NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092426

Metagenome / Metatranscriptome Family F092426

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092426
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 39 residues
Representative Sequence QNGTSAGTNAALMKKVVAKLSEDDIIAISAYLGSLPPR
Number of Associated Samples 97
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.07 %
% of genes from short scaffolds (< 2000 bps) 90.65 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.981 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(6.542 % of family members)
Environment Ontology (ENVO) Unclassified
(36.449 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(47.664 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 42.42%    β-sheet: 0.00%    Coil/Unstructured: 57.58%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF00753Lactamase_B 9.35
PF01436NHL 2.80
PF13548DUF4126 2.80
PF13360PQQ_2 1.87
PF03450CO_deh_flav_C 1.87
PF04203Sortase 0.93
PF00300His_Phos_1 0.93
PF11455MazE-like 0.93
PF13460NAD_binding_10 0.93
PF14312FG-GAP_2 0.93
PF04909Amidohydro_2 0.93
PF02321OEP 0.93
PF02738MoCoBD_1 0.93
PF02678Pirin 0.93
PF13531SBP_bac_11 0.93
PF00254FKBP_C 0.93
PF13442Cytochrome_CBB3 0.93
PF00724Oxidored_FMN 0.93
PF13343SBP_bac_6 0.93
PF10518TAT_signal 0.93
PF09587PGA_cap 0.93
PF13415Kelch_3 0.93
PF08327AHSA1 0.93
PF02371Transposase_20 0.93
PF01435Peptidase_M48 0.93
PF01609DDE_Tnp_1 0.93
PF12616DUF3775 0.93
PF01416PseudoU_synth_1 0.93
PF01738DLH 0.93
PF13472Lipase_GDSL_2 0.93
PF00440TetR_N 0.93
PF11412DsbC 0.93
PF12680SnoaL_2 0.93
PF08281Sigma70_r4_2 0.93
PF04199Cyclase 0.93
PF00989PAS 0.93
PF03401TctC 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.87
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 0.93
COG0101tRNA U38,U39,U40 pseudouridine synthase TruATranslation, ribosomal structure and biogenesis [J] 0.93
COG1741Redox-sensitive bicupin YhaK, pirin superfamilyGeneral function prediction only [R] 0.93
COG1878Kynurenine formamidaseAmino acid transport and metabolism [E] 0.93
COG19022,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) familyEnergy production and conversion [C] 0.93
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.93
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.93
COG3293TransposaseMobilome: prophages, transposons [X] 0.93
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.93
COG3547TransposaseMobilome: prophages, transposons [X] 0.93
COG3764Sortase (surface protein transpeptidase)Cell wall/membrane/envelope biogenesis [M] 0.93
COG5421TransposaseMobilome: prophages, transposons [X] 0.93
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.93
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.92 %
UnclassifiedrootN/A13.08 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10085849All Organisms → cellular organisms → Bacteria → Proteobacteria1455Open in IMG/M
3300005177|Ga0066690_10267687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1149Open in IMG/M
3300005331|Ga0070670_101732455All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300005459|Ga0068867_100840619All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300005538|Ga0070731_10214017All Organisms → cellular organisms → Bacteria → Proteobacteria1279Open in IMG/M
3300005541|Ga0070733_10406832All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300005548|Ga0070665_100770905All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300005555|Ga0066692_10783828All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300005559|Ga0066700_11122068All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300005563|Ga0068855_100346647All Organisms → cellular organisms → Bacteria1637Open in IMG/M
3300005719|Ga0068861_100113595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2173Open in IMG/M
