| Basic Information | |
|---|---|
| Family ID | F092467 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 41 residues |
| Representative Sequence | FDSEDDYRKGDEILSAMPAGDTPGQRTSVTKYNVATRMSS |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 11.11 % |
| % of genes near scaffold ends (potentially truncated) | 14.95 % |
| % of genes from short scaffolds (< 2000 bps) | 15.89 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (85.981 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (16.822 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.907 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.009 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.65% β-sheet: 0.00% Coil/Unstructured: 82.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF04029 | 2-ph_phosp | 10.28 |
| PF01872 | RibD_C | 8.41 |
| PF08281 | Sigma70_r4_2 | 5.61 |
| PF13191 | AAA_16 | 3.74 |
| PF04542 | Sigma70_r2 | 2.80 |
| PF08240 | ADH_N | 2.80 |
| PF06983 | 3-dmu-9_3-mt | 1.87 |
| PF01575 | MaoC_dehydratas | 1.87 |
| PF04261 | Dyp_perox | 1.87 |
| PF07995 | GSDH | 0.93 |
| PF08808 | RES | 0.93 |
| PF00004 | AAA | 0.93 |
| PF14489 | QueF | 0.93 |
| PF04828 | GFA | 0.93 |
| PF00542 | Ribosomal_L12 | 0.93 |
| PF00082 | Peptidase_S8 | 0.93 |
| PF00487 | FA_desaturase | 0.93 |
| PF07883 | Cupin_2 | 0.93 |
| PF12697 | Abhydrolase_6 | 0.93 |
| PF03605 | DcuA_DcuB | 0.93 |
| PF00565 | SNase | 0.93 |
| PF02803 | Thiolase_C | 0.93 |
| PF00342 | PGI | 0.93 |
| PF13189 | Cytidylate_kin2 | 0.93 |
| PF08327 | AHSA1 | 0.93 |
| PF00392 | GntR | 0.93 |
| PF06831 | H2TH | 0.93 |
| PF02801 | Ketoacyl-synt_C | 0.93 |
| PF00766 | ETF_alpha | 0.93 |
| PF03795 | YCII | 0.93 |
| PF02909 | TetR_C_1 | 0.93 |
| PF04101 | Glyco_tran_28_C | 0.93 |
| PF00501 | AMP-binding | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG2045 | Phosphosulfolactate phosphohydrolase or related enzyme | Coenzyme transport and metabolism [H] | 20.56 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 8.41 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 8.41 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 2.80 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 2.80 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 2.80 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 2.80 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 1.87 |
| COG2837 | Periplasmic deferrochelatase/peroxidase EfeB | Inorganic ion transport and metabolism [P] | 1.87 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 1.87 |
| COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 0.93 |
| COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 0.93 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.93 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.93 |
