| Basic Information | |
|---|---|
| Family ID | F092464 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALIGAA |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.13 % |
| % of genes from short scaffolds (< 2000 bps) | 83.18 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.766 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (37.383 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.467 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.598 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 80.43% β-sheet: 0.00% Coil/Unstructured: 19.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF00871 | Acetate_kinase | 32.71 |
| PF00274 | Glycolytic | 14.95 |
| PF12698 | ABC2_membrane_3 | 11.21 |
| PF09364 | XFP_N | 6.54 |
| PF01515 | PTA_PTB | 3.74 |
| PF09361 | Phasin_2 | 2.80 |
| PF00589 | Phage_integrase | 1.87 |
| PF03976 | PPK2 | 1.87 |
| PF01061 | ABC2_membrane | 1.87 |
| PF01594 | AI-2E_transport | 1.87 |
| PF06305 | LapA_dom | 0.93 |
| PF00011 | HSP20 | 0.93 |
| PF00196 | GerE | 0.93 |
| PF16576 | HlyD_D23 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0282 | Acetate kinase | Energy production and conversion [C] | 32.71 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 32.71 |
| COG3588 | Fructose-bisphosphate aldolase class 1 | Carbohydrate transport and metabolism [G] | 14.95 |
| COG0280 | Phosphotransacetylase (includes Pta, EutD and phosphobutyryltransferase) | Energy production and conversion [C] | 3.74 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 1.87 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 1.87 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG3771 | Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.77 % |
| Unclassified | root | N/A | 25.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000550|F24TB_10707240 | Not Available | 839 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10079447 | Not Available | 823 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10023908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 1457 | Open in IMG/M |
| 3300001867|JGI12627J18819_10041791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1913 | Open in IMG/M |
| 3300001867|JGI12627J18819_10137872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 997 | Open in IMG/M |
| 3300004268|Ga0066398_10003584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1782 | Open in IMG/M |
| 3300004633|Ga0066395_10341777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 829 | Open in IMG/M |
| 3300005184|Ga0066671_10256835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1079 | Open in IMG/M |
| 3300005332|Ga0066388_101857145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1074 | Open in IMG/M |
| 3300005332|Ga0066388_103863897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 764 | Open in IMG/M |
| 3300005363|Ga0008090_15463710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1583 | Open in IMG/M |
| 3300005363|Ga0008090_15828783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1049 | Open in IMG/M |
| 3300005439|Ga0070711_101861153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 528 | Open in IMG/M |
| 3300005447|Ga0066689_10271424 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300005471|Ga0070698_101245653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 693 | Open in IMG/M |
| 3300005518|Ga0070699_100012198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7416 | Open in IMG/M |
| 3300005555|Ga0066692_10825742 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005713|Ga0066905_100117612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1846 | Open in IMG/M |
| 3300005713|Ga0066905_102225733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 511 | Open in IMG/M |
| 3300005764|Ga0066903_107997603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 542 | Open in IMG/M |
