NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F092398

Metagenome Family F092398

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092398
Family Type Metagenome
Number of Sequences 107
Average Sequence Length 45 residues
Representative Sequence EWKQYTFPFSTFETDGSDLSGVGFVHAQEPGKFQFEIDQVEIK
Number of Associated Samples 93
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.93 %
% of genes near scaffold ends (potentially truncated) 96.26 %
% of genes from short scaffolds (< 2000 bps) 77.57 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (52.336 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(24.299 % of family members)
Environment Ontology (ENVO) Unclassified
(24.299 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.187 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.23%    β-sheet: 11.27%    Coil/Unstructured: 84.51%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF06762LMF1 6.54
PF01380SIS 6.54
PF11752DUF3309 6.54
PF13377Peripla_BP_3 4.67
PF13450NAD_binding_8 3.74
PF08811DUF1800 2.80
PF02684LpxB 2.80
PF07885Ion_trans_2 0.93
PF13628DUF4142 0.93
PF08447PAS_3 0.93
PF00575S1 0.93
PF00882Zn_dep_PLPC 0.93
PF13188PAS_8 0.93
PF00857Isochorismatase 0.93
PF07883Cupin_2 0.93
PF12704MacB_PCD 0.93
PF02518HATPase_c 0.93
PF14534DUF4440 0.93
PF01833TIG 0.93
PF11941DUF3459 0.93
PF17152CHASE8 0.93
PF04261Dyp_perox 0.93
PF08220HTH_DeoR 0.93
PF16921Tex_YqgF 0.93
PF01557FAA_hydrolase 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0763Lipid A disaccharide synthetaseCell wall/membrane/envelope biogenesis [M] 2.80
COG5267Uncharacterized conserved protein, DUF1800 familyFunction unknown [S] 2.80
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.93
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.93
COG2837Periplasmic deferrochelatase/peroxidase EfeBInorganic ion transport and metabolism [P] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms52.34 %
UnclassifiedrootN/A47.66 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005364|Ga0070673_102298284Not Available512Open in IMG/M
3300005435|Ga0070714_101353643Not Available695Open in IMG/M
3300005436|Ga0070713_100103795All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.2467Open in IMG/M
3300005439|Ga0070711_101649124Not Available561Open in IMG/M
3300005533|Ga0070734_10250325All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1016Open in IMG/M
3300005535|Ga0070684_100052640All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00683541Open in IMG/M
3300005539|Ga0068853_100569845Not Available1074Open in IMG/M
3300005541|Ga0070733_10106008All Organisms → cellular organisms → Bacteria1797Open in IMG/M
3300005543|Ga0070672_101272782Not Available656Open in IMG/M
3300005898|Ga0075276_10107707All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300006176|Ga0070765_101109669Not Available747Open in IMG/M
3300006237|Ga0097621_100155366All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.1963Open in IMG/M
3300009177|Ga0105248_10239370All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00682043Open in IMG/M
3300009551|Ga0105238_10089102All Organisms → cellular organisms → Bacteria3072Open in IMG/M
3300010361|Ga0126378_11538681All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300010375|Ga0105239_10247680All Organisms → cellular organisms → Bacteria2001Open in IMG/M
3300010375|Ga0105239_13374024Not Available520Open in IMG/M
3300010396|Ga0134126_11247564All Organisms → cellular organisms → Bacteria825Open in IMG/M
3300010397|Ga0134124_10244000Not Available1649Open in IMG/M
3300012924|Ga0137413_11653926All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300012944|Ga0137410_11957406Not Available520Open in IMG/M
3300013296|Ga0157374_10712496Not Available1017Open in IMG/M
3300013297|Ga0157378_11200858Not Available798Open in IMG/M
3300013307|Ga0157372_10060376All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4243Open in IMG/M
3300013307|Ga0157372_10388548All Organisms → cellular organisms → Bacteria1626Open in IMG/M
3300014151|Ga0181539_1315706Not Available570Open in IMG/M
3300014152|Ga0181533_1373424Not Available505Open in IMG/M
3300014201|Ga0181537_10637396All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium726Open in IMG/M
3300014493|Ga0182016_10036625All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4034Open in IMG/M
3300014502|Ga0182021_13074792Not Available558Open in IMG/M
3300015371|Ga0132258_11549979All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1673Open in IMG/M
3300015374|Ga0132255_102701348Not Available759Open in IMG/M
3300016387|Ga0182040_11823165Not Available521Open in IMG/M
3300016404|Ga0182037_10822028All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068802Open in IMG/M
3300016445|Ga0182038_11368330Not Available634Open in IMG/M