| COG2704 | Anaerobic C4-dicarboxylate transporter | Carbohydrate transport and metabolism [G] | 0.93 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.93 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.93 |
| COG0166 | Glucose-6-phosphate isomerase | Carbohydrate transport and metabolism [G] | 0.93 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.93 |
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.93 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.93 |
| COG0222 | Ribosomal protein L7/L12 | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 85.98 % |
| All Organisms | root | All Organisms | 14.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459018|G1P06HT02IHWLG | Not Available | 600 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1058854 | Not Available | 510 | Open in IMG/M |
| 3300005167|Ga0066672_10713707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 641 | Open in IMG/M |
| 3300005336|Ga0070680_101096917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 688 | Open in IMG/M |
| 3300005560|Ga0066670_10564538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 695 | Open in IMG/M |
| 3300005569|Ga0066705_10983963 | Not Available | 500 | Open in IMG/M |
| 3300006852|Ga0075433_11618948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
| 3300006904|Ga0075424_101951610 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300011269|Ga0137392_10795168 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300012198|Ga0137364_10743218 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300012199|Ga0137383_10978985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
| 3300015356|Ga0134073_10246072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 615 | Open in IMG/M |
| 3300016270|Ga0182036_11518612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 563 | Open in IMG/M |
| 3300025538|Ga0210132_1002326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2358 | Open in IMG/M |
| 3300025917|Ga0207660_10971426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 693 | Open in IMG/M |
| 3300026550|Ga0209474_10226516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1173 | Open in IMG/M |
| 3300028811|Ga0307292_10102889 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300032075|Ga0310890_11006312 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.35% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.54% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.80% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.80% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.87% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.87% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.93% |