| 3300006028|Ga0070717_10457468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1151 | Open in IMG/M |
| 3300006175|Ga0070712_101440182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 601 | Open in IMG/M |
| 3300006853|Ga0075420_100421764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1153 | Open in IMG/M |
| 3300006903|Ga0075426_10430853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 975 | Open in IMG/M |
| 3300009012|Ga0066710_101668266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 972 | Open in IMG/M |
| 3300009090|Ga0099827_11408737 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300009100|Ga0075418_10261444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1844 | Open in IMG/M |
| 3300010043|Ga0126380_11075247 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300010046|Ga0126384_10954017 | Not Available | 778 | Open in IMG/M |
| 3300010326|Ga0134065_10488402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 511 | Open in IMG/M |
| 3300010358|Ga0126370_10695194 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300010359|Ga0126376_11690084 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300010359|Ga0126376_12576660 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300010360|Ga0126372_10063302 | All Organisms → cellular organisms → Bacteria | 2585 | Open in IMG/M |
| 3300010361|Ga0126378_10758287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1081 | Open in IMG/M |
| 3300010361|Ga0126378_10994718 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300010366|Ga0126379_11135784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 887 | Open in IMG/M |
| 3300010371|Ga0134125_10245182 | Not Available | 1991 | Open in IMG/M |
| 3300010398|Ga0126383_11860085 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300010398|Ga0126383_12220453 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
| 3300012210|Ga0137378_10610971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1000 | Open in IMG/M |
| 3300012349|Ga0137387_10089671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2127 | Open in IMG/M |
| 3300012355|Ga0137369_10805329 | Not Available | 640 | Open in IMG/M |
| 3300012361|Ga0137360_11178309 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300012971|Ga0126369_11840777 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300012989|Ga0164305_10633598 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300016270|Ga0182036_10078247 | Not Available | 2180 | Open in IMG/M |
| 3300016270|Ga0182036_11161652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 641 | Open in IMG/M |
| 3300016341|Ga0182035_10036337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mesoamericanum | 3234 | Open in IMG/M |
| 3300016341|Ga0182035_11194109 | Not Available | 679 | Open in IMG/M |
| 3300016357|Ga0182032_10835837 | Not Available | 780 | Open in IMG/M |
| 3300016357|Ga0182032_11759623 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300016371|Ga0182034_10070688 | Not Available | 2393 | Open in IMG/M |
| 3300016404|Ga0182037_10129187 | Not Available | 1872 | Open in IMG/M |
| 3300016422|Ga0182039_11414483 | Not Available | 632 | Open in IMG/M |
| 3300016445|Ga0182038_11027341 | Not Available | 731 | Open in IMG/M |
| 3300018433|Ga0066667_10707170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 846 | Open in IMG/M |
| 3300021560|Ga0126371_12463502 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300025910|Ga0207684_11343086 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300025922|Ga0207646_10045174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3954 | Open in IMG/M |
| 3300026507|Ga0257165_1114037 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300026557|Ga0179587_10216249 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
| 3300027874|Ga0209465_10529983 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300031543|Ga0318516_10769701 | Not Available | 544 | Open in IMG/M |
