| Basic Information | |
|---|---|
| Family ID | F092398 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 45 residues |
| Representative Sequence | EWKQYTFPFSTFETDGSDLSGVGFVHAQEPGKFQFEIDQVEIK |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.93 % |
| % of genes near scaffold ends (potentially truncated) | 96.26 % |
| % of genes from short scaffolds (< 2000 bps) | 77.57 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.336 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog (24.299 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.299 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.187 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.23% β-sheet: 11.27% Coil/Unstructured: 84.51% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF06762 | LMF1 | 6.54 |
| PF01380 | SIS | 6.54 |
| PF11752 | DUF3309 | 6.54 |
| PF13377 | Peripla_BP_3 | 4.67 |
| PF13450 | NAD_binding_8 | 3.74 |
| PF08811 | DUF1800 | 2.80 |
| PF02684 | LpxB | 2.80 |
| PF07885 | Ion_trans_2 | 0.93 |
| PF13628 | DUF4142 | 0.93 |
| PF08447 | PAS_3 | 0.93 |
| PF00575 | S1 | 0.93 |
| PF00882 | Zn_dep_PLPC | 0.93 |
| PF13188 | PAS_8 | 0.93 |
| PF00857 | Isochorismatase | 0.93 |
| PF07883 | Cupin_2 | 0.93 |
| PF12704 | MacB_PCD | 0.93 |
| PF02518 | HATPase_c | 0.93 |
| PF14534 | DUF4440 | 0.93 |
| PF01833 | TIG | 0.93 |
| PF11941 | DUF3459 | 0.93 |
| PF17152 | CHASE8 | 0.93 |
| PF04261 | Dyp_perox | 0.93 |
| PF08220 | HTH_DeoR | 0.93 |
| PF16921 | Tex_YqgF | 0.93 |
| PF01557 | FAA_hydrolase | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0763 | Lipid A disaccharide synthetase | Cell wall/membrane/envelope biogenesis [M] | 2.80 |
| COG5267 | Uncharacterized conserved protein, DUF1800 family | Function unknown [S] | 2.80 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.93 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.93 |
| COG2837 | Periplasmic deferrochelatase/peroxidase EfeB | Inorganic ion transport and metabolism [P] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.34 % |
| Unclassified | root | N/A | 47.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005364|Ga0070673_102298284 | Not Available | 512 | Open in IMG/M |
| 3300005435|Ga0070714_101353643 | Not Available | 695 | Open in IMG/M |
| 3300005436|Ga0070713_100103795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 2467 | Open in IMG/M |
| 3300005439|Ga0070711_101649124 | Not Available | 561 | Open in IMG/M |
| 3300005533|Ga0070734_10250325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1016 | Open in IMG/M |
| 3300005535|Ga0070684_100052640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 3541 | Open in IMG/M |
| 3300005539|Ga0068853_100569845 | Not Available | 1074 | Open in IMG/M |
| 3300005541|Ga0070733_10106008 | All Organisms → cellular organisms → Bacteria | 1797 | Open in IMG/M |
| 3300005543|Ga0070672_101272782 | Not Available | 656 | Open in IMG/M |
