| Basic Information | |
|---|---|
| Family ID | F092475 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MTTATQTGRERETVNSWDKFLERVKSRVSINTFTTWF |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 21.50 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 85.98 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.636 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.953 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.972 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (66.355 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.62% β-sheet: 0.00% Coil/Unstructured: 55.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13277 | YmdB | 13.08 |
| PF01436 | NHL | 1.87 |
| PF03551 | PadR | 1.87 |
| PF00149 | Metallophos | 0.93 |
| PF11999 | Ice_binding | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.87 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.87 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.64 % |
| Unclassified | root | N/A | 23.36 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10029729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3068 | Open in IMG/M |
| 3300002914|JGI25617J43924_10072503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1258 | Open in IMG/M |
| 3300002917|JGI25616J43925_10338385 | Not Available | 558 | Open in IMG/M |
| 3300004092|Ga0062389_100146214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2216 | Open in IMG/M |
| 3300005454|Ga0066687_10266040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
| 3300005586|Ga0066691_10659434 | Not Available | 620 | Open in IMG/M |
| 3300005993|Ga0080027_10422712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 538 | Open in IMG/M |
| 3300006052|Ga0075029_100402815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300006052|Ga0075029_101015209 | Not Available | 573 | Open in IMG/M |
| 3300006175|Ga0070712_101021267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300006806|Ga0079220_11824375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 536 | Open in IMG/M |
| 3300006903|Ga0075426_10239079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1321 | Open in IMG/M |
| 3300007265|Ga0099794_10072217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1691 | Open in IMG/M |
| 3300009088|Ga0099830_10824958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300009548|Ga0116107_1122825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 743 | Open in IMG/M |
| 3300010048|Ga0126373_10957602 | Not Available | 921 | Open in IMG/M |
| 3300010326|Ga0134065_10338097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 588 | Open in IMG/M |
| 3300010335|Ga0134063_10069938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1560 | Open in IMG/M |
| 3300010341|Ga0074045_10675496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 656 | Open in IMG/M |
| 3300010358|Ga0126370_10078869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2205 | Open in IMG/M |
| 3300010358|Ga0126370_10160048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1653 | Open in IMG/M |
| 3300010358|Ga0126370_10591576 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
| 3300010359|Ga0126376_10601402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1040 | Open in IMG/M |
| 3300010359|Ga0126376_13023256 | Not Available | 520 | Open in IMG/M |
| 3300010366|Ga0126379_10610584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
| 3300010366|Ga0126379_12527827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 612 | Open in IMG/M |
| 3300010376|Ga0126381_104337062 | Not Available | 549 | Open in IMG/M |
| 3300010398|Ga0126383_10466663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1315 | Open in IMG/M |