3300005836|Ga0074470_11081368All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300005844|Ga0068862_101328165All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300006176|Ga0070765_100353022All Organisms → cellular organisms → Bacteria1367Open in IMG/M
3300006237|Ga0097621_100008089All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria7554Open in IMG/M
3300006800|Ga0066660_10044830All Organisms → cellular organisms → Bacteria2842Open in IMG/M
3300006854|Ga0075425_102182665All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300006903|Ga0075426_11290416All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300007004|Ga0079218_13648011All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300009012|Ga0066710_101274949Not Available1139Open in IMG/M
3300009089|Ga0099828_11710617All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300009090|Ga0099827_11609218All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300009093|Ga0105240_10006166All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia17670Open in IMG/M
3300009094|Ga0111539_11876834All Organisms → cellular organisms → Bacteria → Acidobacteria695Open in IMG/M
3300009098|Ga0105245_10855823All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300009148|Ga0105243_12395261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium566Open in IMG/M
3300009177|Ga0105248_10073190All Organisms → cellular organisms → Bacteria3851Open in IMG/M
3300009545|Ga0105237_10257110All Organisms → cellular organisms → Bacteria1749Open in IMG/M
3300009678|Ga0105252_10109579Not Available1116Open in IMG/M
3300009777|Ga0105164_10678928All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300010043|Ga0126380_11792536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7555Open in IMG/M
3300010047|Ga0126382_11208060All Organisms → cellular organisms → Bacteria → Acidobacteria678Open in IMG/M
3300010154|Ga0127503_10974017All Organisms → cellular organisms → Bacteria → Acidobacteria773Open in IMG/M
3300010333|Ga0134080_10574026All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300010343|Ga0074044_10970465All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300010362|Ga0126377_10133343All Organisms → cellular organisms → Bacteria2312Open in IMG/M
3300010366|Ga0126379_13888028All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300010379|Ga0136449_103665931All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300010398|Ga0126383_12908797All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300010400|Ga0134122_13355911All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300010401|Ga0134121_11218161All Organisms → cellular organisms → Bacteria → Acidobacteria753Open in IMG/M
3300010401|Ga0134121_11975106All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300011119|Ga0105246_11811248All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300011120|Ga0150983_12901232All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300012200|Ga0137382_10881690All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300012201|Ga0137365_10216980All Organisms → cellular organisms → Bacteria1428Open in IMG/M
3300012923|Ga0137359_11015873Not Available711Open in IMG/M
3300012925|Ga0137419_10762912All Organisms → cellular organisms → Bacteria → Acidobacteria789Open in IMG/M
3300012925|Ga0137419_11872301All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21514Open in IMG/M
3300012972|Ga0134077_10360640All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300013297|Ga0157378_10015235All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6733Open in IMG/M
3300013297|Ga0157378_11314963All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium764Open in IMG/M
3300014167|Ga0181528_10898114Not Available501Open in IMG/M