| 3300005898|Ga0075276_10107707 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300006176|Ga0070765_101109669 | Not Available | 747 | Open in IMG/M |
| 3300006237|Ga0097621_100155366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1963 | Open in IMG/M |
| 3300009177|Ga0105248_10239370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 2043 | Open in IMG/M |
| 3300009551|Ga0105238_10089102 | All Organisms → cellular organisms → Bacteria | 3072 | Open in IMG/M |
| 3300010361|Ga0126378_11538681 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300010375|Ga0105239_10247680 | All Organisms → cellular organisms → Bacteria | 2001 | Open in IMG/M |
| 3300010375|Ga0105239_13374024 | Not Available | 520 | Open in IMG/M |
| 3300010396|Ga0134126_11247564 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300010397|Ga0134124_10244000 | Not Available | 1649 | Open in IMG/M |
| 3300012924|Ga0137413_11653926 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012944|Ga0137410_11957406 | Not Available | 520 | Open in IMG/M |
| 3300013296|Ga0157374_10712496 | Not Available | 1017 | Open in IMG/M |
| 3300013297|Ga0157378_11200858 | Not Available | 798 | Open in IMG/M |
| 3300013307|Ga0157372_10060376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4243 | Open in IMG/M |
| 3300013307|Ga0157372_10388548 | All Organisms → cellular organisms → Bacteria | 1626 | Open in IMG/M |
| 3300014151|Ga0181539_1315706 | Not Available | 570 | Open in IMG/M |
| 3300014152|Ga0181533_1373424 | Not Available | 505 | Open in IMG/M |
| 3300014201|Ga0181537_10637396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 726 | Open in IMG/M |
| 3300014493|Ga0182016_10036625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4034 | Open in IMG/M |
| 3300014502|Ga0182021_13074792 | Not Available | 558 | Open in IMG/M |
| 3300015371|Ga0132258_11549979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1673 | Open in IMG/M |
| 3300015374|Ga0132255_102701348 | Not Available | 759 | Open in IMG/M |
| 3300016387|Ga0182040_11823165 | Not Available | 521 | Open in IMG/M |
| 3300016404|Ga0182037_10822028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 802 | Open in IMG/M |
| 3300016445|Ga0182038_11368330 | Not Available | 634 | Open in IMG/M |
| 3300017933|Ga0187801_10470294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300017988|Ga0181520_10835575 | Not Available | 619 | Open in IMG/M |
| 3300018004|Ga0187865_1326302 | Not Available | 503 | Open in IMG/M |
| 3300018033|Ga0187867_10259241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300018034|Ga0187863_10607575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 615 | Open in IMG/M |
| 3300018043|Ga0187887_10083202 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
| 3300018090|Ga0187770_11781134 | Not Available | 504 | Open in IMG/M |
| 3300021181|Ga0210388_10035866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4097 | Open in IMG/M |