| 3300031546|Ga0318538_10022014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mesoamericanum | 2857 | Open in IMG/M |
| 3300031549|Ga0318571_10022353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1671 | Open in IMG/M |
| 3300031549|Ga0318571_10047678 | Not Available | 1265 | Open in IMG/M |
| 3300031564|Ga0318573_10128650 | Not Available | 1317 | Open in IMG/M |
| 3300031572|Ga0318515_10042314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2266 | Open in IMG/M |
| 3300031573|Ga0310915_10088269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2074 | Open in IMG/M |
| 3300031573|Ga0310915_10732058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 697 | Open in IMG/M |
| 3300031640|Ga0318555_10475343 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300031668|Ga0318542_10594115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 577 | Open in IMG/M |
| 3300031679|Ga0318561_10498088 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300031680|Ga0318574_10006180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5139 | Open in IMG/M |
| 3300031681|Ga0318572_10089716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1719 | Open in IMG/M |
| 3300031763|Ga0318537_10165597 | Not Available | 823 | Open in IMG/M |
| 3300031768|Ga0318509_10116926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1450 | Open in IMG/M |
| 3300031771|Ga0318546_10529613 | Not Available | 827 | Open in IMG/M |
| 3300031777|Ga0318543_10002886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5287 | Open in IMG/M |
| 3300031777|Ga0318543_10372568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 639 | Open in IMG/M |
| 3300031779|Ga0318566_10066237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1739 | Open in IMG/M |
| 3300031781|Ga0318547_10066836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1981 | Open in IMG/M |
| 3300031782|Ga0318552_10084326 | Not Available | 1552 | Open in IMG/M |
| 3300031797|Ga0318550_10028274 | Not Available | 2395 | Open in IMG/M |
| 3300031819|Ga0318568_10051835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2369 | Open in IMG/M |
| 3300031819|Ga0318568_10933444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 536 | Open in IMG/M |
| 3300031832|Ga0318499_10173350 | Not Available | 841 | Open in IMG/M |
| 3300031859|Ga0318527_10124773 | Not Available | 1069 | Open in IMG/M |
| 3300031860|Ga0318495_10087910 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300031879|Ga0306919_10069707 | All Organisms → cellular organisms → Bacteria | 2391 | Open in IMG/M |
| 3300031880|Ga0318544_10032597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1817 | Open in IMG/M |
| 3300031941|Ga0310912_10094716 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2188 | Open in IMG/M |
| 3300031946|Ga0310910_10005303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7683 | Open in IMG/M |
| 3300031947|Ga0310909_11328181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 577 | Open in IMG/M |
| 3300031954|Ga0306926_10613549 | Not Available | 1327 | Open in IMG/M |
| 3300031954|Ga0306926_12745068 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300031959|Ga0318530_10042995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1673 | Open in IMG/M |
| 3300032009|Ga0318563_10635166 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300032044|Ga0318558_10043924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1950 | Open in IMG/M |
| 3300032052|Ga0318506_10269599 | Not Available | 754 | Open in IMG/M |
| 3300032054|Ga0318570_10258085 | Not Available | 790 | Open in IMG/M |
| 3300032060|Ga0318505_10085919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1407 | Open in IMG/M |
| 3300032076|Ga0306924_10189245 | Not Available | 2362 | Open in IMG/M |
| 3300032090|Ga0318518_10132980 | Not Available | 1257 | Open in IMG/M |
| 3300032261|Ga0306920_100620677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1598 | Open in IMG/M |