| 3300011270|Ga0137391_10038166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4063 | Open in IMG/M |
| 3300011270|Ga0137391_10076774 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2875 | Open in IMG/M |
| 3300012189|Ga0137388_11344624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 654 | Open in IMG/M |
| 3300012202|Ga0137363_11266793 | Not Available | 625 | Open in IMG/M |
| 3300012203|Ga0137399_11241424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300012349|Ga0137387_11217065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300012361|Ga0137360_10582131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
| 3300012957|Ga0164303_10564513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300013100|Ga0157373_10680396 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300014150|Ga0134081_10022161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1795 | Open in IMG/M |
| 3300014155|Ga0181524_10048032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2736 | Open in IMG/M |
| 3300015054|Ga0137420_1342048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1714 | Open in IMG/M |
| 3300015357|Ga0134072_10191741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300016294|Ga0182041_10760094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300016371|Ga0182034_11000434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300016387|Ga0182040_10117472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1839 | Open in IMG/M |
| 3300016387|Ga0182040_10226663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1390 | Open in IMG/M |
| 3300016445|Ga0182038_10016390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4342 | Open in IMG/M |
| 3300017656|Ga0134112_10324822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 623 | Open in IMG/M |
| 3300017932|Ga0187814_10157620 | Not Available | 847 | Open in IMG/M |
| 3300017947|Ga0187785_10059046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1455 | Open in IMG/M |
| 3300017972|Ga0187781_10566957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300017973|Ga0187780_10071630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2381 | Open in IMG/M |
| 3300017999|Ga0187767_10007797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2005 | Open in IMG/M |
| 3300018006|Ga0187804_10438649 | Not Available | 582 | Open in IMG/M |
| 3300018088|Ga0187771_10789018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300018433|Ga0066667_11603158 | Not Available | 580 | Open in IMG/M |
| 3300019278|Ga0187800_1200212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 500 | Open in IMG/M |
| 3300020199|Ga0179592_10205854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 891 | Open in IMG/M |
| 3300020579|Ga0210407_10272993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1319 | Open in IMG/M |
| 3300020580|Ga0210403_10139455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1980 | Open in IMG/M |
| 3300020580|Ga0210403_11068358 | Not Available | 628 | Open in IMG/M |
| 3300021088|Ga0210404_10499267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300021168|Ga0210406_10289724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1334 | Open in IMG/M |
| 3300021171|Ga0210405_10288290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1298 | Open in IMG/M |
| 3300021403|Ga0210397_10521953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300021420|Ga0210394_10924277 | Not Available | 758 | Open in IMG/M |
| 3300021432|Ga0210384_11593374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 558 | Open in IMG/M |
