NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092424

Metagenome / Metatranscriptome Family F092424

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092424
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 64 residues
Representative Sequence DGTLDWGYFQINTVHLKRAGVNLRSLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRTF
Number of Associated Samples 98
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.07 %
% of genes from short scaffolds (< 2000 bps) 89.72 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.589 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(10.280 % of family members)
Environment Ontology (ENVO) Unclassified
(23.364 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(29.907 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.26%    β-sheet: 0.00%    Coil/Unstructured: 63.74%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF00589Phage_integrase 2.80
PF00326Peptidase_S9 2.80
PF13620CarboxypepD_reg 2.80
PF13561adh_short_C2 1.87
PF00696AA_kinase 1.87
PF13442Cytochrome_CBB3 1.87
PF12867DinB_2 1.87
PF12543DUF3738 0.93
PF01039Carboxyl_trans 0.93
PF01261AP_endonuc_2 0.93
PF07642BBP2 0.93
PF07676PD40 0.93
PF12836HHH_3 0.93
PF00990GGDEF 0.93
PF13599Pentapeptide_4 0.93
PF14602Hexapep_2 0.93
PF12704MacB_PCD 0.93
PF02687FtsX 0.93
PF02746MR_MLE_N 0.93
PF13676TIR_2 0.93
PF13240zinc_ribbon_2 0.93
PF09924LPG_synthase_C 0.93
PF11994DUF3489 0.93
PF00132Hexapep 0.93
PF02882THF_DHG_CYH_C 0.93
PF05168HEPN 0.93
PF00106adh_short 0.93
PF00188CAP 0.93
PF01436NHL 0.93
PF13847Methyltransf_31 0.93
PF04343DUF488 0.93
PF01042Ribonuc_L-PSP 0.93
PF08837DUF1810 0.93
PF04966OprB 0.93
PF11175DUF2961 0.93
PF00248Aldo_ket_red 0.93
PF01494FAD_binding_3 0.93
PF13360PQQ_2 0.93
PF01980TrmO 0.93
PF01909NTP_transf_2 0.93
PF02195ParBc 0.93
PF04951Peptidase_M55 0.93
PF07843DUF1634 0.93
PF00289Biotin_carb_N 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG4948L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamilyCell wall/membrane/envelope biogenesis [M] 1.87
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.87
COG1720tRNA (Thr-GGU) A37 N6-methylaseTranslation, ribosomal structure and biogenesis [J] 0.93
COG5579Uncharacterized conserved protein, DUF1810 familyFunction unknown [S] 0.93
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 0.93
COG4272Uncharacterized membrane proteinFunction unknown [S] 0.93
COG3659Carbohydrate-selective porin OprBCell wall/membrane/envelope biogenesis [M] 0.93
COG3189Uncharacterized conserved protein YeaO, DUF488 familyFunction unknown [S] 0.93
COG2340Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domainCell cycle control, cell division, chromosome partitioning [D] 0.93
COG2250HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.93
COG1895HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.93
COG01905,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolaseCoenzyme transport and metabolism [H] 0.93
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 0.93
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 0.93
COG0686Alanine dehydrogenase (includes sporulation protein SpoVN)Amino acid transport and metabolism [E] 0.93
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.93
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.93
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.93
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.59 %
UnclassifiedrootN/A8.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004081|Ga0063454_101200631All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300004803|Ga0058862_12342976All Organisms → cellular organisms → Bacteria791Open in IMG/M
3300005180|Ga0066685_10718086All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6684Open in IMG/M
3300005434|Ga0070709_11735887All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300005436|Ga0070713_102111643All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6546Open in IMG/M
3300005530|Ga0070679_100718320All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300005548|Ga0070665_101910466Not Available599Open in IMG/M