| 3300033290|Ga0318519_10369290 | Not Available | 850 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 37.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.02% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.15% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.54% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.87% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_107072401 | 3300000550 | Soil | MRRALIAVLLAGAVAVSTSTEAQARWGRGWGWGIGAFAIGALLGAALWRPAYAYGYPAYG |
| AF_2010_repII_A1DRAFT_100794472 | 3300000597 | Forest Soil | MRRALIALLLAGAVAVSTTRPAEARWGWGGWGWGLGAFAI |
| AF_2010_repII_A001DRAFT_100239081 | 3300000793 | Forest Soil | MKRALIALLLAGAVAVSTTKPAEARWGWGWGWGLGAFA |
| JGI12627J18819_100417914 | 3300001867 | Forest Soil | MRRALIAVLLAGAVALSTTKPAEARWGWGWGWGLGAFAIGALIG |
| JGI12627J18819_101378722 | 3300001867 | Forest Soil | MRRALIVVLLAGAVAVSSAKPAEARWGWGWGIGAFAVGALLGAALWRPAY |
| Ga0066398_100035841 | 3300004268 | Tropical Forest Soil | MRRTLIALLLAGAVAVSTTKPAEARWGWGWGLGAFAIGALIGAALWRPA |
| Ga0066395_103417771 | 3300004633 | Tropical Forest Soil | MRRALIAILLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALIGAALWRPAYS |
| Ga0066671_102568352 | 3300005184 | Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGLSARSPSAR* |
| Ga0066388_1018571451 | 3300005332 | Tropical Forest Soil | MRRALIAVLLAAAVAVSTTKPAEAQWGWGRGWGWGLGAFAVGALIGAALW |
| Ga0066388_1038638973 | 3300005332 | Tropical Forest Soil | MRRALIAVLLAGAMAVSTTKPAEARWGWGWGWGLGAFAIGALIGAA |
| Ga0008090_154637103 | 3300005363 | Tropical Rainforest Soil | MRRALIAVLLAGAIAVSTAKPAEARWGWGWGWGLGAFAIGALIGAALW |
| Ga0008090_158287831 | 3300005363 | Tropical Rainforest Soil | MRRALIAILLAGAVAVGTTKPAEARWGWGWGWGLGAFAIGALIGAALWRP |
| Ga0070711_1018611531 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRALIVVLLAGAVAVSTVKPAEARWGWGWGIGAFAIGALLGAALWRPAYAYPAYGYGY |
| Ga0066689_102714242 | 3300005447 | Soil | MRRALIAMLLAGAVAVSTTKPAEARWGGWGWGFGAFAIGALIGAA |
| Ga0070698_1012456531 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALIGAALWRPAYS |
| Ga0070699_1000121988 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGWGLGAFAIG |
| Ga0066692_108257422 | 3300005555 | Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALI |
| Ga0066905_1001176122 | 3300005713 | Tropical Forest Soil | MRRALIALLLAGAVAVSTTRPAEARWGWGGWGWGL |
| Ga0066905_1022257331 | 3300005713 | Tropical Forest Soil | MRRALIALLLAGAVAVSTTRPAEARWGWGGWGWGLGAFAIGALI |
| Ga0066903_1079976031 | 3300005764 | Tropical Forest Soil | MRRALIAVLLAGALAVSTTKPAEARWGWGWGWGLGAFA |
| Ga0070717_104574683 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRALIALLLAGAVAVSTTKPAEARWGWGGGWGWGIGAFAIGALL |
| Ga0070712_1014401822 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRALIVVLLAGAVAVSTVKPAEARWGWGWGIGAFAIGALLGAALWRPAYAYPAYGYG |
| Ga0075420_1004217641 | 3300006853 | Populus Rhizosphere | LIAALLAGAVAVRDDGGAGALGLRGGWGWGIGAFAIGALLGAALWRPAYAYG |
| Ga0075426_104308531 | 3300006903 | Populus Rhizosphere | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGLGAFAVGALIGAALWRPAYSYYYPAY |
| Ga0066710_1016682661 | 3300009012 | Grasslands Soil | MRRALIAVLLAGAVAVSTSTQAQARWGWGGGWGWGI |
| Ga0099827_114087372 | 3300009090 | Vadose Zone Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGWGLGAFAVGALIG |
| Ga0075418_102614441 | 3300009100 | Populus Rhizosphere | MRRALIAALLAGAVAVSATTEAQARWGWRGGWGWGIGAFAIGALLG |
| Ga0126380_110752472 | 3300010043 | Tropical Forest Soil | MRRALIALLLAGAVAVSTTKPAEARWGWGGWGWGLGAFAIGALIGAALWR |
| Ga0126384_109540172 | 3300010046 | Tropical Forest Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGLGAFAIGALIGAALWRP |
| Ga0134065_104884022 | 3300010326 | Grasslands Soil | MRRALIAMLLAGAVAVSTTKPAEARWGGWGWGFGAFAIGALI |
| Ga0126370_106951942 | 3300010358 | Tropical Forest Soil | MRRALIAVLLAGAMAVSTTKPAEARWGWGWGWGLGAFAIGA |