3300017933|Ga0187801_10470294All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300017988|Ga0181520_10835575Not Available619Open in IMG/M
3300018004|Ga0187865_1326302Not Available503Open in IMG/M
3300018033|Ga0187867_10259241All Organisms → cellular organisms → Bacteria → Acidobacteria978Open in IMG/M
3300018034|Ga0187863_10607575All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium615Open in IMG/M
3300018043|Ga0187887_10083202All Organisms → cellular organisms → Bacteria1937Open in IMG/M
3300018090|Ga0187770_11781134Not Available504Open in IMG/M
3300021181|Ga0210388_10035866All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4097Open in IMG/M
3300021181|Ga0210388_11747019Not Available514Open in IMG/M
3300021407|Ga0210383_10759866All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068831Open in IMG/M
3300021433|Ga0210391_10302716Not Available1254Open in IMG/M
3300021433|Ga0210391_11110082Not Available614Open in IMG/M
3300022863|Ga0224532_1034823Not Available662Open in IMG/M
3300025911|Ga0207654_10755350Not Available701Open in IMG/M
3300025914|Ga0207671_10076663All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum2502Open in IMG/M
3300025924|Ga0207694_10055587All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3072Open in IMG/M
3300025928|Ga0207700_10084613All Organisms → cellular organisms → Bacteria2487Open in IMG/M
3300025940|Ga0207691_10040021All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4334Open in IMG/M
3300025940|Ga0207691_10364419All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300025945|Ga0207679_11241325Not Available684Open in IMG/M
3300026023|Ga0207677_10058240All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2659Open in IMG/M
3300026035|Ga0207703_11672609Not Available612Open in IMG/M
3300026041|Ga0207639_12130698Not Available522Open in IMG/M
3300026078|Ga0207702_11526761Not Available661Open in IMG/M
3300027853|Ga0209274_10093322Not Available1477Open in IMG/M
3300027869|Ga0209579_10599509All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300027884|Ga0209275_10175397Not Available1148Open in IMG/M
3300028090|Ga0255349_1058113Not Available764Open in IMG/M
3300028560|Ga0302144_10025229Not Available1913Open in IMG/M
3300028560|Ga0302144_10152438Not Available747Open in IMG/M
3300028745|Ga0302267_10047249All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis2468Open in IMG/M
3300028762|Ga0302202_10062523All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis2317Open in IMG/M
3300028783|Ga0302279_10046849All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2671Open in IMG/M
3300028783|Ga0302279_10313749Not Available684Open in IMG/M
3300028785|Ga0302201_10029374All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2958Open in IMG/M
3300028788|Ga0302189_10019969All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3869Open in IMG/M
3300028859|Ga0302265_1074318Not Available1127Open in IMG/M
3300028859|Ga0302265_1264862Not Available506Open in IMG/M
3300028860|Ga0302199_1027111All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2100Open in IMG/M
3300028860|Ga0302199_1136639All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300028882|Ga0302154_10537859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium553Open in IMG/M
3300028906|Ga0308309_10854878Not Available790Open in IMG/M
3300029882|Ga0311368_10034249All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4785Open in IMG/M
3300029882|Ga0311368_10281474Not Available1269Open in IMG/M
3300029907|Ga0311329_10264757Not Available1270Open in IMG/M
3300029907|Ga0311329_10372495All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1008Open in IMG/M
3300029911|Ga0311361_10971442Not Available716Open in IMG/M
3300029917|Ga0311326_10162204Not Available1194Open in IMG/M
3300029953|Ga0311343_10030464All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7224Open in IMG/M
3300029953|Ga0311343_11033191Not Available642Open in IMG/M
3300030041|Ga0302274_10110438Not Available1468Open in IMG/M
3300030051|Ga0302195_10069243All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis1869Open in IMG/M
3300030399|Ga0311353_10122573All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae2507Open in IMG/M
3300030399|Ga0311353_11513861Not Available543Open in IMG/M
3300030518|Ga0302275_10112413All Organisms → cellular organisms → Bacteria1790Open in IMG/M
3300030520|Ga0311372_10328624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Microcoleaceae → Kamptonema → Kamptonema sp. PCC 65062384Open in IMG/M
3300030693|Ga0302313_10172747Not Available876Open in IMG/M
3300031231|Ga0170824_104197172Not Available655Open in IMG/M
3300031236|Ga0302324_100690642All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1443Open in IMG/M
3300031239|Ga0265328_10289418Not Available631Open in IMG/M
3300031258|Ga0302318_10113948All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa ligni1225Open in IMG/M