3300005712|Ga0070764_10944436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae542Open in IMG/M
3300005843|Ga0068860_101194967All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6781Open in IMG/M
3300006176|Ga0070765_100431044All Organisms → cellular organisms → Bacteria1234Open in IMG/M
3300006176|Ga0070765_102034721All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300006358|Ga0068871_100141022All Organisms → cellular organisms → Bacteria2049Open in IMG/M
3300006358|Ga0068871_101020677All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300006642|Ga0075521_10220316All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300006903|Ga0075426_10093399All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA62155Open in IMG/M
3300009093|Ga0105240_10051612All Organisms → cellular organisms → Bacteria5173Open in IMG/M
3300009093|Ga0105240_10730992Not Available1078Open in IMG/M
3300009098|Ga0105245_13151868All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300009545|Ga0105237_10604161All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61104Open in IMG/M
3300009694|Ga0116170_10637477All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300009701|Ga0116228_10136915All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1791Open in IMG/M
3300009709|Ga0116227_10852782All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans686Open in IMG/M
3300009759|Ga0116101_1109787All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae647Open in IMG/M
3300009826|Ga0123355_11407363All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6689Open in IMG/M
3300010358|Ga0126370_11130137All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis724Open in IMG/M
3300010361|Ga0126378_11054348All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300010366|Ga0126379_13453766All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6529Open in IMG/M
3300010375|Ga0105239_12538449All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans597Open in IMG/M
3300012189|Ga0137388_11881608All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6529Open in IMG/M
3300012202|Ga0137363_10685625All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3867Open in IMG/M
3300012353|Ga0137367_10813968All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales648Open in IMG/M
3300012923|Ga0137359_10973948All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans729Open in IMG/M
3300012986|Ga0164304_11634338All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli538Open in IMG/M
3300013306|Ga0163162_12826174All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300014156|Ga0181518_10017038All Organisms → cellular organisms → Bacteria5177Open in IMG/M
3300014156|Ga0181518_10115065All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1482Open in IMG/M
3300014158|Ga0181521_10022338All Organisms → cellular organisms → Bacteria5189Open in IMG/M
3300014159|Ga0181530_10316803Not Available814Open in IMG/M
3300014164|Ga0181532_10022141All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4578Open in IMG/M
3300014201|Ga0181537_10941980All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis585Open in IMG/M
3300014201|Ga0181537_11015838All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300014493|Ga0182016_10243901All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300014655|Ga0181516_10330877All Organisms → cellular organisms → Bacteria775Open in IMG/M
3300014657|Ga0181522_10532092All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300015264|Ga0137403_10070312All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA33556Open in IMG/M
3300016294|Ga0182041_10008621All Organisms → cellular organisms → Bacteria → Acidobacteria5703Open in IMG/M
3300016294|Ga0182041_10465681All Organisms → cellular organisms → Bacteria → Proteobacteria1089Open in IMG/M
3300016294|Ga0182041_12266234All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis508Open in IMG/M
3300017942|Ga0187808_10422346All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis611Open in IMG/M
3300017948|Ga0187847_10205136All Organisms → cellular organisms → Bacteria1074Open in IMG/M