| Ga0126376_116900842 | 3300010359 | Tropical Forest Soil | MRRTLIVVLLAAAVAVSTAKPAEARWGWGGWGWGLGAFAIGALIGAAL |
| Ga0126376_125766602 | 3300010359 | Tropical Forest Soil | MRRALIALLLAGAVAVSTTKPAEARGGWGWGWGLGAFAIG |
| Ga0126372_100633024 | 3300010360 | Tropical Forest Soil | MRRALIAVLLAGAMAVSTTKPAEARWGWGWGWGLGAFAIGALIGAALWR |
| Ga0126378_107582871 | 3300010361 | Tropical Forest Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGLGAFAIGALIGAA |
| Ga0126378_109947182 | 3300010361 | Tropical Forest Soil | MRRALIAVLLAGAMAVSTTKPAEARWGWGWGWGLG |
| Ga0126379_111357842 | 3300010366 | Tropical Forest Soil | MKRALIALLLAGAVAVSTTKPAEARWGWGWGWGLGAFAVGALIGAALWR |
| Ga0134125_102451821 | 3300010371 | Terrestrial Soil | MRRALIVVLLAGAVAVSTVKPAEARWGWGWGIGAFAIGALLGAALWRPAYS |
| Ga0126383_118600851 | 3300010398 | Tropical Forest Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALIGAALWRPAYSYYY |
| Ga0126383_122204531 | 3300010398 | Tropical Forest Soil | MRRALIAVLLAGAVAVSTTRPGEARWGGGGWGWGLGAF |
| Ga0137378_106109712 | 3300012210 | Vadose Zone Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALIGAALWRPVYAYY* |
| Ga0137387_100896711 | 3300012349 | Vadose Zone Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGLGAFAIGALIGAALWRPAYA |
| Ga0137369_108053291 | 3300012355 | Vadose Zone Soil | MRRALIAVLLAGAVAVSTSTEAQARWGRGWGWGWGIGAFAIGALLGAALWRPAYAYGYPA |
| Ga0137360_111783092 | 3300012361 | Vadose Zone Soil | MRRALIALLLAGAVAVSTTKPAEARWGWGGWGWGLGAFAIGALIGAALWRPAYG |
| Ga0126369_118407772 | 3300012971 | Tropical Forest Soil | MRRALIALLLAGAVAVSTTKPAEARWGWGWGWGLGAFAV |
| Ga0164305_106335981 | 3300012989 | Soil | MRRALIAVLLAGALAVSTTKPAEARWGWGWGWGLGAFAIGALIGAAL |
| Ga0182036_100782471 | 3300016270 | Soil | MRRALIALLLAGAVAVSTTILPESLWGWGWGWGLGAFAIVELIGAALWRPAY |
| Ga0182036_111616521 | 3300016270 | Soil | MRRALIAILLAGAVAVSTTKPAEARWGWGWGWGLGA |
| Ga0182035_100363371 | 3300016341 | Soil | MRRALIALLLAGAVAVSTTKPAEARWGWGWGWGLGA |
| Ga0182035_111941092 | 3300016341 | Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGWGLGA |
| Ga0182032_108358371 | 3300016357 | Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALIG |
| Ga0182032_117596232 | 3300016357 | Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALIGAALWRPAYSY |
| Ga0182034_100706881 | 3300016371 | Soil | MRRALIALLLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALIGAA |
| Ga0182037_101291874 | 3300016404 | Soil | MRRALIALLLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALIG |
| Ga0182039_114144831 | 3300016422 | Soil | MRRALIAVLLASAVAVSTTKPAEARWGWGWGWGLGAFAI |
| Ga0182038_110273411 | 3300016445 | Soil | MRRALIAVLLAGAIAVSTTKPAEARWGWGWGWGLGAFAIGALIGAALW |
| Ga0066667_107071703 | 3300018433 | Grasslands Soil | MRRALIAVLLAGAVALSTTKPAEARWGWGWGWGLGAFAIGALIGAA |
| Ga0126371_124635022 | 3300021560 | Tropical Forest Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGWGLGAF |
| Ga0207684_113430861 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGA |
| Ga0207646_100451745 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRALIAVLLAGAVALSTTKPAEARWGWGWGWGLG |
| Ga0257165_11140372 | 3300026507 | Soil | MRRALIALLLAGAVAVSTTKPAEARWGWGGWGWGLGAFAIGA |
| Ga0179587_102162492 | 3300026557 | Vadose Zone Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGWGLGAFA |
| Ga0209465_105299831 | 3300027874 | Tropical Forest Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALIGAA |
| Ga0318516_107697011 | 3300031543 | Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGLGAFAIGALIG |
| Ga0318538_100220143 | 3300031546 | Soil | MRRALIAVLLAGAIAVSTTKPAEARWGWGWGLGAFAIGALIGAALWRPAYSYY |
| Ga0318571_100223531 | 3300031549 | Soil | MRRALIAILLAGAVAVSTTKPAEARWGWGWGWGLGAFAIG |
| Ga0318571_100476781 | 3300031549 | Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGLGAFAI |
| Ga0318573_101286501 | 3300031564 | Soil | MRRALIAVLLACAVAVSTTKPAEARWGWGWGLGAFAIGALIGAALWRPAYSYYYPAY |
| Ga0318515_100423143 | 3300031572 | Soil | MRRALIALLLAGAVAVSTTKPAEARWGWGWGLGAFAIG |
