | Not Available | 577 | Open in IMG/M |
| 3300005542|Ga0070732_10678881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 627 | Open in IMG/M |
| 3300005548|Ga0070665_101280638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 743 | Open in IMG/M |
| 3300006162|Ga0075030_100858645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 716 | Open in IMG/M |
| 3300006174|Ga0075014_100774776 | Not Available | 564 | Open in IMG/M |
| 3300006755|Ga0079222_11872503 | Not Available | 584 | Open in IMG/M |
| 3300006847|Ga0075431_100377985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1421 | Open in IMG/M |
| 3300006852|Ga0075433_10151385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2064 | Open in IMG/M |
| 3300006853|Ga0075420_101908670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300006871|Ga0075434_102590936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 508 | Open in IMG/M |
| 3300006893|Ga0073928_10126861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2093 | Open in IMG/M |
| 3300006893|Ga0073928_10500626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 871 | Open in IMG/M |
| 3300006904|Ga0075424_102197937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 581 | Open in IMG/M |
| 3300006954|Ga0079219_10728140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 761 | Open in IMG/M |
| 3300007076|Ga0075435_101297029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 638 | Open in IMG/M |
| 3300009522|Ga0116218_1159559 | Not Available | 1023 | Open in IMG/M |
| 3300009840|Ga0126313_10924539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 712 | Open in IMG/M |
| 3300010036|Ga0126305_10916288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300010044|Ga0126310_11293907 | Not Available | 589 | Open in IMG/M |
| 3300010396|Ga0134126_10699680 | Not Available | 1152 | Open in IMG/M |
| 3300010396|Ga0134126_10978736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 948 | Open in IMG/M |
| 3300010396|Ga0134126_11012757 | Not Available | 930 | Open in IMG/M |
| 3300010397|Ga0134124_11233946 | Not Available | 769 | Open in IMG/M |
| 3300010400|Ga0134122_12545204 | Not Available | 561 | Open in IMG/M |
| 3300012181|Ga0153922_1113482 | Not Available | 621 | Open in IMG/M |
| 3300012212|Ga0150985_110618280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 662 | Open in IMG/M |
| 3300012915|Ga0157302_10311671 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300012942|Ga0164242_10493219 | Not Available | 879 | Open in IMG/M |
| 3300012944|Ga0137410_11481644 | Not Available | 592 | Open in IMG/M |
| 3300012955|Ga0164298_10424586 | Not Available | 867 | Open in IMG/M |
| 3300012987|Ga0164307_10145408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1553 | Open in IMG/M |
| 3300012987|Ga0164307_11402157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 588 | Open in IMG/M |
| 3300012988|Ga0164306_10540412 | Not Available | 903 | Open in IMG/M |
| 3300012988|Ga0164306_10764996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 774 | Open in IMG/M |
| 3300012989|Ga0164305_11119516 | Not Available | 677 | Open in IMG/M |
| 3300015077|Ga0173483_10323720 | Not Available | 764 | Open in IMG/M |
| 3300015245|Ga0137409_11135200 | Not Available | 621 | Open in IMG/M |