3300014745|Ga0157377_11400944All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300014969|Ga0157376_10854570All Organisms → cellular organisms → Bacteria → Acidobacteria925Open in IMG/M
3300014969|Ga0157376_11737234All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria659Open in IMG/M
3300015371|Ga0132258_12617293All Organisms → cellular organisms → Bacteria → Acidobacteria1260Open in IMG/M
3300015373|Ga0132257_103083819All Organisms → cellular organisms → Bacteria → Acidobacteria607Open in IMG/M
3300015374|Ga0132255_101387070All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1061Open in IMG/M
3300015374|Ga0132255_103637141All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300015374|Ga0132255_104269956All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium606Open in IMG/M
3300016387|Ga0182040_10140927Not Available1704Open in IMG/M
3300016387|Ga0182040_10517721All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria955Open in IMG/M
3300018000|Ga0184604_10121073All Organisms → cellular organisms → Bacteria835Open in IMG/M
3300018037|Ga0187883_10660045All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300018433|Ga0066667_10553176All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium955Open in IMG/M
3300018466|Ga0190268_12350008Not Available504Open in IMG/M
3300018481|Ga0190271_13884859All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300020580|Ga0210403_11393825Not Available531Open in IMG/M
3300022718|Ga0242675_1106369Not Available546Open in IMG/M
3300025907|Ga0207645_10903165All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300025912|Ga0207707_10200648All Organisms → cellular organisms → Bacteria1739Open in IMG/M
3300025912|Ga0207707_10823646All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300025924|Ga0207694_11113756All Organisms → cellular organisms → Bacteria → Acidobacteria668Open in IMG/M
3300025927|Ga0207687_11183021Not Available657Open in IMG/M
3300025939|Ga0207665_10261454All Organisms → cellular organisms → Bacteria1282Open in IMG/M
3300025949|Ga0207667_10570776All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300026023|Ga0207677_11050752All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300026067|Ga0207678_10019942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales5892Open in IMG/M
3300026089|Ga0207648_10581557All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1031Open in IMG/M
3300026116|Ga0207674_11272031All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300026121|Ga0207683_11967859All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300026142|Ga0207698_12231498All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300026532|Ga0209160_1103331All Organisms → cellular organisms → Bacteria → Acidobacteria1438Open in IMG/M
3300027682|Ga0209971_1127114All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions627Open in IMG/M
3300027842|Ga0209580_10399360All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria685Open in IMG/M
3300027876|Ga0209974_10086416All Organisms → cellular organisms → Bacteria1084Open in IMG/M
3300027911|Ga0209698_11270018All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300028800|Ga0265338_11028674All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300028906|Ga0308309_11363466All Organisms → cellular organisms → Bacteria → Acidobacteria609Open in IMG/M
3300029943|Ga0311340_11130837Not Available635Open in IMG/M
3300031421|Ga0308194_10103906All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium821Open in IMG/M
3300031525|Ga0302326_10161317All Organisms → cellular organisms → Bacteria3833Open in IMG/M
3300031525|Ga0302326_12142716Not Available716Open in IMG/M
3300031708|Ga0310686_104297094All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300031720|Ga0307469_12230776Not Available533Open in IMG/M