| 3300021181|Ga0210388_11747019 | Not Available | 514 | Open in IMG/M |
| 3300021407|Ga0210383_10759866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 831 | Open in IMG/M |
| 3300021433|Ga0210391_10302716 | Not Available | 1254 | Open in IMG/M |
| 3300021433|Ga0210391_11110082 | Not Available | 614 | Open in IMG/M |
| 3300022863|Ga0224532_1034823 | Not Available | 662 | Open in IMG/M |
| 3300025911|Ga0207654_10755350 | Not Available | 701 | Open in IMG/M |
| 3300025914|Ga0207671_10076663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 2502 | Open in IMG/M |
| 3300025924|Ga0207694_10055587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3072 | Open in IMG/M |
| 3300025928|Ga0207700_10084613 | All Organisms → cellular organisms → Bacteria | 2487 | Open in IMG/M |
| 3300025940|Ga0207691_10040021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4334 | Open in IMG/M |
| 3300025940|Ga0207691_10364419 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300025945|Ga0207679_11241325 | Not Available | 684 | Open in IMG/M |
| 3300026023|Ga0207677_10058240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2659 | Open in IMG/M |
| 3300026035|Ga0207703_11672609 | Not Available | 612 | Open in IMG/M |
| 3300026041|Ga0207639_12130698 | Not Available | 522 | Open in IMG/M |
| 3300026078|Ga0207702_11526761 | Not Available | 661 | Open in IMG/M |
| 3300027853|Ga0209274_10093322 | Not Available | 1477 | Open in IMG/M |
| 3300027869|Ga0209579_10599509 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300027884|Ga0209275_10175397 | Not Available | 1148 | Open in IMG/M |
| 3300028090|Ga0255349_1058113 | Not Available | 764 | Open in IMG/M |
| 3300028560|Ga0302144_10025229 | Not Available | 1913 | Open in IMG/M |
| 3300028560|Ga0302144_10152438 | Not Available | 747 | Open in IMG/M |
| 3300028745|Ga0302267_10047249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis | 2468 | Open in IMG/M |
| 3300028762|Ga0302202_10062523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis | 2317 | Open in IMG/M |
| 3300028783|Ga0302279_10046849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2671 | Open in IMG/M |
| 3300028783|Ga0302279_10313749 | Not Available | 684 | Open in IMG/M |
| 3300028785|Ga0302201_10029374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2958 | Open in IMG/M |
| 3300028788|Ga0302189_10019969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3869 | Open in IMG/M |
| 3300028859|Ga0302265_1074318 | Not Available | 1127 | Open in IMG/M |
| 3300028859|Ga0302265_1264862 | Not Available | 506 | Open in IMG/M |
| 3300028860|Ga0302199_1027111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2100 | Open in IMG/M |
| 3300028860|Ga0302199_1136639 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300028882|Ga0302154_10537859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 553 | Open in IMG/M |