| 3300015371|Ga0132258_10049195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 9629 | Open in IMG/M |
| 3300016294|Ga0182041_11828163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
| 3300016341|Ga0182035_12061417 | Not Available | 518 | Open in IMG/M |
| 3300017974|Ga0187777_10070413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2267 | Open in IMG/M |
| 3300018054|Ga0184621_10200581 | Not Available | 715 | Open in IMG/M |
| 3300018089|Ga0187774_11236916 | Not Available | 537 | Open in IMG/M |
| 3300018422|Ga0190265_10511768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1314 | Open in IMG/M |
| 3300018466|Ga0190268_11940895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
| 3300018910|Ga0193598_1021884 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300019377|Ga0190264_10030087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1963 | Open in IMG/M |
| 3300019377|Ga0190264_11384146 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300021388|Ga0213875_10554009 | Not Available | 554 | Open in IMG/M |
| 3300021403|Ga0210397_10609617 | Not Available | 835 | Open in IMG/M |
| 3300021403|Ga0210397_11095720 | Not Available | 619 | Open in IMG/M |
| 3300021477|Ga0210398_11104448 | Not Available | 630 | Open in IMG/M |
| 3300021560|Ga0126371_13514651 | Not Available | 529 | Open in IMG/M |
| 3300022756|Ga0222622_10057262 | All Organisms → cellular organisms → Bacteria | 2231 | Open in IMG/M |
| 3300025905|Ga0207685_10082633 | Not Available | 1333 | Open in IMG/M |
| 3300025917|Ga0207660_10920267 | Not Available | 713 | Open in IMG/M |
| 3300025933|Ga0207706_11363818 | Not Available | 583 | Open in IMG/M |
| 3300026067|Ga0207678_11736064 | Not Available | 547 | Open in IMG/M |
| 3300026078|Ga0207702_11923499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 583 | Open in IMG/M |
| 3300026323|Ga0209472_1106406 | Not Available | 1114 | Open in IMG/M |
| 3300027787|Ga0209074_10458209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 546 | Open in IMG/M |
| 3300028379|Ga0268266_11361165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 685 | Open in IMG/M |
| 3300028704|Ga0307321_1019912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1178 | Open in IMG/M |
| 3300028705|Ga0307276_10201966 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300028719|Ga0307301_10238561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
| 3300028721|Ga0307315_10239954 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300028721|Ga0307315_10300274 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300028771|Ga0307320_10326354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 611 | Open in IMG/M |
| 3300028775|Ga0302231_10516085 | Not Available | 506 | Open in IMG/M |
| 3300028799|Ga0307284_10417699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300028807|Ga0307305_10203913 | Not Available | 909 | Open in IMG/M |
| 3300028875|Ga0307289_10047788 | All Organisms → cellular organisms → Bacteria | 1708 | Open in IMG/M |
| 3300028875|Ga0307289_10345191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 613 | Open in IMG/M |
| 3300028875|Ga0307289_10389032 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300028878|Ga0307278_10233575 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300028880|Ga0307300_10071198 | Not Available | 1014 | Open in IMG/M |