3300031724|Ga0318500_10710908All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300031788|Ga0302319_10251798Not Available2139Open in IMG/M
3300031820|Ga0307473_11133742All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300031912|Ga0306921_11931777All Organisms → cellular organisms → Bacteria → Proteobacteria631Open in IMG/M
3300031945|Ga0310913_10529205All Organisms → cellular organisms → Bacteria → Acidobacteria837Open in IMG/M
3300031962|Ga0307479_11048283All Organisms → cellular organisms → Bacteria → Acidobacteria783Open in IMG/M
3300031962|Ga0307479_11072114All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300032059|Ga0318533_10396314All Organisms → cellular organisms → Bacteria1008Open in IMG/M
3300032060|Ga0318505_10569028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum533Open in IMG/M
3300032829|Ga0335070_11080676Not Available739Open in IMG/M
3300032954|Ga0335083_10449227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → unclassified Ilumatobacter → Ilumatobacter sp.1090Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.74%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.74%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.74%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.80%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.80%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.87%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.87%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.87%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.87%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.87%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.93%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.93%
WastewaterEnvironmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater0.93%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.93%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.93%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.93%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009777Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking waterEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300022718Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300027682Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1008584913300000567Peatlands SoilARQLICIQNGSSDGTTVEPMKKVVANLSEDDIIAISAYLGSLPPK*
Ga0066690_1026768713300005177SoilICMQNGASAGTAAALMKKVVANLSEDDIISISAYLGSLPPR*
Ga0070670_10173245513300005331Switchgrass RhizosphereVYLARQLIMMRNGSSAGQAAQLMQQVVARLSEDDIISISAYLGSLPPQ*
Ga0068867_10084061913300005459Miscanthus RhizosphereQLITMQNGTSAGANAALMKKPVAKLSEDDIIAISAYLGSLPPR*
Ga0070731_1021401713300005538Surface SoilICIQNGSSAGAAVAPMKKVVANLSEDDIIAISAYLGSLPPQ*
Ga0070733_1040683233300005541Surface SoilRQLICIQNGSSAGAAVAPMKKVVTNLSEDDIIAISAYLGSLSPR*
Ga0070665_10077090523300005548Switchgrass RhizosphereSAGANAALMKKAVAKLSEDDIISISAYLGSLPPR*
Ga0066692_1078382823300005555SoilLFDLQYGSSAGKAAALMKRAVASLSEDDIIAISAYLGSLSPE*
Ga0066700_1112206813300005559SoilARQLIGIQNGSSNGTAVALMKKPVAKLSEDDIISIAAYLGSLPPTTNH*
Ga0068855_10034664713300005563Corn RhizosphereTSAGTNAALMKKAVAKLSEDDIISISAYLGSLPPR*
Ga0068861_10011359543300005719Switchgrass RhizosphereYIARQLITMQNGTSAGANAVLMKKPVAKLSEDDIIAISAYLGSLPPR*
Ga0074470_1108136813300005836Sediment (Intertidal)GSSAGTAAGLMKKVVEKLSEDDIIAISAYVGSLPPQ*
Ga0068862_10132816523300005844Switchgrass RhizosphereTARQLFYMQHGSSAGKAVALMTRVVEKLSERDVIDISAYLGSLPPR*
Ga0070765_10035302213300006176SoilSAGTAVALMKKVVSNLSEDDIISISAYLGSLPPQ*
Ga0097621_10000808913300006237Miscanthus RhizosphereSMENGSSAGTNSAPMKPVVAKLSEDDVIAISAYLGSLPPR*
Ga0066660_1004483013300006800SoilIARQLISMQNGSSAGTAVALMKKTVSNLSEDDTISISAYLGSLPP*
Ga0075425_10218266513300006854Populus RhizosphereYGSSAGKAAALMKAVVTNLSDEDIIAISAYVGSLPPQ*
Ga0075426_1129041613300006903Populus RhizosphereSAGANAALMKKPLAKLTEDDIIAISAYLGSLSPR*