| 3300028906|Ga0308309_10854878 | Not Available | 790 | Open in IMG/M |
| 3300029882|Ga0311368_10034249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4785 | Open in IMG/M |
| 3300029882|Ga0311368_10281474 | Not Available | 1269 | Open in IMG/M |
| 3300029907|Ga0311329_10264757 | Not Available | 1270 | Open in IMG/M |
| 3300029907|Ga0311329_10372495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1008 | Open in IMG/M |
| 3300029911|Ga0311361_10971442 | Not Available | 716 | Open in IMG/M |
| 3300029917|Ga0311326_10162204 | Not Available | 1194 | Open in IMG/M |
| 3300029953|Ga0311343_10030464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7224 | Open in IMG/M |
| 3300029953|Ga0311343_11033191 | Not Available | 642 | Open in IMG/M |
| 3300030041|Ga0302274_10110438 | Not Available | 1468 | Open in IMG/M |
| 3300030051|Ga0302195_10069243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis | 1869 | Open in IMG/M |
| 3300030399|Ga0311353_10122573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 2507 | Open in IMG/M |
| 3300030399|Ga0311353_11513861 | Not Available | 543 | Open in IMG/M |
| 3300030518|Ga0302275_10112413 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300030520|Ga0311372_10328624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Kamptonema → Kamptonema sp. PCC 6506 | 2384 | Open in IMG/M |
| 3300030693|Ga0302313_10172747 | Not Available | 876 | Open in IMG/M |
| 3300031231|Ga0170824_104197172 | Not Available | 655 | Open in IMG/M |
| 3300031236|Ga0302324_100690642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1443 | Open in IMG/M |
| 3300031239|Ga0265328_10289418 | Not Available | 631 | Open in IMG/M |
| 3300031258|Ga0302318_10113948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa ligni | 1225 | Open in IMG/M |
| 3300031259|Ga0302187_10135079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1355 | Open in IMG/M |
| 3300031261|Ga0302140_10987568 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300031525|Ga0302326_10346403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2340 | Open in IMG/M |
| 3300031788|Ga0302319_10532385 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300031819|Ga0318568_10626434 | Not Available | 670 | Open in IMG/M |
| 3300031902|Ga0302322_103865873 | Not Available | 511 | Open in IMG/M |
| 3300031912|Ga0306921_12220624 | Not Available | 578 | Open in IMG/M |
| 3300032770|Ga0335085_12289100 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300032892|Ga0335081_10713607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1214 | Open in IMG/M |
| 3300034065|Ga0334827_125616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 820 | Open in IMG/M |