3300018008|Ga0187888_1090188All Organisms → cellular organisms → Bacteria → Acidobacteria1320Open in IMG/M
3300018016|Ga0187880_1294449All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6701Open in IMG/M
3300018042|Ga0187871_10460050All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6703Open in IMG/M
3300018043|Ga0187887_10287759Not Available971Open in IMG/M
3300018044|Ga0187890_10256097All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6985Open in IMG/M
3300018047|Ga0187859_10624771All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300018468|Ga0066662_12515594All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae543Open in IMG/M
3300018481|Ga0190271_11971861All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300019240|Ga0181510_1231576All Organisms → cellular organisms → Bacteria → Acidobacteria1044Open in IMG/M
3300019789|Ga0137408_1278723All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300020579|Ga0210407_10359651All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300021388|Ga0213875_10109227All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans1291Open in IMG/M
3300021407|Ga0210383_11655019All Organisms → cellular organisms → Bacteria → Acidobacteria525Open in IMG/M
3300021432|Ga0210384_10833931All Organisms → cellular organisms → Bacteria → Acidobacteria821Open in IMG/M
3300021477|Ga0210398_11215953All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium595Open in IMG/M
3300022533|Ga0242662_10093699All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300025913|Ga0207695_10500315All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61097Open in IMG/M
3300025927|Ga0207687_10382050All Organisms → cellular organisms → Bacteria → Acidobacteria1154Open in IMG/M
3300025928|Ga0207700_11551281Not Available587Open in IMG/M
3300027773|Ga0209810_1197405All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium803Open in IMG/M
3300027863|Ga0207433_10041669All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5225Open in IMG/M
3300028047|Ga0209526_10919636All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300028379|Ga0268266_10223129All Organisms → cellular organisms → Bacteria1733Open in IMG/M
3300028765|Ga0302198_10450017All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300028785|Ga0302201_10070671All Organisms → cellular organisms → Bacteria1650Open in IMG/M
3300028866|Ga0302278_10303807All Organisms → cellular organisms → Bacteria → Acidobacteria740Open in IMG/M
3300029883|Ga0311327_10242007All Organisms → cellular organisms → Bacteria → Acidobacteria1205Open in IMG/M
3300029945|Ga0311330_10975517All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6628Open in IMG/M
3300029952|Ga0311346_11195039All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6594Open in IMG/M
3300030041|Ga0302274_10103958All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1528Open in IMG/M
3300030051|Ga0302195_10033240All Organisms → cellular organisms → Bacteria3097Open in IMG/M
3300030580|Ga0311355_11211744All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6666Open in IMG/M
3300030659|Ga0316363_10160474All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6958Open in IMG/M
3300031231|Ga0170824_119137149All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300031236|Ga0302324_101391568All Organisms → cellular organisms → Bacteria → Acidobacteria919Open in IMG/M
3300031238|Ga0265332_10059652All Organisms → cellular organisms → Bacteria → Acidobacteria1633Open in IMG/M
3300031250|Ga0265331_10312668All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia704Open in IMG/M
3300031261|Ga0302140_10292775All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1385Open in IMG/M
3300031261|Ga0302140_10384245All Organisms → cellular organisms → Bacteria → Acidobacteria1141Open in IMG/M
3300031463|Ga0272448_1093486All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1947Open in IMG/M
3300031708|Ga0310686_104717731All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6610Open in IMG/M