| Ga0310915_100882693 | 3300031573 | Soil | MRRALIAVLLAGAIAVSTTKPAEARWGWGWGWGLGAFAIGALIGAALWRPAYSYYY |
| Ga0310915_107320583 | 3300031573 | Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALIGAAL |
| Ga0318555_104753432 | 3300031640 | Soil | MRRALIAILLAGAVAVSTTKPAEARWGWGWGWGLG |
| Ga0318542_105941152 | 3300031668 | Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGLGAFAIGALIGAALWRPAYSYYYPAYGYY |
| Ga0318561_104980881 | 3300031679 | Soil | MRRALIALLLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALIGAALWRPAYSYY |
| Ga0318574_100061805 | 3300031680 | Soil | MRRALIAILLAGAVAVSTTKPAEARWGWGWGWGLGAFAI |
| Ga0318572_100897161 | 3300031681 | Soil | MRRALIAILLAGAVAVSTTKPAEARWGWGWGWGLGAF |
| Ga0318537_101655971 | 3300031763 | Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGAL |
| Ga0318509_101169263 | 3300031768 | Soil | MRRALIAILLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGAL |
| Ga0318546_105296131 | 3300031771 | Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGLGAFAIGALI |
| Ga0318543_100028864 | 3300031777 | Soil | MRRALIAVLLAGAIAVSTTKPAEARWGWGWGLGAFAIGALIGAALWRPAYSYYYPAYGY |
| Ga0318543_103725682 | 3300031777 | Soil | MRRALIAVLLACAVAVSTTKPAEARWGWGWGLGAFAIGALIGAALWRPAYSYYY |
| Ga0318566_100662373 | 3300031779 | Soil | MRRALIAILLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALIGA |
| Ga0318547_100668361 | 3300031781 | Soil | MRRALIAVLLACAVAVSTTKPAEARWGWGWGLGAFAIGALI |
| Ga0318552_100843263 | 3300031782 | Soil | MRRALIAVLLAGAIAVSTTKPAEARWGWGWGLGAFAIGALIGAALWRPAYSY |
| Ga0318550_100282744 | 3300031797 | Soil | MRRALIALLLAGAVAVSTTKPAEARWGWGWGLGAFAIGALIGAALW |
| Ga0318568_100518351 | 3300031819 | Soil | MRRALIAVLLAGAIAVSTTKPAEARWGWGWGWGLGAFAIGALIGAALWRPAY |
| Ga0318568_109334442 | 3300031819 | Soil | MRRALIAVLLACAVAVSTTKPAEARWGWGWGLGAFAIGALIGAALWRPAYSYY |
| Ga0318499_101733502 | 3300031832 | Soil | MRRALIAVLLACAVAVSTTKPAEARWGWGWGWGLGAFAIGA |
| Ga0318527_101247731 | 3300031859 | Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGLGAFAIGALIGAALWRPAYSYY |
| Ga0318495_100879101 | 3300031860 | Soil | MRRALIAILLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALIGAALWRPA |
| Ga0306919_100697073 | 3300031879 | Soil | MRRALIAVLLAGAVAVATTKPAEARWGWGWGWGIGAFAIG |
| Ga0318544_100325971 | 3300031880 | Soil | MRRALIAILLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALIGAALWRPAYSYY |
| Ga0310912_100947161 | 3300031941 | Soil | MRRALIALLLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALIGAALWRPAYSYYY |
| Ga0310910_100053035 | 3300031946 | Soil | MRRALIAVLLAGAIAVSTTKPAEARWGWGWGWGLGAFAIGALIGAAL |
| Ga0310909_113281811 | 3300031947 | Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGLGAFAIGALIGAALWRPAYSYYYP |
| Ga0306926_106135491 | 3300031954 | Soil | MRRALIALLLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALIGAALWRPAYSY |
| Ga0306926_127450681 | 3300031954 | Soil | MRRALIALLLAGAVAVSTTKPAEARWGWGWGWGLGAFAIG |
| Ga0318530_100429953 | 3300031959 | Soil | MRRALIAVLLAGAIAVSTTKPAEARWGWGWGWGLGAFAIGALIG |
| Ga0318563_106351662 | 3300032009 | Soil | MRRALIAILLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALIGAAL |
| Ga0318558_100439243 | 3300032044 | Soil | MRRALIAVLLAGAIAVSTTKPAEARWGWGWGLGAFAIGALIGAALW |
| Ga0318506_102695993 | 3300032052 | Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGWGLGAFAI |
| Ga0318570_102580853 | 3300032054 | Soil | MRRALIAVLLAGAVAVSTTKPAEARWGWGWGWGLG |
| Ga0318505_100859193 | 3300032060 | Soil | MRRALIAILLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALIGAALWRPAY |
| Ga0306924_101892454 | 3300032076 | Soil | MRRALIALLLAGAVAVSTTKPAEARWGWGWGLGAF |
| Ga0318518_101329801 | 3300032090 | Soil | MRRALIAVLLACAVAVSTTKPAEARWGWGWGLGAFAI |
| Ga0306920_1006206773 | 3300032261 | Soil | MRRALIAILLAGAVAVSTTKPAEARWGWGWGWGLGAFAIGALIGAALWRP |
| Ga0318519_103692902 | 3300033290 | Soil | MRRALIAVLLACAVAVSTTKPAEARWGWGWGLGAFAIGALIGAA |
| ⦗Top⦘ |