| 3300034065|Ga0334827_140553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 759 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 24.30% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.61% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.74% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.74% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 3.74% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.87% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.93% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005898 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300022863 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 1-5 | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028090 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v15 | Environmental | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028783 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028785 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028859 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300028860 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300030041 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1 | Environmental | Open in IMG/M |
| 3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031259 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070673_1022982841 | 3300005364 | Switchgrass Rhizosphere | YTFPFSTFETDGSDLIGLGFLRTQEVGKFQFQIDELEIK* |
| Ga0070714_1013536431 | 3300005435 | Agricultural Soil | PAWKQYTFPFSTFETDGSDISGIGFIRAQEPGKFQFAIDEVEIK* |
| Ga0070713_1001037951 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | TSFTAGPAWKQYTFPFSTFETDGSDISGIGFIRAQEPGKFQFAIDEVEIK* |
| Ga0070711_1016491241 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | PAMTTFVASPDWKQYTFPFTAFDTDGSDLSGLGFIRILEPGTFQFAIDQVEIK* |
| Ga0070734_102503253 | 3300005533 | Surface Soil | TFVAGPDWKQYTFPFSTFDTDGSDLTGMGFIRIGQPGKFRFEIDQVEIK* |
| Ga0070684_1000526405 | 3300005535 | Corn Rhizosphere | GPEWKHYAFPFSTFETDGSDLSGIGFIRVGNLGKFQFDIDQVEIK* |
| Ga0068853_1005698452 | 3300005539 | Corn Rhizosphere | EAPTMTSFTARPEWKKYTFPFSTFETDGSDLIGLGFLRTQEVGKFQFQVDELEIK* |
| Ga0070733_101060084 | 3300005541 | Surface Soil | MTNFIAGPDWKQFTFPLSGFDTDASDLSGIGLIRLAEPGKFQFEIDQVEIK* |
| Ga0070672_1012727821 | 3300005543 | Miscanthus Rhizosphere | FSTFETDGSDMSGIGFLRAQEVGKFRFQIDELEIK* |
| Ga0075276_101077072 | 3300005898 | Rice Paddy Soil | QNGEPPAMTSFTAEPEWKQYTFPFSTFETDGSDLSGIGFIRAQELGKFQFQIDELEIR* |
| Ga0070765_1011096693 | 3300006176 | Soil | FPFSTFETDGSDLTGLVFGKVETPGKLNFEIDQVEIR* |
| Ga0097621_1001553661 | 3300006237 | Miscanthus Rhizosphere | KKYTFPFSTFETDGSDLIGLGFLRTQEVGKFQFQVDELEIK* |
| Ga0105248_102393701 | 3300009177 | Switchgrass Rhizosphere | MTTFVAGPEWKQYTFPLSTFETDGSDLSGLGFIRAQEPGQFQFEIDQLEIQ* |
| Ga0105238_100891023 | 3300009551 | Corn Rhizosphere | PAMTSFTAEPEWKRYTFPFSTFETDGSDLSGIGFIRAQEPGKFQFEIDELEIK* |
| Ga0126378_115386812 | 3300010361 | Tropical Forest Soil | AGPEWKQYTFPFSTFQTDGSDLSSLAFVATQQPGKFEFEIDQVEIK* |
| Ga0105239_102476803 | 3300010375 | Corn Rhizosphere | FTFPFSTFETDGSDLTGIGFIRVMEQGKFQFQIDELEIK* |