| 3300028880|Ga0307300_10331191 | Not Available | 521 | Open in IMG/M |
| 3300028881|Ga0307277_10135187 | Not Available | 1063 | Open in IMG/M |
| 3300028885|Ga0307304_10174473 | Not Available | 908 | Open in IMG/M |
| 3300030503|Ga0311370_11501509 | Not Available | 705 | Open in IMG/M |
| 3300031234|Ga0302325_12558717 | Not Available | 607 | Open in IMG/M |
| 3300031546|Ga0318538_10716304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
| 3300031720|Ga0307469_12220402 | Not Available | 535 | Open in IMG/M |
| 3300031751|Ga0318494_10208885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1114 | Open in IMG/M |
| 3300031852|Ga0307410_11911573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 528 | Open in IMG/M |
| 3300031858|Ga0310892_10691371 | Not Available | 699 | Open in IMG/M |
| 3300031908|Ga0310900_10613235 | Not Available | 862 | Open in IMG/M |
| 3300031938|Ga0308175_100005083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 9304 | Open in IMG/M |
| 3300031938|Ga0308175_102899980 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300031995|Ga0307409_102591125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces chromofuscus | 536 | Open in IMG/M |
| 3300032089|Ga0318525_10255941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 900 | Open in IMG/M |
| 3300032828|Ga0335080_12266674 | Not Available | 520 | Open in IMG/M |
| 3300032955|Ga0335076_10875128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 780 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 26.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.74% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.80% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.80% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.80% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.87% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.87% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.87% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.87% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.93% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.93% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.93% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.93% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012942 | Miracle-Growth compost microbial communities from Emeryville, California, USA - Original compost - Miracle growth compost (MG) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018910 | Soil crust microbial communities from Colorado Plateau, Utah, USA - earlymid stage, 18 hrs after wetting v1 | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1000915192 | 3300000956 | Soil | TELDKLASETIKRTRHNSAATTYDEAVDNSLSRLEAVTELKTAWHPIGA* |
| JGI10216J12902_1195662101 | 3300000956 | Soil | DRLAAETVKRARHAAPARTYDAATDDALARLEAVTELKTAWHPIGA* |
| A10PFW1_103008671 | 3300001538 | Permafrost | PELSAELDRLAAETIKRVRHRAAAPSYDAAVADSLERIESVTELKTAWHPVGA* |
| C688J35102_1209730954 | 3300002568 | Soil | TELDKLASETIKRTRHSAAATSYDAAIADALNRLEAVTELKTAWHPIGA* |
| JGI25407J50210_101595022 | 3300003373 | Tabebuia Heterophylla Rhizosphere | RLAADSVTRVRHAAATTSYEAGVADALGRLEAVVELKTAWHPVGA* |
| Ga0063455_1002235714 | 3300004153 | Soil | LAAESVTRVRHSSPTTSYALATADNLARLEAVTELKTAWHPVGA* |