| Permafrost And Active Layer Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost And Active Layer Soil | 0.93% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.93% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
| 2170459018 | Litter degradation MG2 | Engineered | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300002028 | Permafrost and active layer soil microbial communities from McGill Arctic Research Station (MARS), Canada, for enrichment studies - Sample_A17 | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012529 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014299 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| L02_01265090 | 2170459007 | Grass Soil | ALAIVFFDSEDDYDRGDKILSAMPAADTPGQRTSVKKYQVAVRRNP |
| 2MG_01584570 | 2170459018 | Switchgrass, Maize And Mischanthus Litter | LVVLFFENEDDYRRGDETLSAMPASDTPGQRTSVTKYNVAMRMSD |
| AP72_2010_repI_A10DRAFT_10588541 | 3300000651 | Forest Soil | VVLFFENEDDYQRGHETLNAMPASDTPGQRTSVSKYNVAMRMSD* |
| A17_10907542 | 3300002028 | Permafrost And Active Layer Soil | DKTLVVVLFENEDDYRKGDEILSAMPKDDTPGRRTSVTKYDVALRQKAG* |
| Ga0055498_101292772 | 3300004058 | Natural And Restored Wetlands | ETEEAYARGDEILDAMPTGDTPGQRTSVSKYDVALRMTT* |
| Ga0062595_1011108832 | 3300004479 | Soil | FDNEDDYRKGDEILNAMPAGDTPGQRTSVKKYDLAMRMSN* |
| Ga0062595_1012869411 | 3300004479 | Soil | ENEDDYRLGDETLSAMPAGDTPGQRTSVTKYQVAIRMAD* |
| Ga0062591_1001458281 | 3300004643 | Soil | AVIIFDNEDDYKKGDEILSGMPAGDTPGQRTSVTKYNVAMRMKS* |
| Ga0066672_107137071 | 3300005167 | Soil | PEAEKSLVVIIFENEDDYRAGDEILSAMPAGDTPGQRTSVTKFNVATRMSN* |
| Ga0066677_104400582 | 3300005171 | Soil | VIIFENEDDYRAGDEILSAMPAGDTPGQRTSVTKYNVATRMSN* |
| Ga0066688_104726151 | 3300005178 | Soil | VVVFENEDDYKRGDEILSAMPASDTPGSRTSVKKYDVAVHMKP* |
| Ga0066688_107665611 | 3300005178 | Soil | LVVIIFENEDDYRAGDEILSAMPAGDTPGQRTSVTKYNVATRMSS* |
| Ga0070680_1010969171 | 3300005336 | Corn Rhizosphere | LAIVFFENEDDYRLGDETLSAMPAGDTPGQRTSVTKYQVAIRMAD* |
| Ga0066681_109440011 | 3300005451 | Soil | FENEDDYQKGDEILNAMPAEDTPGRRTSVKKYDVAMRMKS* |
| Ga0066687_106939491 | 3300005454 | Soil | ENEDDYRAGDEILSAMPAGDTSGQRTSVTKYNVATRMSN* |
| Ga0073909_103330381 | 3300005526 | Surface Soil | EKSIAIVIFDNEDDYKKGDEILGSMPSGDTPGNRTSVAKYNVATRMKS* |
| Ga0070684_1006782222 | 3300005535 | Corn Rhizosphere | IVFFETEEDYQTGDKILSAMPAADTPGKRTSVTKYNVATRMKS* |
| Ga0066670_100577984 | 3300005560 | Soil | EKSLVVIIFENEDDYRAGDEILSAMPAGDTPGQRTSVTKYNVATRMSN* |
| Ga0066670_105645384 | 3300005560 | Soil | LFFENEDDYRRGDETLSAMPASDTPGQRTSVAKYNVAMRMSD* |
| Ga0066705_104083312 | 3300005569 | Soil | AIVIFDNEDDYRKGAEILDAMPGPDTPGQRTSVSKYDVAVRMSS* |
| Ga0066705_109839631 | 3300005569 | Soil | AIVFFENEDDYQKGHEILDAMPASDTPGQRTAVTKYDVAVRMTN* |
| Ga0066654_109216641 | 3300005587 | Soil | SLAIVIFDNEDDYRKGDEILGSMPASDTPGTRTSVKKYNVAHRMSM* |