| 3300021432|Ga0210384_11829051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 513 | Open in IMG/M |
| 3300021478|Ga0210402_11386004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 630 | Open in IMG/M |
| 3300025498|Ga0208819_1053806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 924 | Open in IMG/M |
| 3300026281|Ga0209863_10079751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
| 3300026294|Ga0209839_10103030 | Not Available | 973 | Open in IMG/M |
| 3300026317|Ga0209154_1247412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300026318|Ga0209471_1001116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 16349 | Open in IMG/M |
| 3300026319|Ga0209647_1051433 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2214 | Open in IMG/M |
| 3300026330|Ga0209473_1202309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300026376|Ga0257167_1056213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 609 | Open in IMG/M |
| 3300026482|Ga0257172_1105028 | Not Available | 519 | Open in IMG/M |
| 3300026496|Ga0257157_1033886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300026528|Ga0209378_1272360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300026557|Ga0179587_10156406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1423 | Open in IMG/M |
| 3300026557|Ga0179587_10984424 | Not Available | 555 | Open in IMG/M |
| 3300026942|Ga0207783_1015679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300027024|Ga0207819_1011923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1257 | Open in IMG/M |
| 3300027070|Ga0208365_1055392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 533 | Open in IMG/M |
| 3300027587|Ga0209220_1005788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3307 | Open in IMG/M |
| 3300027605|Ga0209329_1134241 | Not Available | 544 | Open in IMG/M |
| 3300027645|Ga0209117_1014375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2623 | Open in IMG/M |
| 3300027706|Ga0209581_1283801 | Not Available | 500 | Open in IMG/M |
| 3300027765|Ga0209073_10458361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 531 | Open in IMG/M |
| 3300027783|Ga0209448_10169013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300027787|Ga0209074_10178614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300027829|Ga0209773_10025608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2328 | Open in IMG/M |
| 3300027875|Ga0209283_10217503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1269 | Open in IMG/M |
| 3300027875|Ga0209283_10487112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300030991|Ga0073994_11825748 | Not Available | 532 | Open in IMG/M |
| 3300031231|Ga0170824_113525957 | Not Available | 711 | Open in IMG/M |
| 3300031231|Ga0170824_126935844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter | 1109 | Open in IMG/M |
| 3300031446|Ga0170820_13290965 | Not Available | 504 | Open in IMG/M |
| 3300031754|Ga0307475_11142249 | Not Available | 608 | Open in IMG/M |
| 3300031910|Ga0306923_11035459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300031910|Ga0306923_11954259 | Not Available | 597 | Open in IMG/M |
| 3300031942|Ga0310916_11205215 | Not Available | 626 | Open in IMG/M |
| 3300031962|Ga0307479_11002800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300032180|Ga0307471_104069855 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 516 | Open in IMG/M |
| 3300032205|Ga0307472_102699578 | Not Available | 507 | Open in IMG/M |
| 3300032770|Ga0335085_11765965 | Not Available | 635 | Open in IMG/M |