| Ga0105239_133740242 | 3300010375 | Corn Rhizosphere | AGPEWKQYTFPFSTFETDGSDLIGLGFLRTQEVGKFQFQVDELEIK* |
| Ga0134126_112475641 | 3300010396 | Terrestrial Soil | KQFTFPFSTFETDGSDLSGIGFIRAQDPGKFQFQIDELEIK* |
| Ga0134124_102440001 | 3300010397 | Terrestrial Soil | PFSTFETDGSDLIGLGFLRTQEVGKFQFQVDELEIK* |
| Ga0137413_116539262 | 3300012924 | Vadose Zone Soil | MAATPIGFLGEPPAMTSFTAGAEWKQYTFPFSTFETDGSDISGLGFVRVQEPGKFQFQIDEVEIK* |
| Ga0137410_119574062 | 3300012944 | Vadose Zone Soil | MTSFVAGPEWKQYTFPFSALETDGSDLSGIGFIKVSGPGKFQFALDQLEIK* |
| Ga0157374_107124961 | 3300013296 | Miscanthus Rhizosphere | TFPFSTFETDGSDLSGIGFLRAQEAGKFQFEIDELEIK* |
| Ga0157378_112008582 | 3300013297 | Miscanthus Rhizosphere | PFSTFETDGSDLTGLGFLRTQEVGKFQFQIDELEIK* |
| Ga0157372_100603764 | 3300013307 | Corn Rhizosphere | PPAMTTFIAAPEWKQFTFPFSTFETDGSDLTGIGFIRVMEQGKFQFQIDELEIK* |
| Ga0157372_103885482 | 3300013307 | Corn Rhizosphere | STFETDGRDLSGIGFLRAQEAGKFQFEIDELEIK* |
| Ga0181539_13157062 | 3300014151 | Bog | TESRSGNSGQMPAMTQFVAGPEWKLYTFPFSTFETDGSDLAGLGFVKVMSMGKFQFEIDQLQIK* |
| Ga0181533_13734241 | 3300014152 | Bog | SGNSGQMPAMTQFVAGPEWKLYTFPFSTFETDGSDLAGLGFVKVMSMGKFQFEIDQLQIK |
| Ga0181537_106373962 | 3300014201 | Bog | KQYTFPFSTFETDGSDLSGVGFVHAQEPGKFQFEIDQVEIK* |
| Ga0182016_100366251 | 3300014493 | Bog | TFPLSTFETDGSDLSGLGFVHVGEPGKFQFELDQFEIK* |
| Ga0182021_130747921 | 3300014502 | Fen | PEWKQYAFTFSALDIDVSDMTGLGFVRVQEPGKFQFQIDRLEIK* |
| Ga0132258_115499791 | 3300015371 | Arabidopsis Rhizosphere | ATFETDGGDLSSLAFVATQPPGKFAFEIDELEIK* |
| Ga0132255_1027013482 | 3300015374 | Arabidopsis Rhizosphere | STFETDGSDLIGLGFLRTQEVGKFQFQIDELEIK* |
| Ga0182040_118231651 | 3300016387 | Soil | TGPEWKQYTFPFSAFETDGSDLSGIGFIRLQEPGKIQLQIDQLEIK |
| Ga0182037_108220283 | 3300016404 | Soil | QYTFPFSTFDTDGGDLTGIGFVRINNPGKFQFALDQVEIK |
| Ga0182038_113683302 | 3300016445 | Soil | AGPGWKQYTFPFSTFDTDGSDLSGIGFIRVQEPGKFQFQIDEFEIK |
| Ga0187801_104702942 | 3300017933 | Freshwater Sediment | PDWKQFTFPFSTFQTDGSDITGLLFSRAGQPGKFQFAIDEVEIK |
| Ga0181520_108355752 | 3300017988 | Bog | DMPAMTQFNAGPEWKQYTFPLSTFDTDGSDLSGLGFVQVGQPGKFQFELDQLEIK |
| Ga0187865_13263022 | 3300018004 | Peatland | LYTFPFSIFETDGSDLTGLGFVKVMEVGKFQFEIDQLQIK |
| Ga0187867_102592412 | 3300018033 | Peatland | FSTFETDGSDLAGLGFVHAQEPGKFQFEIDELQIK |
| Ga0187863_106075751 | 3300018034 | Peatland | TFPFSTFETDGSDLSGLGFVHVMEPGKFQFEIDEVEIK |
| Ga0187887_100832021 | 3300018043 | Peatland | YTFPFSDFETDGSDLKGLGFLRAQEPGPFSFQIDQVEIK |
| Ga0187770_117811341 | 3300018090 | Tropical Peatland | QFTFPFSTFQTDGSDLTGLMFAHSQEPGKFQFELDEVEIK |
| Ga0210388_100358661 | 3300021181 | Soil | AMTSFVAGPDWKKYTFPFSTFETDGSDLSGLGFVRAQEAGKFQFELDQLEIK |
| Ga0210388_117470192 | 3300021181 | Soil | FVAGPDWKQYTFPFSAFETDGGDLSGIGFIKVGQPGKFQFELDQVEIK |
| Ga0210383_107598663 | 3300021407 | Soil | GEAPAMTSFVAGPEWKQYTFPFSVFETDGSDLSGIGFIKLEPGKFQFLLDQVEIK |
| Ga0210391_103027162 | 3300021433 | Soil | EWKQYTFPFSDFETDGSDLKGLGFLHAQEPGTFSFQIDQVEIK |