3300031754|Ga0307475_11365248All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis547Open in IMG/M
3300031788|Ga0302319_11774753All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6534Open in IMG/M
3300031795|Ga0318557_10212890All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300031939|Ga0308174_10593622All Organisms → cellular organisms → Bacteria → Acidobacteria916Open in IMG/M
3300032041|Ga0318549_10186291All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300032060|Ga0318505_10479059All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6588Open in IMG/M
3300032068|Ga0318553_10727929All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300032783|Ga0335079_11201912All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia762Open in IMG/M
3300032805|Ga0335078_10641281Not Available1330Open in IMG/M
3300032805|Ga0335078_11771569All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300032829|Ga0335070_10934290Not Available802Open in IMG/M
3300032897|Ga0335071_10289377All Organisms → cellular organisms → Bacteria1592Open in IMG/M
3300032954|Ga0335083_11417516All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6530Open in IMG/M
3300033550|Ga0247829_10752973Not Available811Open in IMG/M
3300033888|Ga0334792_074335All Organisms → cellular organisms → Bacteria → Acidobacteria991Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog10.28%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog8.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.41%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland7.48%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.61%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere4.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.87%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.87%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.87%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.87%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated1.87%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.93%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.93%
Hot SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring0.93%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.93%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.93%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.93%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.93%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.93%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.93%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.93%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.93%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.93%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.93%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.93%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004803Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009694Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaGEngineeredOpen in IMG/M
3300009701Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300009709Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009759Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10EnvironmentalOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019240Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021388Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8Host-AssociatedOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027863Hot spring thermophilic microbial communities from Obsidian Pool, Yellowstone National Park, USA - OP-RAMG-01 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028765Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2EnvironmentalOpen in IMG/M
3300028785Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2EnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300030041Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1EnvironmentalOpen in IMG/M