| 3300033402|Ga0326728_10154522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2473 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.95% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.02% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.67% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.74% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.87% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.87% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.87% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.93% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026376 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-B | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026942 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 63 (SPAdes) | Environmental | Open in IMG/M |
| 3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_100297291 | 3300001661 | Forest Soil | MTTAPQVGRERETANSWDKFLERVKSRVSINTYTTWFQ |
| JGI25617J43924_100725031 | 3300002914 | Grasslands Soil | MTTATQAGRERETANSWDKFLDHVKSRVSINTYTTWFQPTRLNR |
| JGI25616J43925_103383851 | 3300002917 | Grasslands Soil | MTAATNPAREREPINAWDKFLELVKSRVSINTYTTWFQPTR |
| Ga0062389_1001462143 | 3300004092 | Bog Forest Soil | MTTAIQTGRDRDAVNSWDRFLDRVKSRVSINTYTTWFQPTRLN |
| Ga0066687_102660403 | 3300005454 | Soil | LSLAMTTATQVGREREAGNPWDQFLDHVKARVSINTFTTWF |
| Ga0066691_106594342 | 3300005586 | Soil | MTTATHIVKERETAGMWDKFLERVKSRVSLNTFTTWF |
| Ga0080027_104227121 | 3300005993 | Prmafrost Soil | MTTAIQLGRDREPVNSWDTFLEHVKSRVSINTFTTWFQPT |
| Ga0075029_1004028151 | 3300006052 | Watersheds | MTMTTATQIGRERETVNIWDKFLELIKSRVSINTY |
| Ga0075029_1010152091 | 3300006052 | Watersheds | MSILFAMTTATQLGRDHESVNSWDKFLERVKSRVSINTFTTWFQP |
| Ga0070712_1010212671 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTATQTGRETVNSWDKFLDRVKSRVSINTYTTWFQPTR |
| Ga0079220_118243751 | 3300006806 | Agricultural Soil | MTTATQVGREREAVNSWDKFLDRVKSRVSINTFTTWFQPTR |
| Ga0075426_102390792 | 3300006903 | Populus Rhizosphere | MTTATHIVKDRETTGMWDKFLERVKSRVSLNTFTTWF |
| Ga0099794_100722171 | 3300007265 | Vadose Zone Soil | VRFFLVMTTATNPARERETANAWDKFLEHVKARVSINTYTTW |
| Ga0099830_108249581 | 3300009088 | Vadose Zone Soil | MTTAPQVGREREVANSWDKFLEHVKSRVSINTYTTW |
| Ga0116107_11228253 | 3300009548 | Peatland | MTTATQLGRERETQNVWDKFLELSKSRISINTYTTWFQPTRLNRMEGE |
| Ga0126373_109576022 | 3300010048 | Tropical Forest Soil | MVGVWHFLMTIAAQLGREKETQNLWEKFLELIKSRVSINTYST |
| Ga0134065_103380972 | 3300010326 | Grasslands Soil | MTTATHIVKERETTGMWDKFLDRVKSRVSLNTFTTWFAPTRLNHTDGD |
| Ga0134063_100699381 | 3300010335 | Grasslands Soil | MTTATQVGRERETANAWDKFLEHVKARVSINTFTT |
| Ga0074045_106754962 | 3300010341 | Bog Forest Soil | MTTATQLGRERETQQNVWDKFLELSKSRISINTYTTWFQPTRLNRMEGE |
| Ga0126370_100788691 | 3300010358 | Tropical Forest Soil | MTTAAQVGRETTNAWDRFLEHVKARVSINTFTTWFQ |
| Ga0126370_101600482 | 3300010358 | Tropical Forest Soil | MTTATHIAKDREATGMWDKFLERVKSRVSLNTFTTWFAP |
| Ga0126370_105915762 | 3300010358 | Tropical Forest Soil | MTTAIQLGREREAANLWDRFLERVKSRISVNTFNTWFQ |
| Ga0126376_106014021 | 3300010359 | Tropical Forest Soil | MTTATQLGREREAANTWDRFLEHVKARVSINTFTTWFQPT |
| Ga0126376_130232561 | 3300010359 | Tropical Forest Soil | VLFFVEMTTATNIARERDAANAWDKFLQHVKARVSVNTYGTW |
| Ga0126379_106105841 | 3300010366 | Tropical Forest Soil | MVKVWHFLMTIATQLGREKETQNLWEKFLELIKSRVSINTYST |
| Ga0126379_125278272 | 3300010366 | Tropical Forest Soil | MTTATQVGRERETSNAWDKFLEHVKARVSINTFTTWFQ |
| Ga0126381_1043370622 | 3300010376 | Tropical Forest Soil | MAKVWHFLMTIATQIGREKETQNLWEKFLELIKSRVSINTYSTWFQP |
| Ga0126383_104666632 | 3300010398 | Tropical Forest Soil | MTTAIQTARDREATNCWDKFLEHVKSRVSVNTFST |
| Ga0137391_100381664 | 3300011270 | Vadose Zone Soil | MTTATQIGRDREVANPWDKFLEHVKSRVSINTFTTWFQPTRLN |