| Ga0062590_1025639952 | 3300004157 | Soil | LAAESVTRVRHTTASTDYTTATADPLSRLEALTELKTAWHPVGA* |
| Ga0066674_104045302 | 3300005166 | Soil | TELDKLASETIKRTRHGSPATTYDEAVAAALTRLEAVTELKTAWHPIGA* |
| Ga0066685_107672502 | 3300005180 | Soil | ELDRLAAETIKRVRHGAAATSYDEAVSDALSRIDALTELKTAWHPIGA* |
| Ga0070683_1007832901 | 3300005329 | Corn Rhizosphere | LDRLAAETVKRTRHGAAAGTYEAATDDALARLEAVTELKTAWHPIGA* |
| Ga0070692_104931941 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | LAAESVTRVRHTMASTGYAAATADPLSRLEALTELKTAWHPVGA* |
| Ga0070668_1018992451 | 3300005347 | Switchgrass Rhizosphere | ESVDRLASESVTRVRRAAPTRSYEAAIADALTRLEAVTELKTAWHPIGA* |
| Ga0070663_1020736471 | 3300005455 | Corn Rhizosphere | AAETVKRARHAPAATSYEAATDDALARLEAVTELKTAWHPVGA* |
| Ga0070741_103143851 | 3300005529 | Surface Soil | ADLDRLASETIKRVRHAHATRGYDTAVTDSLARIEAVTELKTAWHPVGA* |
| Ga0070730_108398582 | 3300005537 | Surface Soil | TELDKLAAETIKRVRHRVAATSYEDATGDALERLHAVTELKTAWHPVGA* |
| Ga0070732_106788812 | 3300005542 | Surface Soil | SETIKRARHPEAATSYEAAVADALERLEAVTELKTAWHPVGA* |
| Ga0070665_1012806383 | 3300005548 | Switchgrass Rhizosphere | ETIKRARHSAGATTYDEATGNALTRLEAVTELKTAWHPIGA* |
| Ga0075030_1008586452 | 3300006162 | Watersheds | ELGAELDRLGAETIKRVHHRRPAHTYDDAVADALERIEGVSELKTAWHPIGA* |
| Ga0075014_1007747762 | 3300006174 | Watersheds | HSVAATTYEAATDDALERIEAVTELKTAWHPVGA* |
| Ga0079222_118725032 | 3300006755 | Agricultural Soil | VRHGAAATGYEDATGDALERLEAVTELKTAWHPVGA* |
| Ga0075431_1003779851 | 3300006847 | Populus Rhizosphere | AESVTRVRHADPTRSYALATSDALARLEAVTELKTAWHPVGA* |
| Ga0075433_101513851 | 3300006852 | Populus Rhizosphere | AESVTRVRHTDAPNDYAAATADPLSRLEALTELKTAWHPVGA* |
| Ga0075420_1019086702 | 3300006853 | Populus Rhizosphere | REQVDRLAAESVTRVRHCQPSASYDAATADALTRLEAVTELKTAWHPVGA* |
| Ga0075434_1025909362 | 3300006871 | Populus Rhizosphere | ELDGLAAETIKRVRHGSGAESYAAAVDDALERIEAVTELKTAWHPVGA* |
| Ga0073928_101268614 | 3300006893 | Iron-Sulfur Acid Spring | LASETIKRTRHSAAATSYADAVDDALDRLVAVTELKTAWHPVGA* |
| Ga0073928_105006262 | 3300006893 | Iron-Sulfur Acid Spring | AAGEPELSAELDRLASETIKRVRHTTAARDYELAVADALGRIDALTELKTAWHPVGA* |
| Ga0075424_1021979371 | 3300006904 | Populus Rhizosphere | KRTRHNSAATTYDEAVDNSLSRLEAVTELKTAWHPIGA* |
| Ga0079219_107281402 | 3300006954 | Agricultural Soil | SAALDRLAAETIKRVRHGSAATSYAAAVDDALERIEATVELKTAWHPVGA* |
| Ga0075435_1012970292 | 3300007076 | Populus Rhizosphere | IKRVRHGSGAESYAAAVDDALERIEAVTELKTAWHPVGA* |
| Ga0116218_11595592 | 3300009522 | Peatlands Soil | AELDRLAAETIKRVRHGAAATGYEGATDDALDRLEAVTELKTAWHPVGA* |
| Ga0126313_109245391 | 3300009840 | Serpentine Soil | RVRHTTPSESYADATSDPLSRLEALTELKTAWHPVGA* |
| Ga0126305_109162882 | 3300010036 | Serpentine Soil | VRHAAPTGSYAEATGDPLSRLEAVTELKTAWHPVGA* |
| Ga0126310_112939071 | 3300010044 | Serpentine Soil | AESVTRVSHTAAATSYETATADPLSRLEALTELKTAWHPVGA* |
| Ga0134126_106996801 | 3300010396 | Terrestrial Soil | ETIKRVRHADAAMSYEDATGDALERLHAVTELKTAWHPVGA* |
| Ga0134126_109787361 | 3300010396 | Terrestrial Soil | IDKLAAESVTRVRHTPASNDYATATADPLSRLEALTELKTAWHPVGA* |
| Ga0134126_110127572 | 3300010396 | Terrestrial Soil | ELDRLAAETIKRARHRDAAASYETAVADALERIEALTELKTAWHPVGA* |
| Ga0134124_112339462 | 3300010397 | Terrestrial Soil | AAESVTRVRHTTPADSYEAATGDPLSRLEAVTELKTAWHPVGA* |