| Ga0210391_111100821 | 3300021433 | Soil | GPEWKQYTFPFSVFETDGSDLSGIGFIKLVPGKFQFQLDQVEIK |
| Ga0224532_10348231 | 3300022863 | Soil | SRSGNSGQMPAMTPFTAGPEWKLYSFPLSTFETDGGDLSGLGFIKTMDPGKFQFEIDQLQIK |
| Ga0207654_107553502 | 3300025911 | Corn Rhizosphere | APAMTSFTAAPEWKQYTFPFSTFETDGSDLSGIGFLRAQEAGKFQFEIDELEIK |
| Ga0207671_100766631 | 3300025914 | Corn Rhizosphere | TTFIAAPEWKQFTFPFSTFETDGRDLTGIGFIRVMEQGKFQFQIDELEIK |
| Ga0207694_100555871 | 3300025924 | Corn Rhizosphere | PAMTSFTAEPEWKRYTFPFSTFETDGSDLSGIGFIRAQEPGKFQFEIDELEIK |
| Ga0207700_100846131 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | TSFTAGPAWKQYTFPFSTFETDGSDISGIGFIRAQEPGKFQFAIDEVEIK |
| Ga0207691_100400211 | 3300025940 | Miscanthus Rhizosphere | KKYTFPFSTFETDGSDLIGLGFLRTQEVGKFQFQIDELEIK |
| Ga0207691_103644194 | 3300025940 | Miscanthus Rhizosphere | KKYTFPFSTFETDGSDLIGLGFLRTQEVGKFQFQVDELEIK |
| Ga0207679_112413251 | 3300025945 | Corn Rhizosphere | EWKQFTFPFSTFETDGSDLSGIGFLRAQDPGKFQFEVDEFEIK |
| Ga0207677_100582401 | 3300026023 | Miscanthus Rhizosphere | FTFPFSTFETDGRDLTGIGFIRVMEQGKFQFQIDELEIK |
| Ga0207703_116726092 | 3300026035 | Switchgrass Rhizosphere | FTFPFSTFETDGSDISGIGFLRAQEVGKFRFQIDELEIK |
| Ga0207639_121306982 | 3300026041 | Corn Rhizosphere | QFTFPFSTFETDGSDISGIGFLRAQEVGKFRFQIDELEIK |
| Ga0207702_115267611 | 3300026078 | Corn Rhizosphere | KYTFPFSTFETDGSDLIGLGFLRTQEVGKFQFQVDELEIK |
| Ga0209274_100933223 | 3300027853 | Soil | WKQFIFPFSTFETDGSDLTGLVFGKVETPGKLNFEIDQVEIR |
| Ga0209579_105995092 | 3300027869 | Surface Soil | FPFSAFDTDGSDIFMIGFGQVETPGKFTFDIDQVEIR |
| Ga0209275_101753972 | 3300027884 | Soil | WKQYSFPFSAFDTDGSDLTGLGFIDAQRPGKFQFQIDQVEIK |
| Ga0255349_10581131 | 3300028090 | Soil | FAFSDFETDGSDIKGLGFLHAQEPGTFAFQIDQVEIK |
| Ga0302144_100252291 | 3300028560 | Bog | KQYTFPLSTFETDGSDLSGLGFVHVGEPGKFQFELDQFEIK |
| Ga0302144_101524382 | 3300028560 | Bog | RGGSGGEMPAMTQFTAGPEWKQYTFPLSTFETDGSDLSGVGLIHVGEPGKFQFEIDQFEI |
| Ga0302267_100472491 | 3300028745 | Bog | GPEWKQYTFPFSTFETDGSDLSGVGFVHVMEPGKFQFEIDQVEIK |
| Ga0302202_100625233 | 3300028762 | Bog | TPFVAGPEWKQYTFPFDTFETDGSDLSGLGFVHVMEPGKFQFEIDQVEIK |
| Ga0302279_100468493 | 3300028783 | Bog | FSDFETDGSDIKGLGFLHAQEPGTFAFQIDQVEIK |
| Ga0302279_103137491 | 3300028783 | Bog | FPFSTFETDGSDLSGLGFVHVQEPGKFQFQIDEVEIK |
| Ga0302201_100293741 | 3300028785 | Bog | GGEMPAMTQFTAGPEWKQYTFPLSTFETDGSDLSGVGLIHVGEPGKFQFEIDQFEIK |
| Ga0302189_100199691 | 3300028788 | Bog | TFAFSDFETDGSDIKGLGFLHAQEPGTFAFQIDQVEIK |
| Ga0302265_10743182 | 3300028859 | Bog | FPFDTFETDGSDLSGLGFVHVMEPGKFQFEIDQVEIK |
| Ga0302265_12648621 | 3300028859 | Bog | SRSGNSGEMPAMTSFTAGPDWKQYIFPFSTFETDGSDLAGIGFLHAQEPGKFQFEIDQFKIE |
| Ga0302199_10271113 | 3300028860 | Bog | WKLYTFPFSTFQTDGSDLSALAFVHAQQPGKFQFEIDELQIK |
| Ga0302199_11366392 | 3300028860 | Bog | TFPFSTFETDGSDLAGIGFLHAQEPGKFQFEIDQFKIE |
| Ga0302154_105378591 | 3300028882 | Bog | WKQYTFPFSKFETDGSDLSGLGFVHVGEAGKFQFEIDQVEIK |