| Ga0137391_100767741 | 3300011270 | Vadose Zone Soil | MTAATNPAREREPANAWDKFLELVKSRVSINTYTTWFQPT |
| Ga0137388_113446241 | 3300012189 | Vadose Zone Soil | MTTATQAGRARETANSWDKFLDHVKSRVSINTYTTWFQPTRLNR |
| Ga0137363_112667931 | 3300012202 | Vadose Zone Soil | MTTATQIGREKEVQNLWDKFLDLIKSRVSINTYSTWF |
| Ga0137399_112414241 | 3300012203 | Vadose Zone Soil | VEIAEVHSFLVMTAAANPAREREPANAWDKFLELVKSRVS |
| Ga0137387_112170651 | 3300012349 | Vadose Zone Soil | MTTATQVGREREAGNPWDQFLDHVKARVSINTFTT |
| Ga0137360_105821312 | 3300012361 | Vadose Zone Soil | MTTAPQLGREREVASPWDKFLEHVKSRVSINTYTTWFQP |
| Ga0164303_105645132 | 3300012957 | Soil | MTTATQTGRDAANSWDKFLEHVKSRVSINTYTTRFQP |
| Ga0157373_106803962 | 3300013100 | Corn Rhizosphere | MSTATQPGREPFNSWDKFLDRVKQRVSINTFTTWFQP |
| Ga0134081_100221613 | 3300014150 | Grasslands Soil | MTTAIQVGRERETANSWDKFLEHVKSRVSINTFTTWF |
| Ga0181524_100480321 | 3300014155 | Bog | LVFSITMTTATQLGRERETQNVWDKFLELSKSRISINTYTTW |
| Ga0137420_13420483 | 3300015054 | Vadose Zone Soil | MTTATQIGREREALNSWDKFLDRVKSRVSINTFTTWFQ |
| Ga0134072_101917412 | 3300015357 | Grasslands Soil | MTTATKTEREREAVNSWDKFLDRVKSRVSINTFTTWFQPTR |
| Ga0182041_107600942 | 3300016294 | Soil | MTTATQLGRESVTLNVWDKFLDLIKSRVSINTYSTWFQP |
| Ga0182034_110004341 | 3300016371 | Soil | MMTTTATQLGREPEIVNVWDKFLDLIKSRVSINTFSTWFQ |
| Ga0182040_101174723 | 3300016387 | Soil | MTTATQIGREREAQNVWDKFLELSKSRVSINTYATWFQPTRLNRL |
| Ga0182040_102266631 | 3300016387 | Soil | MTTATQLGRESVTLNVWDKFLDLIKSRVSINTYST |
| Ga0182038_100163904 | 3300016445 | Soil | MTTAIQLGKERAVANLWDKFLERVKSRISINTYTTWFQP |
| Ga0134112_103248221 | 3300017656 | Grasslands Soil | MTTATQAGRERETANSWDKFLDHVKSRVSINTYTTWFQPTR |
| Ga0187814_101576202 | 3300017932 | Freshwater Sediment | MTMTTATQVGRERETLNVWDKFLDLIKSRVSINTYS |
| Ga0187785_100590461 | 3300017947 | Tropical Peatland | MAHVWHFLMTTATQIGREKETQNLWEKFLDLIKSRVSINTYSTWFQPT |
| Ga0187781_105669572 | 3300017972 | Tropical Peatland | MSTATQIGRERETANAWDKFLERVKSRVSINTYTTWFQPT |
| Ga0187780_100716301 | 3300017973 | Tropical Peatland | MTTAIQTGRERETLNIWDKFLELIKSRVSINTYSTW |
| Ga0187767_100077973 | 3300017999 | Tropical Peatland | MTTATQIGRERETANIWDKFLELIKSRVSINTYTTWFQ |
| Ga0187804_104386491 | 3300018006 | Freshwater Sediment | MTTATQLGHERETQNVWDKFLELSKSRISINTYTTW |
| Ga0187771_107890182 | 3300018088 | Tropical Peatland | MTTAPQLGRALPNPNVWDKFLELIKSRVSINTYST |
| Ga0066667_116031581 | 3300018433 | Grasslands Soil | MTTATKTEREREAVNSWDKFLDRVKSRVSINTFTT |
| Ga0187800_12002121 | 3300019278 | Peatland | MTMTTAIQVGRESAALNVWDKFLDLIKSRVSINTFTTWFQPTR |
| Ga0179592_102058541 | 3300020199 | Vadose Zone Soil | VRLFLVMTAATNPAREREPINAWDKFLELVKSRVS |
| Ga0210407_102729932 | 3300020579 | Soil | MTTATQTGRDRETVNSWDKFLERVKSRVSINTFTTWFQP |
| Ga0210403_101394551 | 3300020580 | Soil | MASVWLFLMTTATQIGREKEVQNLWDKFLDLIKSRVSI |
| Ga0210403_110683581 | 3300020580 | Soil | MITATQVGRERDTQQNVWDKFLDLIKSRVSINTYNT |
| Ga0210404_104992672 | 3300021088 | Soil | MTAATNPAREREPANAWDKFLELVKSRVSINTYTTW |
| Ga0210406_102897242 | 3300021168 | Soil | VRLFLVMNAATNTAREREPANAWDKFLELVKSRVSINTYT |
| Ga0210405_102882901 | 3300021171 | Soil | MTTATQAGREREGANSWDKFLERVKSRVSINTYTTWF |
| Ga0210397_105219532 | 3300021403 | Soil | MTTAIQTGREREAVNTWEKFLEHVKSRVSINTYTTWFQPT |
| Ga0210394_109242772 | 3300021420 | Soil | MVQVWLFLMTTATQIGREKEVQNLWDRFLDLIKSRVSINTY |
| Ga0210384_115933741 | 3300021432 | Soil | MTTATQVGREREAVNSWDKFLDRVKSRVSINTYTTWFQPTRLN |
| Ga0210384_118290511 | 3300021432 | Soil | MTTATQTGRDRETVNSWDKFLEHVKSRVSINTFTTWF |
| Ga0210402_113860041 | 3300021478 | Soil | MTTATQTGRDAANSWDKFLEHVKSRVSINTYTTWF |