| Ga0134122_125452042 | 3300010400 | Terrestrial Soil | RHAAASNDYATATADPLSRLEALTELKTAWHPVGA* |
| Ga0153922_11134821 | 3300012181 | Attine Ant Fungus Gardens | LAAETIKRVRHGAPARTYEDAVDEALTRLEAVTELKTAWHPVGA* |
| Ga0150985_1106182801 | 3300012212 | Avena Fatua Rhizosphere | RHSAAATSYDAAIADALNRLEAVTELKTAWHPIGA* |
| Ga0157302_103116712 | 3300012915 | Soil | DRLAAESVTRVRHAQATQTYDGAVGDALTRLEAVTELKTAWHPIGA* |
| Ga0164242_104932192 | 3300012942 | Compost | AAETIKRASHRSAATSYEAAVDDALERIAALTELKTAWHPVGA* |
| Ga0137410_114816442 | 3300012944 | Vadose Zone Soil | LASETIKRVRHGAAVTSYADAVSDSLGRIDAVTELKTAWHPVGA* |
| Ga0164298_104245861 | 3300012955 | Soil | AETVKRARHAPAATSYEAATDDALARLEAVTELKTAWHPVGA* |
| Ga0164307_101454083 | 3300012987 | Soil | RTRHATPATTYAAATDNALSRLEAVVELKTAWHPVGA* |
| Ga0164307_114021572 | 3300012987 | Soil | RHGAPATTYEAATDDALARLEAVTELKTAWHPVGA* |
| Ga0164306_105404122 | 3300012988 | Soil | DRLAAETIKRVRQESGAVSYAAAVDDALERIEAVVELKTAWHPVGA* |
| Ga0164306_107649961 | 3300012988 | Soil | AAETVKRTRPPTPATTYASATDNALSRLEAVVELKTAWHPVGA* |
| Ga0164305_111195162 | 3300012989 | Soil | AAELDRLAAETVKRARHAPAATSYEAATDDALARLEAVTELKTAWHPVGA* |
| Ga0173483_103237201 | 3300015077 | Soil | DKLAAESVTRVRHTTAATSYETATADPLSRIEGLTELKTAWHPVGA* |
| Ga0137409_111352002 | 3300015245 | Vadose Zone Soil | RELSAELDRLASETIKRVRHGAAVTSYADAVSDSLGRIDAVTELKTAWHPVGA* |
| Ga0132258_100491951 | 3300015371 | Arabidopsis Rhizosphere | RVRHTDAPNDYAAATADPLSRLEALTELKTAWHPVGA* |
| Ga0182041_118281632 | 3300016294 | Soil | RLAAETIKRVRHGAAAKSYSDATDDALERLEMVTELKTAWHPVGA |
| Ga0182035_120614172 | 3300016341 | Soil | SAELDRLAAETIKRVRHGDAATSYEDATDDALERLEAVTELKTAWHPVGA |
| Ga0187777_100704133 | 3300017974 | Tropical Peatland | AELGRLAAETIKRVRRGAAATSYEDATDDALDRLEAVTELKTAWHPVGA |
| Ga0184621_102005811 | 3300018054 | Groundwater Sediment | ELDRLAAETVKRTRHGAAAGSYEDATDDALARLEAVTELKTAWHPIGA |
| Ga0187774_112369161 | 3300018089 | Tropical Peatland | KRVRHGDAATSYEDATDDALERIEAVTELKTAWHPVGA |
| Ga0190265_105117683 | 3300018422 | Soil | VRHSRPTTSYEEAVRDPLSRLEAVTELKTAWHPVGA |
| Ga0190268_119408953 | 3300018466 | Soil | AAESVTRVRHAAPTASYATATADPLSRLEAVTELKTAWHPVGA |
| Ga0193598_10218841 | 3300018910 | Soil | RVRHAAAATDYGEAVRDALGRLEAVVELKTAWHPVGA |
| Ga0190264_100300871 | 3300019377 | Soil | ELAAESVTRVRHADGSPGYEAATADPLSRLEAVTELKTAWHPVGA |
| Ga0190264_113841461 | 3300019377 | Soil | ESVTRVRHAAPTVSYEAAVADALSRLEAVTELKTAWHPVGA |
| Ga0213875_105540091 | 3300021388 | Plant Roots | AELDRLASETIKRVRHGAPATSYGSATSDALERLHAVTELKTAWHPVGA |
| Ga0210397_106096172 | 3300021403 | Soil | RARHTAAATTYEAATGDALERIEAVTELKTAWHPVGA |
| Ga0210397_110957201 | 3300021403 | Soil | VRHGAAATSYEDATDDALDRLEAVTELKTAWHPIGA |
| Ga0210398_111044482 | 3300021477 | Soil | VRHGAAASTYEDATDDALLRLEAVTELKTAWHPVGA |
| Ga0126371_135146511 | 3300021560 | Tropical Forest Soil | AAETIKRVRHEDAATSYEDATDDALERLEAVTELKTAWHPVGA |
| Ga0222622_100572621 | 3300022756 | Groundwater Sediment | PAAEIDLRAAESVTRVRHAAPAGSYAVAVADALARLEAVTELKTAWHPIGA |
| Ga0207685_100826331 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | LSAELDRLAAETIKRVRHGSAAASYAAAVDDALERIEATVELKTAWHPVGA |
| Ga0207660_109202671 | 3300025917 | Corn Rhizosphere | RHSAAAATYDEAVADALSRIEAVTELKTAWHPIGA |
| Ga0207706_113638182 | 3300025933 | Corn Rhizosphere | VRRAAPTRSYEAAIADALTRLEAVTELKTAWHPIGA |