| Ga0066706_111056444 | 3300005598 | Soil | VIFENEDDYRKGDEILSAMPAGDTPGTRTSVSKHDVALRMKS* |
| Ga0066706_111380321 | 3300005598 | Soil | IFESDEDYQKGDEALNAMSGEDTPGQRTSVTKHNVAARMKS* |
| Ga0068858_1024085152 | 3300005842 | Switchgrass Rhizosphere | FFETEEDYQTGDKILSAMPAADTPGKRTSVTKYNVATRMKS* |
| Ga0066651_103810042 | 3300006031 | Soil | EEDYRKGDEILSAMPAGDVPGQRSSVTKYDVAMRMKS* |
| Ga0070712_1013241972 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | IVIVDSEDDYRKANEILEAMPGPDTPGSRTSVTKYDVAIRANA* |
| Ga0066659_110904511 | 3300006797 | Soil | EDDYRKADEILSAMPAGDTPGQRTSVTKYNVATRMKP* |
| Ga0079221_107461031 | 3300006804 | Agricultural Soil | KSIAIVIFDDEDDYARGDEIHSNMPAPETRGQRTSVTTYNVAMRMKS* |
| Ga0075433_116189482 | 3300006852 | Populus Rhizosphere | SEDDYRRGDEVLSAMPAGDTPGQRTGVGKYDVAVRMAV* |
| Ga0075434_1026299271 | 3300006871 | Populus Rhizosphere | SEDDYRKGDEILSSMPAGNTPGQRTSVTKYNVATRMSN* |
| Ga0075426_101149521 | 3300006903 | Populus Rhizosphere | YRKGDEILSSMPAGNTPGQRTSVTKYNVATRMSN* |
| Ga0075424_1010748031 | 3300006904 | Populus Rhizosphere | NEDDYKKGDEILSAMPTGDTPGQRTSVSKYNVAVRMKN* |
| Ga0075424_1019516101 | 3300006904 | Populus Rhizosphere | AETSTVVVIFDNEDDYRTGDEILNNMDAGDTPGTRTSVKKHDVAMRMSN* |
| Ga0075424_1020063521 | 3300006904 | Populus Rhizosphere | SLVLVLFESEDDYRKGDEILSSMPAGNTPGQRTSVTKYNVATRMSN* |
| Ga0079219_104909082 | 3300006954 | Agricultural Soil | EADYQKGHEILDAMPASDTPGRRASVTKYDVAMRMSM* |
| Ga0105240_112367902 | 3300009093 | Corn Rhizosphere | SLAIVIFDNEDDYRKGDEILDSMPASDTPGQRTSVTKYHVAHRMSM* |
| Ga0066709_1015296142 | 3300009137 | Grasslands Soil | FDNEDDYKRGDEILSNMPAADTPGRRTSVQRYDVAARMSS* |
| Ga0066709_1027612251 | 3300009137 | Grasslands Soil | EDDYKKGDEILSAMPAGDTPGQRTSVKKYNVAMRMKS* |
| Ga0126314_101996832 | 3300010042 | Serpentine Soil | DYTRGDETLNAMSTTDTPGQRTSVKRYDVAMRMAV* |
| Ga0127456_11618021 | 3300010140 | Grasslands Soil | VIVFFDSEDDYRKGDEILSAMPAGDTPGQRTSVTKYNVATRMSS* |
| Ga0134088_102450692 | 3300010304 | Grasslands Soil | FETEDDYQRGDEMLSAMPAGETPGKRTSVTKYNVATRMTA* |
| Ga0134064_102295601 | 3300010325 | Grasslands Soil | VVIFDNEEDYKKGDEILSAMPAGDTPGQRTSVSKYDVAVRMKS* |
| Ga0134080_101626173 | 3300010333 | Grasslands Soil | DYQKGDEILNAMPAEDTPGRRTSVKKYDVAMRMKS* |
| Ga0105239_119800053 | 3300010375 | Corn Rhizosphere | VIIFDNEDDYKKGDEILSAMPAGDTPGQRTSVTKYDVAMRMKD* |
| Ga0134123_108344282 | 3300010403 | Terrestrial Soil | FFENEDDYEQGDKTLSAMPAGDTPGQRASVTKYNVAIRMTA* |
| Ga0137392_107951681 | 3300011269 | Vadose Zone Soil | ETEDDYQRGDEALNAMPAGDTPGQRTSVTKYNVATRMTS* |
| Ga0137364_107432181 | 3300012198 | Vadose Zone Soil | MGGKLVVVFFDDEDAYKRGDEILSSMPTGDTPGQRTSVARYDVAHRQTM* |
| Ga0137383_109789851 | 3300012199 | Vadose Zone Soil | EAEKSLVVIIFENEDDYRKGDEILSAMPAGDTPGQRTSVTKYNVATRMKS* |
| Ga0137376_107410322 | 3300012208 | Vadose Zone Soil | SLAIVIFETEDDYKRGDEILNAMPAGDTPGQRTSVTKYNVATRMKS* |