Ga0079218_1364801113300007004Agricultural SoilNGTSAGANAALMKKVVANLSEDEIIALSAYLGSLSPR*
Ga0066710_10127494913300009012Grasslands SoilHGRSAGKAAELMKPVVASLSDDDIIAISSYLGSLPPQ
Ga0099828_1171061723300009089Vadose Zone SoilITIQNGASAGTAVALMKKAVANLSEDDIISISAYLGSLAP*
Ga0099827_1160921813300009090Vadose Zone SoilMRYGSSAGKAAALMKAVVTNLAEDDIIAISAYVASLPPQ*
Ga0105240_1000616613300009093Corn RhizosphereSAGTNAALMKKAVANLSEDDIIAISAYLGSLTPQ*
Ga0111539_1187683413300009094Populus RhizosphereSAGKAAALMKKVVSNLSEDDIISISAYLGSLPPR*
Ga0105245_1085582323300009098Miscanthus RhizosphereQNGSSAGTNAALMKKAVANLTEDDIISISAYLRTLSPQ*
Ga0105243_1239526113300009148Miscanthus RhizosphereIQNGSSAGTAVALMKKAVANLSEDDIISISAYLGSLSPH*
Ga0105248_1007319013300009177Switchgrass RhizosphereLITMQNGTSAGANAALMKKVVAKLSEDDIIALSAYVGSLPPK*
Ga0105237_1025711013300009545Corn RhizosphereQLIQMQNGSSAGANAALMKKAVANLTEDDIISISAYLGTLTPQ*
Ga0105252_1010957913300009678SoilTSAGANAALMKKAVEKLSEDEIIALSAYLGSLPPR*
Ga0105164_1067892823300009777WastewaterIQNGSSAGTASALMKKAVANLSEDDIISISAYLGSLPPQ*
Ga0126380_1179253623300010043Tropical Forest SoilSSAGKAAELMKPVVANLSEDDIIAISSYLGSLPPQ*
Ga0126382_1120806013300010047Tropical Forest SoilSAGTNAALMKKVVAKLSEDDIIAISAYLGSLPPR*
Ga0127503_1097401713300010154SoilARQLFDIQYGSSAGKAVALMKGPVAHLTEDDIIAISAYLGSLTP*
Ga0134080_1057402613300010333Grasslands SoilLMTMQNGTSAGANAALMKKPVSKLSEDDIISISAYLGSLPSQ*
Ga0074044_1097046513300010343Bog Forest SoilMDIQNGTSAGKAVALMKNVVAKLSEDEIIAISAYVGTLPPQ*
Ga0126377_1013334313300010362Tropical Forest SoilRSAGKAAELMKPVVASLSDDDIIAISSYLGSLPPQ*
Ga0126379_1388802813300010366Tropical Forest SoilSAGASSAPMQPTVAKLSEDDVIAISAYLGSLPPR*
Ga0136449_10366593113300010379Peatlands SoilQLICMQNGSSAGTAAALMKKVVANLSEDDIIAISAYLGSLPPQ*
Ga0126383_1290879713300010398Tropical Forest SoilFQNNSRVGASSLLMKPVVAKLTEDDMIAISAYLGSLAE*
Ga0134122_1335591113300010400Terrestrial SoilITMQNGTSAGANAALMKKPVSKLSEDDIIAISAYLGSLPPR*
Ga0134121_1121816123300010401Terrestrial SoilWLFDMRYGSSAGKAAALMKAVVTNLSEDDIIAISSYVASLPPQ*
Ga0134121_1197510613300010401Terrestrial SoilDIQYGSSNGKAVALMKGPVAKLKEDDIIAISAYLGSLRPE*
Ga0105246_1181124813300011119Miscanthus RhizosphereQNGTSAGTNAALMKKAVAKLSEDDIISISAYLGSLPPR*
Ga0150983_1290123223300011120Forest SoilQLFDIQYGSSAGKAVELMKGPVAHLTEDDIIAISAYLGSLVLE*
Ga0137382_1088169013300012200Vadose Zone SoilLICIQIGSSAGTAAALMKKVVSNLSEDDIIAISAYLGSLPPQ*
Ga0137365_1021698023300012201Vadose Zone SoilQNGTSAGANAALMKKVVVNLSEDDIIALSAYLGSLPPR*
Ga0137359_1101587323300012923Vadose Zone SoilSRGGKEVEPMKPVVANLSEDDIIAISSYLGSLPPA*
Ga0137419_1076291213300012925Vadose Zone SoilRQLICIQNGSSAGIAVALMKKAVSNLSEDDIISISAYLGSLPPQ*
Ga0137419_1187230113300012925Vadose Zone SoilSAGKAAALMKRAVASISEDDIIAISAYLGSLSPE*
Ga0134077_1036064013300012972Grasslands SoilGSSAGKAAALMKRAVASLSEDDIIAISAYLGSLSPE*
Ga0157378_1001523593300013297Miscanthus RhizosphereICLQNGTSAGTNAALMKKAVAKLSEDDIISISAYLGSLPPR*
Ga0157378_1131496333300013297Miscanthus RhizosphereQLFDLQYGSSAGKAAALMKRAVEHLSEDDIIAISAYLGSLAPR*
Ga0181528_1089811413300014167BogQLICIQNGASAGVAVELMKKVVSNLSEDDIIAISAYLGTLPPK*
Ga0157377_1140094423300014745Miscanthus RhizosphereQNGTSAGTNAALMKKVVAKLSEDDIIAISAYLGSLPPR*
Ga0157376_1085457013300014969Miscanthus RhizosphereQMQNGTSAGANAALMKKVVAKLTEDDIIAISAYLGSLPPR*
Ga0157376_1173723413300014969Miscanthus RhizosphereLITMQNGTSAGANAALMKKVVAKLSEDDVIALSAYLGSLPPK*
Ga0132258_1261729313300015371Arabidopsis RhizosphereSAGTAAALMKKAVANLSEDDIISISAYLGSLPPQ*
Ga0132257_10308381923300015373Arabidopsis RhizosphereSAGANAALMNRVVAKLTEDDIISLAAYVGSLPPK*
Ga0132255_10138707013300015374Arabidopsis RhizosphereMQNGASAGTNAALMKKVVAKLSEEDIIAISAYLGSLPPR*
Ga0132255_10363714123300015374Arabidopsis RhizosphereLICMQNGTSAGTAAALMKKAVANLSEDDIISISAYLGSLPPQ*
Ga0132255_10426995623300015374Arabidopsis RhizosphereSAGKAAALMKAVVVNLTDDDIIAISAYVASLPPQ*