| Ga0207678_117360642 | 3300026067 | Corn Rhizosphere | AELDRLAAETVKRARHAPAATSYEAATDDALARLEAVTELKTAWHPVGA |
| Ga0207702_119234991 | 3300026078 | Corn Rhizosphere | VKRTRHGAAAVTYEAATDDALARLEAVTELKTAWHPIGA |
| Ga0209472_11064062 | 3300026323 | Soil | TIKRTRHTTAATTYDAAVSDSLSRLEAVTELKTAWHPIGA |
| Ga0209074_104582091 | 3300027787 | Agricultural Soil | TVKRARHGAGAASYEAATDDALARLEAVTELKTAWHPIGA |
| Ga0268266_113611653 | 3300028379 | Switchgrass Rhizosphere | ETIKRARHSAGATTYDEATGNALTRLEAVTELKTAWHPIGA |
| Ga0307321_10199123 | 3300028704 | Soil | VKRTRHGAAAGSYEDATDDALARLEAVTELKTAWHPIGA |
| Ga0307276_102019662 | 3300028705 | Soil | DRLAAETVKRARHGTAATTYEAATDDALARLEAVTELKTAWHPVGA |
| Ga0307301_102385612 | 3300028719 | Soil | ELDRLAAETVKRARHGAPATTYEAATDDALARLEAVTELKTAWHPVGA |
| Ga0307315_102399541 | 3300028721 | Soil | VKRARHGAPATTYDAATGDSLARLEAVTELKTAWHPVGA |
| Ga0307315_103002741 | 3300028721 | Soil | VTRVRHADPTRSYALATADALTRLEAVTELKTAWHPVGA |
| Ga0307320_103263541 | 3300028771 | Soil | KLASESVTRVRHAAPTGSYAEATADPLSRLEAVTELKTAWHPVGA |
| Ga0302231_105160851 | 3300028775 | Palsa | SHHEAAVSYDEAVEDALERIAAVIELKTAWHPVGA |
| Ga0307284_104176991 | 3300028799 | Soil | AELDRLAAETVKRARHGAPATTYEAATDDALARLEAVTELKTAWHPVGA |
| Ga0307305_102039132 | 3300028807 | Soil | AETVKRARHGAPATTYDAATGDSLARLEAVTELKTAWHPVGA |
| Ga0307289_100477881 | 3300028875 | Soil | TVKRARHGAPATTYDAATGDSLARLEAVTELKTAWHPVGA |
| Ga0307289_103451911 | 3300028875 | Soil | KRARHGAPAASYEAATDDALARLEAVTELKTAWHPIGA |
| Ga0307289_103890322 | 3300028875 | Soil | TAPIDELAAESVTRVRHADPTRSYALATADALTRLEAVTELKTAWHPVGA |
| Ga0307278_102335751 | 3300028878 | Soil | RLAAETVKRARHGAPATTYEAATDDALARLEAVTELKTAWHPVGA |
| Ga0307300_100711981 | 3300028880 | Soil | ETVKRARHGAAATSYEAATGDSLARLEAVTELKTAWHPIGA |
| Ga0307300_103311912 | 3300028880 | Soil | RVRHTTPAESYEAATGDPLSRLEALTELKTAWHPVGA |
| Ga0307277_101351871 | 3300028881 | Soil | KRTRHGAAAASYEAATDDALARLEAVTELKTAWHPIGA |
| Ga0307304_101744731 | 3300028885 | Soil | TRHGAAAGSYEDATDDALARLEAVTELKTAWHPIGA |
| Ga0311370_115015092 | 3300030503 | Palsa | AETIKRTRHPRAATSYADAVDDSLERIEAVTELKTAWHPVGA |
| Ga0302325_125587171 | 3300031234 | Palsa | GRLGAETITRVRRRAAASSYDEAVADSLGRIEALTELKTAWHPIGT |
| Ga0318538_107163042 | 3300031546 | Soil | RHGAAARSYSDATDDALERLEMVTELKTAWHPVGA |
| Ga0307469_122204022 | 3300031720 | Hardwood Forest Soil | KLAAESVTRVRHTTPAESYEAATGDPLSRLEAVTELKTAWHPIGA |
| Ga0318494_102088852 | 3300031751 | Soil | DRLAAETIKRVRHGAAARSYSDATDDALERLEMVTELKTAWHPVGA |
| Ga0307410_119115731 | 3300031852 | Rhizosphere | AAESVTRVRHAPPTTSYAAATADPLSRLESVTELKTAWHPVGA |
| Ga0310892_106913711 | 3300031858 | Soil | TRVRHTPASNDYATATADPLSRLEALTELKTAWHPVGA |
| Ga0310900_106132351 | 3300031908 | Soil | ELDRLAAETVKRTRHGAAAGTYEAATDDALARLEAVTELKTAWHPIGA |
| Ga0308175_1000050838 | 3300031938 | Soil | LASETIKRTRHSSAAGSYDEAVADALSRLEAVTELKTAWHPIGA |
| Ga0308175_1028999802 | 3300031938 | Soil | ELAAELDRLAAETVKRTRHGAGAASYEAATDDALARLEAVTEHKTAWHPIGA |
| Ga0307409_1025911252 | 3300031995 | Rhizosphere | DRLAAESVTRVRHTTASTDYATATVDPLSRLEALTELKTAWHPVGA |
| Ga0318525_102559412 | 3300032089 | Soil | IKRVRHGAAARSYSDATDDALERLEMVTELKTAWHPVGA |
| Ga0335080_122666741 | 3300032828 | Soil | ETIKRARHSVAASTYEDATDDALERLEAVTELKTAWHPVGA |
| Ga0335076_108751281 | 3300032955 | Soil | IKRVRHEDAATSYEDATDDALERLEAVTELKTAWHPVGA |
| ⦗Top⦘ |