| Ga0137378_115811311 | 3300012210 | Vadose Zone Soil | NEDDYASADAVLSAMPTDETPGRRTSVAKYNVAMRMKS* |
| Ga0137377_106097152 | 3300012211 | Vadose Zone Soil | ENEDDYRKGDEILDAMPASDTPGQRTSVTKYNVAHRMSM* |
| Ga0137366_112532311 | 3300012354 | Vadose Zone Soil | TEDDYKRGDEILDAMPAGDTPGRRASVKKYNVATRMTS* |
| Ga0137371_112509841 | 3300012356 | Vadose Zone Soil | LVVFFDDEDAYQRGDEILSSMPTGDTPGQRTSVSKYDVAVRMTP* |
| Ga0137375_108652752 | 3300012360 | Vadose Zone Soil | LVIVFFDSEDDYRKGDEILSAMPAGDTPGQRTSVTKYNVATRMSS* |
| Ga0137360_116189571 | 3300012361 | Vadose Zone Soil | ETEDDYRQADEILNAMPAGETPGQRTSVNRYDVVFRMKS* |
| Ga0136630_11634001 | 3300012529 | Polar Desert Sand | DYRRGDEVLSAMPAGETPGQRTSVTKYDVAIRMTP* |
| Ga0134076_102148652 | 3300012976 | Grasslands Soil | LRKEDDYQRGDEMLSAMPAGETPGKRTSVTKYNVATRMTA* |
| Ga0120179_10096351 | 3300013763 | Permafrost | ETEDDYKRGDEILSAMPAGDTPGRRASVTKYNVATRMTP* |
| Ga0134078_105547591 | 3300014157 | Grasslands Soil | EDDYRKGDELLNAMPAGDTPGQRTSVKKYDVAMRMSN* |
| Ga0075303_10007031 | 3300014299 | Natural And Restored Wetlands | VFFETEDAYARGDEILNAMPTGDTPGQRTSVSKYEVALRMTT* |
| Ga0163163_119775131 | 3300014325 | Switchgrass Rhizosphere | NEDDYRKGDEILSNMPAGDTPGQRTSVTKYNVAMRMKN* |
| Ga0182006_11391541 | 3300015261 | Rhizosphere | IFDNEDDYRKGDEILNAMPAGDTPGQRTSVKRYDVAMRMSN* |
| Ga0134073_102460722 | 3300015356 | Grasslands Soil | VVIIFDNEDDYHAGDEILSAMPAGDTPGQRTSVTKYNVATRMSN* |
| Ga0132258_122548181 | 3300015371 | Arabidopsis Rhizosphere | EDDYRRGNETLDAMPAGETPGQRTSVSKYQVAFRMTS* |
| Ga0182036_115186123 | 3300016270 | Soil | QALAIVFFDNEDDYQQGHETLDAMPRGDTPGQRTSVTKYNVAMRVTD |
| Ga0187785_103326241 | 3300017947 | Tropical Peatland | KSLVVIFFDDHDAYSRGDEILSTMPAGDTPGQRTSVSKYNVAHRQTM |
| Ga0187776_102537343 | 3300017966 | Tropical Peatland | FDNEDDYNKGDEILSAMPTDDTPGQRTSVSKYNVAMRMKS |
| Ga0190272_105019211 | 3300018429 | Soil | DYRRGDETLSAMPAGDTPGQRTSVARYDVAVRMAV |
| Ga0066667_121130091 | 3300018433 | Grasslands Soil | KSTVVIIFENEDDYKKGDQILNDMPAGDTPGQRTSVSKYNVATRMKN |
| Ga0066662_123393101 | 3300018468 | Grasslands Soil | EDDYRKGDEILSAMPASDTPGTRTSVTKYNVAMRMKR |
| Ga0173479_107297974 | 3300019362 | Soil | DYKKGDEILSAMPAGDTPGQRTSVSKYDVAMRMKS |
| Ga0193730_11053071 | 3300020002 | Soil | DYKRGDEILNAMPAGDTPGQRTSVTKYNVATRMKS |
| Ga0222623_101816522 | 3300022694 | Groundwater Sediment | FDSEDDYRKGDEILSAMPAGDTPGQRTSVTKYNVATRMSS |
| Ga0222622_109339141 | 3300022756 | Groundwater Sediment | ADYKTGDETLSAMPAGDTPGKRTSVAKYNVAFRMAD |
| Ga0247672_10625341 | 3300024187 | Soil | NEDDYRKGDEILDSMPASDTPGQRTSVTKYHVAHRMSM |
| Ga0247667_10671421 | 3300024290 | Soil | VFFDDEDKYQRGDEILSAMPAGDTPGQRTSVSKYNVAMRQSM |
| Ga0210132_10023261 | 3300025538 | Natural And Restored Wetlands | EKSLGIVFFETEDAYARGDEILNAMPTGDTPGQRTSVSKYEVALRMTT |