3300030051Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2EnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031238Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaGHost-AssociatedOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031463Hot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-019-1EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033888Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0063454_10120063113300004081SoilYHYNADGTLDWGYFQINTVHLKRPGLNLRDLLDCRANIDFAYQLYMENHGFTPWATFNSGLYRRYLRD*
Ga0058862_1234297613300004803Host-AssociatedTNGTLDWGYFQINTVHLQRPGVNLRDLLDCKANIDFAYQLYVERGFDAWSTYKSGAYLQHLRKF*
Ga0066685_1071808623300005180SoilSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYKERGFEPWTTYNSGAYRQFLRQR*
Ga0070709_1173588713300005434Corn, Switchgrass And Miscanthus RhizosphereNGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYQERGDFSAWSTYNSGIYRRFLRR*
Ga0070713_10211164323300005436Corn, Switchgrass And Miscanthus RhizosphereCEIYHYNSDGTLDWGYFQINTIHLKRPGVNLRGLLDCKANIDFAYQLYTERGFEPWTTFRDGAYRKFLSKF*
Ga0070679_10071832023300005530Corn RhizosphereTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYKEKGGFSPWSTFNNGAYRQFIGP*
Ga0070665_10191046623300005548Switchgrass RhizosphereDWGYFQINTVHLKRAGVNLRNLLDCKANIDFAFQLYQERGFAPWSTYNSGAYQQFLRNH*
Ga0070764_1094443623300005712SoilDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLFQDKHGFSAWSTYTSGKYRQFLNPH*
Ga0068860_10119496723300005843Switchgrass RhizosphereYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCRANIDFAYQLYQESHGFTPWSTYNSGKYRQFLKSR*
Ga0070765_10043104413300006176SoilQGKCEIYHYNTDGTLDWGYFQINTVHLERPGLNLRDLLDCKANIDFAYRLFEEKHGFTAWSTYNSGKYRQFMESR*
Ga0070765_10203472113300006176SoilSDGTLDWGYFQVNTVHLKRAGVNLRDLLDCKANIDFAYRLYMERGFAAWSTFNSGAYLQFLKKF*
Ga0068871_10014102213300006358Miscanthus RhizosphereDWGYFQINTVHLKRAGVNLRNLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRNF*
Ga0068871_10102067723300006358Miscanthus RhizosphereGTLDWGYFQINTVHLKRPGLNLRDLLGCKSNIDFAYQLFQEEGGFTPWSTYNSGRYRQFLTQ*
Ga0075521_1022031623300006642Arctic Peat SoilWGYFQINTVHLTRVGLNLRDLLDCRANIDFAYQLYQERGFQPWSTFNNGAYRRFLRGP*
Ga0075426_1009339913300006903Populus RhizosphereFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYTERGFESWTAFNNGAYRQFLRKL*
Ga0105240_1005161273300009093Corn RhizosphereSDGTLDWGYFQINTVHLKRPGLNLRDLLDCRANIDFAYQLYQESHGFTPWSTYNSGKYRQFLKSR*
Ga0105240_1073099243300009093Corn RhizosphereDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYRERGGFTPWSTYNSGMYRRFLGPE*
Ga0105245_1315186823300009098Miscanthus RhizosphereWGYFQINTVHLKRPGINLRDLLDCKANIDFAYQLYKEKGGFSPWSTFNNGAYRHFIGP*
Ga0105237_1060416133300009545Corn RhizosphereWGYFQINTIHLKRPGMNLRSLLDCKANIDFAYQLYTERGFEPWTTFRDGAYRKFLSKF*
Ga0116170_1063747723300009694Anaerobic Digestor SludgeDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYKERGGFTPWSTYKDGRYLRYMRQ*
Ga0116228_1013691563300009701Host-AssociatedPQGKCEIYHYNTDGTLDWGYFQINTVHLQRPGLVLRDLLDCRANIDFAYLLYTEHHGFSPWSTYNSGAYRKFLHQ*
Ga0116227_1085278223300009709Host-AssociatedPQGKCEIYHYNTDGTLDWGYFQINTVHLQRPGLVLRDLLDCRANIDFAYQLYTEHHGFSPWSTYNSGAYRKFLRQ*
Ga0116101_110978713300009759PeatlandACEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYKLYTERGFEPWTTFNSGAYRQFLRRF*
Ga0123355_1140736313300009826Termite GutIYHYNSDGTLDWGYFQINTVHLKRAEVNLRGLLDCRANIDFAYQLYMEHGFEPWTTYRSGAYLQFLHNF*
Ga0126370_1113013713300010358Tropical Forest SoilWGYFQINTVHLKRPGVNLRGLLDCRANIDFAYQLYTERGFEPWTTYRDGLYLKYLRNF*
Ga0126378_1105434823300010361Tropical Forest SoilGDCEVYHYNTNGTLDWGYFQINTVHLERRGLNLRDLLDCKANIDFAYQLYTERGFDPWSTYKNGAYQKFLRRF*
Ga0126379_1345376613300010366Tropical Forest SoilPRGACEIYHYNSDGTLDWGYFQINTVHLKRPGVNLRDLLDCKANIDFAFQLYQERGFEPWTTYNSGAYRRFLRGQ*
Ga0105239_1253844923300010375Corn RhizosphereGKCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYREQGGFTPWSTYNNGLYRKFMGFR*
Ga0126381_10407901013300010376Tropical Forest SoilVHLKRTGVNLRGLLDCRANIDFAYQLYTERGFEPWTTFRSGEYRRFLQNF*
Ga0137388_1188160813300012189Vadose Zone SoilIYHYNSDGTLDWGYFQINTVHLKRSGLNLRDLLDCKANIDFAYQLYEEKRGFTPWSTYNNGRYRQFLASQ*
Ga0137363_1068562523300012202Vadose Zone SoilYHYNSDGTLDWGYFQINTVHLKRAGVNLRNLLDCKANIDFAYQLYTERGFEAWTTFNSGAYRQFLRTF*
Ga0137367_1081396823300012353Vadose Zone SoilFQINTVHLKRPTLNLRDLLNCNANIDFAYQLYQEKGDFTAWSTYNSGAYRWFLRPDGSRP
Ga0137359_1097394813300012923Vadose Zone SoilYHYNTNGTLDWGYFQINTVHLERPGLNLRDLLDCKANIDFAYQLYQESGGFSPWSTYKSGRYLQFMSRNTSGN*