| Ga0308309_108548783 | 3300028906 | Soil | MAGFVAGPEWKQFIFPFSTFETDGSDLTGLVFGKVETPGKLNFEIDQVEIR |
| Ga0311368_100342495 | 3300029882 | Palsa | EWKQYTFPFSTFETDGSDLSGVGFVHAQEPGKFQFEIDQVEIK |
| Ga0311368_102814741 | 3300029882 | Palsa | TFIAGPEWKQLAFPFSTFETDGSDLSGVGFVLAQQPGTFQFQIDQLEIK |
| Ga0311329_102647573 | 3300029907 | Bog | ESRSGSSGDMPAMTPFTAGGEWKQYTFPLSTFETDGSDLSGLGFVHVGEPGKFQFELDQLEIK |
| Ga0311329_103724951 | 3300029907 | Bog | AGPEWKLYTFPFSTFQTDGSDLSALAFVHAQQPGKFQFEIDELQIK |
| Ga0311361_109714422 | 3300029911 | Bog | GEMPAMTQFTAGPEWKQYTFPLSTFETDGSDLSGVGLIHVGEPGKFQFEIDQFEIK |
| Ga0311326_101622042 | 3300029917 | Bog | QYTFPLSTFETDGSDLSGVGLIHVGEPGKFQFEIDQFEIK |
| Ga0311343_100304645 | 3300029953 | Bog | RSGSSGDMPAMTPFTAGGEWKQYTFPLSTFETDGSDLSGLGFVHVGEPGKFQFELDQLEI |
| Ga0311343_110331912 | 3300029953 | Bog | PLSTFETDGSDLSGLGFVHVGEPGKFQFELDQFEIK |
| Ga0302274_101104381 | 3300030041 | Bog | SRGGSGGEMPAMTQFTAGPEWKQYTFPLSTFETDGSDLSGVGLIHVGEPGKFQFEIDQFEIK |
| Ga0302195_100692433 | 3300030051 | Bog | TTTFVAGPDWKQYTFPFETFETDGSDLSGVGFVHVMEPGKFQFEIDQVEIK |
| Ga0311353_101225734 | 3300030399 | Palsa | TTFIAGPEWKQLAFPFSTFETDGSDLSGVGFVLAQQPGTFQFQIDQLEIK |
| Ga0311353_115138612 | 3300030399 | Palsa | YTFPFSTFETDGSDLSGLGFVRAQEPGKFQFELDDLEIK |
| Ga0302275_101124132 | 3300030518 | Bog | YTFPFSTFETDGSDLTGIGFLHAQEPGNFQFEIDQFQIE |
| Ga0311372_103286241 | 3300030520 | Palsa | PEWKHFSFPFSTFETDGSDLSGLGFVHVQEPGKFQFEIDQVEIK |
| Ga0302313_101727473 | 3300030693 | Palsa | FPFSTFDTDGSDLSGLGFVHVQEPGKFQFQLDQLEIK |
| Ga0170824_1041971721 | 3300031231 | Forest Soil | FAAGPEWKQYTFPFSTFETDPSDLSGIGFIRVQEPGKLQFQLDEVEIK |
| Ga0302324_1006906422 | 3300031236 | Palsa | QYTFPFTDFETDGSDLKGLGFLHAQEPGTFSFQIDQLEIK |
| Ga0265328_102894182 | 3300031239 | Rhizosphere | QYTFPFSTFETDGSDISGIGFIRIQEPGKFQFAIDEVEIK |
| Ga0302318_101139481 | 3300031258 | Bog | TQFVAGPEWKQYTFPFSAFETDGSDLTGLGFVRIKEPGKFQFQIDQFQIQ |
| Ga0302187_101350793 | 3300031259 | Bog | KLYTFPFSTFQTDGSDLSALAFVHAQQPGKFQFEIDELQIK |
| Ga0302140_109875682 | 3300031261 | Bog | EWKHYSFPFSTFETDGSDLSGLGFVHVQVPGKFQFEIDQVEIK |
| Ga0302326_103464031 | 3300031525 | Palsa | DWKQYTFAFSDFETDGSDLKGLGFLHAQEPGTFSFQIDQVEIK |
| Ga0302319_105323851 | 3300031788 | Bog | KHYSFPFSTFETDGSDLSGLGFVHVQVPGKFQFEIDQVEIK |
| Ga0318568_106264342 | 3300031819 | Soil | RFPFSAFETDGSDLSGLGFIRMQEQGKFQFELDEVEIK |
| Ga0302322_1038658731 | 3300031902 | Fen | WKKISIPFKQFETDGSDISGLGFMHVKEAGKYQFEIDQVRFE |
| Ga0306921_122206241 | 3300031912 | Soil | MTTFVAGPEWKQYAFPFSTFETDGSDVTGLGFVRINNPGKFQFAPDHVEIK |
| Ga0335085_122891001 | 3300032770 | Soil | FSAFETNGSDLIGIGFIRVQEPGKFQFDLDEFEIK |
| Ga0335081_107136071 | 3300032892 | Soil | AGPEWKQYSLPFTQFQTDGSDISGLSFVRAGQPGKFQFEIDEVEIK |
| Ga0334827_125616_1_123 | 3300034065 | Soil | QYVFPFSAFDTDGSDLTGLGFIRILEPAKFQFQLDQLEIK |
| Ga0334827_140553_648_758 | 3300034065 | Soil | PFSTFETDGSDLSGVGFVHVMEPGKFQFEIDQVEIK |
| ⦗Top⦘ |