| Ga0207699_102969223 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | DDYRKGDEILSAMPAGDTPGQRTSVTKYNVATRMSS |
| Ga0207699_104365301 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | DYKKGDEILGGMPSGDTPGTRTSVTKYNVATHMKS |
| Ga0207693_109099711 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | IVIVDSEDDYRKANEILEAMPGPDTPGSRTSVTKYDVAIRANA |
| Ga0207660_109714263 | 3300025917 | Corn Rhizosphere | AIVFFENEDDYRLGDETLSAMPAGDTPGQRTSVTKYQVAIRMAD |
| Ga0207664_113718401 | 3300025929 | Agricultural Soil | RSLAIVIVDSEDDYRKANEILEAMPGPDTPGSRTSVTKYDVAIRANA |
| Ga0207644_106436282 | 3300025931 | Switchgrass Rhizosphere | AIVFFETEEDYQTGDKILSAMPAADTPGKRTSVTKYNVATRMKS |
| Ga0207686_106340193 | 3300025934 | Miscanthus Rhizosphere | VIIFENEDDYRKGDEILGNMPASDVPGKRTSVTKYDVATRMKS |
| Ga0207709_104475732 | 3300025935 | Miscanthus Rhizosphere | IFENEDDYKKGDEILGSMPTPDTPGTRTSVTKYNVAARMKS |
| Ga0207703_122124121 | 3300026035 | Switchgrass Rhizosphere | FFETEEDYQTGDKILSAMPAADTPGKRTSVTKYNVATRMKS |
| Ga0209239_13259602 | 3300026310 | Grasslands Soil | EDDYRAGDEILSAMPAGDTPGQRTSVTKYNVATRMSN |
| Ga0209804_13141251 | 3300026335 | Soil | IFENEDDYRKGDEILDAMPASDTPGQRTSVTKYNVAHRMSM |
| Ga0209808_12978291 | 3300026523 | Soil | KSLVVIIFENEDDYRAGDEILSAMPAGDTPGQRTSVTKYNVATRMSN |
| Ga0209156_104943822 | 3300026547 | Soil | DYRKGDEILSAMPAGDTPGQRTSVTKYNVATRMSS |
| Ga0209474_102265161 | 3300026550 | Soil | FENEDDYRRGDETLNSMPASDTPGQRTSVTKYNVAMRMSD |
| Ga0209811_101396533 | 3300027821 | Surface Soil | EDDYKKGDEILGSMPSGDTPGNRTSVAKYNVATRMKS |
| Ga0209811_103583272 | 3300027821 | Surface Soil | EEDYKKGDEILNAMPAGDVPGSRTSVTKYQVATRMKS |
| Ga0307322_100427231 | 3300028710 | Soil | KSLVIVFFDSEDDYRKGDEILSAMPAGDTPGQRTSVTKYNVATRMSS |
| Ga0307293_101471304 | 3300028711 | Soil | VIFETEDDYKRGDEILNAMPAGDTPGQRTSVTKYNVATRMKS |
| Ga0307303_101017522 | 3300028713 | Soil | VVIFFDSEDDYRKGDEILSAMPAGDTPGQRTSVTKYNVATRMSS |
| Ga0307307_102428851 | 3300028718 | Soil | NEDDYRKGDEVLSAMPTDDTPGQRTSVKRYDVAIHRTM |
| Ga0307315_102808511 | 3300028721 | Soil | FETEDDYKKGDEILNAMPAGDTPGQRTSVMKYDVAMRMKS |
| Ga0307282_103573261 | 3300028784 | Soil | DDYKRGDEILNAMPAGDTPGQRTSVTKYNVATRMKS |
| Ga0307292_101028891 | 3300028811 | Soil | DEDYQRGDAALSAMPAGDTPGQRTSVTKYQVAMRMTD |
| Ga0318546_112625882 | 3300031771 | Soil | DYRRGHEALDAMPAGETPGQRVDVQKYNVAGRMTA |
| Ga0310893_102604931 | 3300031892 | Soil | NEDDYRKGDEVLSAMPTDDTPGNRTSVQRYDVAIHQTM |
| Ga0306926_106774891 | 3300031954 | Soil | FENEDDYRRGHEALDAMPAGETPGQRVDVQKYNVAGRMTA |
| Ga0308173_100012291 | 3300032074 | Soil | VVFDNEEDYRKGDEILSSMPGPDTPGRRASVSKYDVAVRTST |
| Ga0310890_110063121 | 3300032075 | Soil | DYAKGDAALNAMPASDTPGQRTSVTKYDVAIRMAD |
| Ga0314865_150688_2_112 | 3300033806 | Peatland | DDYRKGDAILDAMPGPDTPGRRASVTKYAVAARTAS |
| ⦗Top⦘ |