Ga0164304_1163433823300012986SoilDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYKLYLESHGFTPWSTYNSGVYRKYLR*
Ga0163162_1282617413300013306Switchgrass RhizosphereEIYHYNSDGTLDWGFFQINTVHLKRAGVNLRDLLDCKANIDFAYILYTERGFAPWTTFNSGAYRQYLNAF*
Ga0181518_1001703813300014156BogDGTLDWGYFQINTVHLKRAGVNLRSLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRTF*
Ga0181518_1011506513300014156BogTLDWGYFQINTLHLRRKGVNLRGLLDCKANIDFAYQLYTERGFEPWTTYRDGTYRQFLRNF*
Ga0181521_1002233863300014158BogHYNSDGTLDWGYFQINTVHLKRAGVNLRSLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRTF*
Ga0181530_1031680313300014159BogTLDWGYFQINTVHLKRAGVNLRSLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRTF*
Ga0181532_1002214133300014164BogVYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAHKLYTERGFEPWTTFNSGAYRQFLRTF*
Ga0181537_1094198033300014201BogYNTDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWTTYNSGAYRQFLRTF*
Ga0181537_1101583823300014201BogYFQINTVHLKRPGLNLRDLLDCRANIDFAYQLYQERHGFTPWSTFNSGKYRQFLESR*
Ga0182016_1024390113300014493BogLDWGYFQINTVHLKRAGLNLRDLLDCKANIDFAYKLYLESGFVPWSTYNSGAYRSFLKGF
Ga0181516_1033087723300014655BogWGYFQINTVHLKRVGVNLRDLLDCKANIDFAYQLYKERGFQPWSTFNSGAYRQFLRKF*
Ga0181522_1053209233300014657BogFQINTVHLKRPGLNLRDLLDCRANIDFAYQLYREGHGFTPWSTFNSGKYRQFLESR*
Ga0137403_1007031213300015264Vadose Zone SoilEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRNLLDCRANIDFAYQLYTERGFEPWTTFNSGAYRQFLRTF*
Ga0182041_1000862163300016294SoilEIYHYNTDGTLDWGYFQINTVHLKRPGVNLRALLDCRANIDFAYQLFTERGFEPWTTYRNGAYRKFLRNF
Ga0182041_1046568113300016294SoilLDWGYFQINTVHLRRPGVNLRGLLDCKANIDFAYQLYTERGFEPWTTYRDGAYRKFLR
Ga0182041_1226623413300016294SoilCEIYHYNTDGTLDWGYFQINTVHLKRPGVNLRALLDCTANIDFAYQLYTERGFEPWTTYRNGAYQKFLRNF
Ga0187808_1042234623300017942Freshwater SedimentYFQINTVHLQRPGLNLRDLLDCKANIDFAYVLYTERGFVPWSTYNSGAYLKYLHSGP
Ga0187847_1020513613300017948PeatlandNSDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWTTYNSGAYRQFLRTF
Ga0187888_109018813300018008PeatlandLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRTF
Ga0187880_129444913300018016PeatlandKGACEVYHYNTDGTLDWGYFQINTVHLKRAGVNLRGLLDCRANIDFAYQLYTERGFEPWTTYNSGAYRQFLRTF
Ga0187871_1046005013300018042PeatlandNPRGACEIYHYNTDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYQERGFEPWTTYTSGLYRNYLRDE
Ga0187887_1028775943300018043PeatlandGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYRLYTERGFEPWTTYNSGAYRQFLRTF
Ga0187890_1025609713300018044PeatlandGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAHKLYTERGFEPWTTFNSGAYRQFLRTF
Ga0187859_1062477123300018047PeatlandHYNTDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYRERGFEPWTTYTSGLYRNYLRDP
Ga0066662_1251559423300018468Grasslands SoilYHYNRDGTLDWGYFQINTIHLKRRGVNLRDLLDCKTNIDFAYQLYVENQGFTPWSVYNSGRYKRFLRE
Ga0190271_1197186113300018481SoilAGKCEIYHYNTDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAFQLFQESRGFTPWSTYKSGRYLQYLAPR
Ga0181510_123157613300019240PeatlandNTDGTLDWGYFQINTVHLKRPGLNLRDLLDCRANIDFAYQLYQERHGFTPWSTFNSGKYRQFLESR
Ga0137408_127872323300019789Vadose Zone SoilDGTLDWGYFQINTVHLKRAGVNLRNLLDCKANIDFAYQLYTERGFEPWTTFNSGAYREFLRTF
Ga0210407_1035965113300020579SoilLRDLSLQLRRHARLGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRAF
Ga0213875_1010922713300021388Plant RootsDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYLEKGGFTPWSTYNNGLYKRFLR
Ga0210383_1165501913300021407SoilEIYHYNTDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYRERGFEPWTTYTSGLYRNYLRDP
Ga0210384_1083393113300021432SoilDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYTERGFQPWTTFQSGAYRQFLRTF
Ga0210398_1121595323300021477SoilLDWGYFQINTIHLQRPGLILRDLLDCKANIDFAYQLYQEKRGFTPWSTYTSGKYREFLAS
Ga0242662_1009369913300022533SoilNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYTERGFEPWTTFNSGRYRQFLRSF
Ga0207695_1050031523300025913Corn RhizosphereLDWGYFQINTVHLKRAGVNLRGLLDCRANIDFAYQLYTERGFEPWTTYRSGAYKQFLHNF
Ga0207687_1038205033300025927Miscanthus RhizosphereWGYFQINTVHLKRPGINLRDLLDCKANIDFAYQLYKEKGGFSPWSTFNNGAYRHFIGP