| Ga0208819_10538061 | 3300025498 | Peatland | MTTATQLGREHETQQNVWDKFLELSKSRVSINTYTTWFQPTRLNRM |
| Ga0209863_100797511 | 3300026281 | Prmafrost Soil | MTTAIQLGRDREPVNSWDTFLEHVKSRVSINTFTTWFQPTRLNRA |
| Ga0209839_101030302 | 3300026294 | Soil | MTTAIHPARELEPVNSWDKFLERVKSRVSINTFTTW |
| Ga0209154_12474122 | 3300026317 | Soil | MTTATKTEREREAVNSWDKFLDRVKSRVSINTFTTWFQ |
| Ga0209471_10011161 | 3300026318 | Soil | MTTVTKTEREREAVNSWDKFLDRVKSRVSINTFTT |
| Ga0209647_10514331 | 3300026319 | Grasslands Soil | MTTATHIVKERETAGMWDKFLERVKSRVSLNTFTT |
| Ga0209473_12023091 | 3300026330 | Soil | MTTATQVGRERETANAWDKFLEHVKARVSINTFTTW |
| Ga0257167_10562131 | 3300026376 | Soil | MTTTINAGRDREGVNSWDKLLERVKSRVSINTFTTWFQPTRLNRAEG |
| Ga0257172_11050281 | 3300026482 | Soil | VEIAEGASFSVMTAATNPAREREPGNAWDKFLELVKSRVSINTY |
| Ga0257157_10338861 | 3300026496 | Soil | MTTATQTGRERETVNSWDKFLERVKSRVSINTFTTWF |
| Ga0209378_12723601 | 3300026528 | Soil | MTTAIQLGRERETANLWDKFLERVKSRVSINTFNTWFQP |
| Ga0179587_101564061 | 3300026557 | Vadose Zone Soil | MTTATQTGREREAVNSWDKFLERVKSRVSINTFTTWF |
| Ga0179587_109844241 | 3300026557 | Vadose Zone Soil | VEIAKVRLFLVMTAATNPAREREPINAWDKFLELVKSRVSINTYTT |
| Ga0207783_10156791 | 3300026942 | Tropical Forest Soil | MTMTTATQIGRERETANVWEKFLELIKSRVSINTY |
| Ga0207819_10119231 | 3300027024 | Tropical Forest Soil | MTMTTATQIGRERETANVWDKFLELIKSRVSINTY |
| Ga0208365_10553921 | 3300027070 | Forest Soil | MTTATQVGREREAVNSWDKFLERVKSRVSINTFTTWFQPTRL |
| Ga0209220_10057881 | 3300027587 | Forest Soil | MTTAPQVGRERETANSWDKFLDRVKSRVSINTYTTWFQP |
| Ga0209329_11342412 | 3300027605 | Forest Soil | MTAAANTAREREPVNAWDKFLELVKSRVSINTYTT |
| Ga0209117_10143751 | 3300027645 | Forest Soil | MPKGASFLVITAATNPAREREPANTWDKFLELVKSRVSINTY |
| Ga0209581_12838012 | 3300027706 | Surface Soil | MTTATHIAKEREAAGMWDKFLERVKSRVSLNTFTT |
| Ga0209073_104583611 | 3300027765 | Agricultural Soil | MTTATQVGREREAVNSWDKFLDRVKSRVSINTFTTWFQPT |
| Ga0209448_101690132 | 3300027783 | Bog Forest Soil | MTTATQIGREREVLNLWDKFLELIKSRVSINTYSTWF |
| Ga0209074_101786141 | 3300027787 | Agricultural Soil | MTTATQVGRERETANSWDKFLEHVKARVSINTFTTWFQPT |
| Ga0209773_100256081 | 3300027829 | Bog Forest Soil | MTTATQISRERDTVNVWDKFLDLIKSRVSINTYST |
| Ga0209283_102175032 | 3300027875 | Vadose Zone Soil | MTTATQTGREREAVNSWDKFLERVKSRVSINTFTTWFQPT |
| Ga0209283_104871122 | 3300027875 | Vadose Zone Soil | MTTATQIGREREVANPWDKFLEHVKSRVSINTFTTWFQP |
| Ga0073994_118257481 | 3300030991 | Soil | MTTAIHPARELEPVNSWDKFLERVKSRVSINTFTTWF |
| Ga0170824_1135259571 | 3300031231 | Forest Soil | MITATQVGRERDTQQNVWDKFLDLIKSRVSINTYNTWFQ |
| Ga0170824_1269358442 | 3300031231 | Forest Soil | MKTAIQLGKEQEVTNLWDKFLERVKSRVSINTFNTWF |
| Ga0170820_132909651 | 3300031446 | Forest Soil | MTTATQTGRERETVNSWYKFLERVKSRVSINTFTTWFQ |
| Ga0307475_111422492 | 3300031754 | Hardwood Forest Soil | MTTATQIGREKEVQNLWDKFLDLIKSRVSINTYST |
| Ga0306923_110354591 | 3300031910 | Soil | MTMTTATQIGRERETANVWDRFLELIKSRVSINTYTTWFQPT |
| Ga0306923_119542592 | 3300031910 | Soil | MTTAAHIAKEREADGMWDKFLERVKSRVSLNTFTTWFAPTR |
| Ga0310916_112052152 | 3300031942 | Soil | VTTLMTMTTATQIGREPQTSNVWDRFLELIKSRVSINTYST |
| Ga0307479_110028001 | 3300031962 | Hardwood Forest Soil | MTTTINAGHDREGVNSWDKLLERVKSRVSINTFTTWFQP |
| Ga0307471_1040698551 | 3300032180 | Hardwood Forest Soil | MTTAIQAGRDREAANLWDKLLERVKSRVSINTFTTWFQPT |
| Ga0307472_1026995782 | 3300032205 | Hardwood Forest Soil | MTTGTQTGRETPNAWEKFLERVKSRVSTNTYTTWFE |
| Ga0335085_117659652 | 3300032770 | Soil | MSLLFSPQMSTATQTGREPFNSWDKFLDRVKQRVSINTF |
| Ga0326728_101545221 | 3300033402 | Peat Soil | MTTAAQIGRERETQNVWDKFLELSKSRVSINTYTTWFQPTR |
| ⦗Top⦘ |