Ga0182040_1014092723300016387SoilGSSAGKAAEAMKPVVANLTEDDIIAISSYLGSLPPQ
Ga0182040_1051772113300016387SoilSSAGKAAALMKPVVANLSEDDIIAIASYLGSLPPQ
Ga0184604_1012107313300018000Groundwater SedimentRQLITMQNGTSAGANAALMKKPVSKLSEDDIIAISAYLGSLPPR
Ga0187883_1066004513300018037PeatlandGSSAGVAVELMKKVVSDLSEDDIIAISAYLGSLPPR
Ga0066667_1055317613300018433Grasslands SoilTSAAAKATLMKKPVSKLSEDDIIWISAYLGSLPPE
Ga0190268_1235000813300018466SoilRQLITIQNGTNAGTAVALMKKVVAHLSEEDIISISAYLGSLPPQ
Ga0190271_1388485913300018481SoilNGSSAGTNSAPMKPAVANLSEDDVIAISAYLGSLPPR
Ga0210403_1139382513300020580SoilNGSRNGADDASMKKVVEKLSVDDIIAISAYLGSLPPQ
Ga0242675_110636923300022718SoilSSAGKAAELIKPVVANLSEDDIIAISSYLGSLPPQ
Ga0207645_1090316523300025907Miscanthus RhizosphereRQLFYMQHGSSAGKAVALMTRVVEKLSERDVIDISAYLGSLPPR
Ga0207707_1020064823300025912Corn RhizosphereQLITMQNGTSAGANAALMKRVVAKLSEDDIISLSAYLGSLPPK
Ga0207707_1082364623300025912Corn RhizosphereQLICLQNGTSAGANAALMKKAVAKLSEDDIISISAYLGSLPPR
Ga0207694_1111375613300025924Corn RhizosphereLFDLQYGSSAGKAAALMKKTVTGLSEDDIINISAYLGSLPPQ
Ga0207687_1118302113300025927Miscanthus RhizosphereFGSSAGKAAALMKAVVRNLSDDDIIALAAYVGSLPPQ
Ga0207665_1026145433300025939Corn, Switchgrass And Miscanthus RhizosphereQLICLQNGSSAGTNAALMKKAVANLSEDDIIAISAYLGTLPPQ
Ga0207667_1057077613300025949Corn RhizosphereGTSAGTNAALMKKAVAKLSEDDIISISAYLGSLPPR
Ga0207677_1105075223300026023Miscanthus RhizosphereLICLQNGTSAGTNAALMKKAVAKLSEDDIISISAYLGSLPPR
Ga0207678_1001994263300026067Corn RhizosphereYTARQLFYMQHGSSAGKAVALMKGVVGKLSERDIIDISAYLGSLPPR
Ga0207648_1058155713300026089Miscanthus RhizosphereARQLISMQNGSSAGTNSTLMKPAVANLSEDDVIAIAAYLGSLPPR
Ga0207674_1127203113300026116Corn RhizosphereTSAGTNAALMKKAVAKLSEDDIISISAYLGSLPPR
Ga0207683_1196785913300026121Miscanthus RhizosphereSSAGKAAALMKAVVTNLSEDDIIAISAYVASLPPH
Ga0207698_1223149823300026142Corn RhizosphereLICMQNGTSAGTAAALMKKAVANLSEDDIISISAYLGSLPPQ
Ga0209160_110333123300026532SoilQNGASAGTAAALMKKVVANLSEDDIISISAYLGSLPPR
Ga0209971_112711413300027682Arabidopsis Thaliana RhizosphereYGSSAGKAAELMKAAVKNLSDDDIIAISSYLGSLPPQ
Ga0209580_1039936013300027842Surface SoilDMQYGSSSGKAAEPMKPVVANLKEDDIIAISAYLGSLPPQ
Ga0209974_1008641623300027876Arabidopsis Thaliana RhizosphereLARQLISMQNGSSAGTNSTLMKPAVANLSEDDVIAIAAYLGSLPPR
Ga0209698_1127001823300027911WatershedsLSAGSASAPMKKVVANLSEDDIIAISAYLGSLPPQ
Ga0265338_1102867413300028800RhizosphereGSSAGTAVALMKKPVAHLSEDDIIAISAYLGSLPPK
Ga0308309_1136346623300028906SoilSSAGKAAALMKAVVANLSEDDIIAISASVASLPPQ
Ga0311340_1113083723300029943PalsaLICMQNGSSAGKAAALMKKAVANLSEDDIIAISAYLGSLPPQ
Ga0308194_1010390613300031421SoilLFDLRYGSSAGKAAALMKRAVASLSEDDIIAISAYLGSLSPE
Ga0302326_1016131753300031525PalsaQYGSSAGRAAALMKRAVANLSEDDIIAISAYLGSLPPQ
Ga0302326_1214271623300031525PalsaNGSSAGTAVALMKKAVAGLSEDDIIAISAYVGSLPPR
Ga0310686_10429709413300031708SoilARQLILMQNGSSAGTAAALMKKVVANLSEDDIIAISSYLGSLPPQ
Ga0307469_1223077613300031720Hardwood Forest SoilASGGANAALMKKPVAKLTEEDIIAIAAYLGSLPPH
Ga0318500_1071090813300031724SoilLFDIQYGSSAGKAVALMKGPVAHLTEDDIIAISAYLGSLAPE
Ga0302319_1025179833300031788BogDKQGLSGSASLLMQPVVAKLTMDDMIAISAYVASLPP
Ga0307473_1113374223300031820Hardwood Forest SoilSMQNGSSAGTNSALMKPAVANLSENDVIAIAAYLGSLPPR
Ga0306921_1193177723300031912SoilLFDMQYGSSAGAAAAAMKPVVANLNEDDIIAISSYLGSLPPK
Ga0310913_1052920513300031945SoilLQYGSSAGKAAALMKRAVASLSEDDIIAISAYLGSLSPR
Ga0307479_1104828323300031962Hardwood Forest SoilSSAGTAAALMKKVVANLSEDDIISISAYLGSLPPR
Ga0307479_1107211413300031962Hardwood Forest SoilGSSAGVNTALMKKAVANLTEDDIISISAYLGALAPQ
Ga0318533_1039631423300032059SoilTMQNGTSAGVNAALMKKVVANLSEDDVIALSAYLGSLPPR
Ga0318505_1056902813300032060SoilSRTGDAATPMKPVVANLSDEDIIAISSYLGSLSPS
Ga0335070_1108067623300032829SoilGMQKGSSAGSSSAPMKPVVAKLSEDDVIAISAYLGSLPPR
Ga0335083_1044922733300032954SoilICIQNGSSAGTAVALMKKVVARLSEDDVIAISAYLGSLPPR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.