Ga0207700_1155128113300025928Corn, Switchgrass And Miscanthus RhizosphereDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAFVLYRERGFEPWTTYTSGAYRKFLRD
Ga0209810_119740513300027773Surface SoilFQINTVHLKRPGLNLRDLLDCRANIDFAYQLYRERGGFTPWSTFNSGAYRAFMTP
Ga0207433_1004166913300027863Hot SpringNSDGTLDWGYFQINTVHLQRPGLNLRDLLDCKANIDFAYTLYQERGFEPWSTYKSGAYLKFLRH
Ga0209526_1091963623300028047Forest SoilDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYKEKGGFSPWSTFNNGAYRHFMGP
Ga0268266_1022312913300028379Switchgrass RhizosphereINTVHLKRPGLNLRDLLDCRANIDFAYQLYQESHGFTPWSTYNSGKYRQFLKSR
Ga0302198_1045001713300028765BogLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRKF
Ga0302201_1007067113300028785BogDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYREKGGFTPWSTFNDGRYRRYMGR
Ga0302278_1030380723300028866BogHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYTERGFEPWTTFNSGAYRQFLRKF
Ga0311327_1024200713300029883BogGTLDWGYFQINTVHLQRPGLNLRDLLDCKANIDFAYQLYQEKHGFTPWSTYNSGEYRKFLAPQ
Ga0311330_1097551723300029945BogETYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCRANIDFAYQLYSERQSFSAWSTYNTGSYRKYLRH
Ga0311346_1119503913300029952BogTLDWGYFQINTVHLKRLGLNLHDLLDCKANIDFAFQLYQERGGFTPWSTYNSGLYRKFIGGE
Ga0302274_1010395813300030041BogGTLDWGYFQINTVHLKRPGLNLRDLLDCRANIDFAWQLYQESHGFTPWSTYNSGKYRQFLETR
Ga0302195_1003324013300030051BogGYFQINTVHLKRPGLNLRDLLDCRANIDFAWQLYQESHGFTPWSTYNSGKYRQFLETR
Ga0311355_1121174423300030580PalsaLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYRLYTERGFEPWTTFNSGAYRQFLRRF
Ga0316363_1016047413300030659Peatlands SoilTLDWGYFQINTVHLKRAGVNLRDLLDCRANIDFAYQLFRERGFVPWSTYNDGSYRRFLLD
Ga0170824_11913714923300031231Forest SoilYHYNSDGTLDWGYFQINTVHLQRPGLNLRDLLGCKSNIDFAYQLFQEKGGFTPWSTYNSGKYRQFLTQ
Ga0302324_10139156813300031236PalsaSDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYRLYHEKHGFTPWSTYNSGEYRKYLESP
Ga0265332_1005965213300031238RhizosphereNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANVDFAYQLFQEKHGFTAWSTYNSSKYRQFLGPP
Ga0265331_1031266823300031250RhizosphereYHYNTDGTLDWGYFQINTVHLKRAGVNLRGLLDCKANIDFAYQLYTERGFEPWTTYRDGAYRRFLRNF
Ga0302140_1029277543300031261BogETYHYNSDGTLDWGYFQINTLHLKRPGLNLRDLLDCRANIDFAYQLYSERQSFSAWSTYNNGSYRKYLRH
Ga0302140_1038424513300031261BogWGYFQINTVHLQRPGLNLRDLLDCKANIDFAYQLYQEKHGFTPWSTYNSGEYRKFLAPQ
Ga0272448_109348633300031463SedimentDGTLDWGYFQINTVHLQRPGLNLRDLLDCKANIDFAYQLYREKGGFTPWSTFNNGRYRQFMGQ
Ga0310686_10471773123300031708SoilFQINTVHLRRPGLNLRDLLDCKANIDFAYQLYQEKRGFTPWSTFNSGKYREFLTSP
Ga0307475_1136524823300031754Hardwood Forest SoilGDCEIYHYNTDGTLDWGYFQINTVHLRRPGVNLRALLDCRANIDFAYQLYTERGFEPWTTYRNGAYRRFLGTF
Ga0302319_1177475323300031788BogSDGTLDWGYFQINTVHLKRPGLNLHDLLDCKANIDFAFQLYQERGGFTPWSTYNSGLYRKFIGPE
Ga0318557_1021289023300031795SoilCEIYHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYTERGFDAWTAYTSGAYMEYLRTF
Ga0308174_1059362213300031939SoilDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYRERSGFTPWSTYNNGMYRRFLGPE
Ga0318549_1018629113300032041SoilHYNSDGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYTERGFDAWTAYTSGAYMEYLRTF
Ga0318505_1047905923300032060SoilYNTDGTLDWGYFQINTVHLRRPGVNLRALLDCRANIDFAYQLFTERGFEPWTTYRNGAYRKFLRNF
Ga0318553_1072792923300032068SoilLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYTERGFDAWTAYTSGAYMEYLRTF
Ga0335079_1120191213300032783SoilHYNTDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYKLYAERGFEPWTTFQSGAYRQFLRRF
Ga0335078_1064128123300032805SoilNTDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYRERGFEPWTTYTSGLYRNYLRDP
Ga0335078_1177156923300032805SoilADGTLDWGYFQINTVHLKRPGLNLRDLLDCKANIDFAYQLYRENGGFSPWSTFKNGAYRRFMSQ
Ga0335070_1093429013300032829SoilDGTLDWGYFQINTVHLKRAGVNLRDLLDCRANIDFAYRLYQERGFAPWATFNDGSYRRFVRN
Ga0335071_1028937713300032897SoilYFQINTVHLKRAGVNLRDLLDCRANIDFAYRLYQERGFAPWATFNDGSYRRFVRN
Ga0335083_1141751623300032954SoilCEIYHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYQLYTERGFEPWTTYNSGAYRQFLRRF
Ga0247829_1075297313300033550SoilGSLDWGYFQINTVHLERPGLNLRDLLDCKANIDFAHQLYLEKGGFTPWSTFKNGRYRQFMGGP
Ga0334792_074335_3_2093300033888SoilFHYNSDGTLDWGYFQINTVHLKRAGVNLRDLLDCKANIDFAYKLYTERGFEPWTTFNSGAYRQFLRKP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.