3300031259|Ga0302187_10135079All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1355Open in IMG/M
3300031261|Ga0302140_10987568All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300031525|Ga0302326_10346403All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2340Open in IMG/M
3300031788|Ga0302319_10532385All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300031819|Ga0318568_10626434Not Available670Open in IMG/M
3300031902|Ga0302322_103865873Not Available511Open in IMG/M
3300031912|Ga0306921_12220624Not Available578Open in IMG/M
3300032770|Ga0335085_12289100All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300032892|Ga0335081_10713607All Organisms → cellular organisms → Bacteria → Acidobacteria1214Open in IMG/M
3300034065|Ga0334827_125616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae820Open in IMG/M
3300034065|Ga0334827_140553All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium759Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog24.30%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa7.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere5.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.74%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.74%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil3.74%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.80%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.80%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.87%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.87%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.87%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.93%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.93%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.93%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.93%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.93%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.93%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005898Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_405EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300022863Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 1-5EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028090Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v15EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028783Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3EnvironmentalOpen in IMG/M
3300028785Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2EnvironmentalOpen in IMG/M
3300028788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2EnvironmentalOpen in IMG/M
3300028859Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_1EnvironmentalOpen in IMG/M
3300028860Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029917I_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300030041Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1EnvironmentalOpen in IMG/M
3300030051Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030693Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031259Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070673_10229828413300005364Switchgrass RhizosphereYTFPFSTFETDGSDLIGLGFLRTQEVGKFQFQIDELEIK*
Ga0070714_10135364313300005435Agricultural SoilPAWKQYTFPFSTFETDGSDISGIGFIRAQEPGKFQFAIDEVEIK*
Ga0070713_10010379513300005436Corn, Switchgrass And Miscanthus RhizosphereTSFTAGPAWKQYTFPFSTFETDGSDISGIGFIRAQEPGKFQFAIDEVEIK*
Ga0070711_10164912413300005439Corn, Switchgrass And Miscanthus RhizospherePAMTTFVASPDWKQYTFPFTAFDTDGSDLSGLGFIRILEPGTFQFAIDQVEIK*
Ga0070734_1025032533300005533Surface SoilTFVAGPDWKQYTFPFSTFDTDGSDLTGMGFIRIGQPGKFRFEIDQVEIK*
Ga0070684_10005264053300005535Corn RhizosphereGPEWKHYAFPFSTFETDGSDLSGIGFIRVGNLGKFQFDIDQVEIK*
Ga0068853_10056984523300005539Corn RhizosphereEAPTMTSFTARPEWKKYTFPFSTFETDGSDLIGLGFLRTQEVGKFQFQVDELEIK*
Ga0070733_1010600843300005541Surface SoilMTNFIAGPDWKQFTFPLSGFDTDASDLSGIGLIRLAEPGKFQFEIDQVEIK*
Ga0070672_10127278213300005543Miscanthus RhizosphereFSTFETDGSDMSGIGFLRAQEVGKFRFQIDELEIK*
Ga0075276_1010770723300005898Rice Paddy SoilQNGEPPAMTSFTAEPEWKQYTFPFSTFETDGSDLSGIGFIRAQELGKFQFQIDELEIR*
Ga0070765_10110966933300006176SoilFPFSTFETDGSDLTGLVFGKVETPGKLNFEIDQVEIR*
Ga0097621_10015536613300006237Miscanthus RhizosphereKKYTFPFSTFETDGSDLIGLGFLRTQEVGKFQFQVDELEIK*
Ga0105248_1023937013300009177Switchgrass RhizosphereMTTFVAGPEWKQYTFPLSTFETDGSDLSGLGFIRAQEPGQFQFEIDQLEIQ*
Ga0105238_1008910233300009551Corn RhizospherePAMTSFTAEPEWKRYTFPFSTFETDGSDLSGIGFIRAQEPGKFQFEIDELEIK*
Ga0126378_1153868123300010361Tropical Forest SoilAGPEWKQYTFPFSTFQTDGSDLSSLAFVATQQPGKFEFEIDQVEIK*
Ga0105239_1024768033300010375Corn RhizosphereFTFPFSTFETDGSDLTGIGFIRVMEQGKFQFQIDELEIK*
Ga0105239_1337402423300010375Corn RhizosphereAGPEWKQYTFPFSTFETDGSDLIGLGFLRTQEVGKFQFQVDELEIK*
Ga0134126_1124756413300010396Terrestrial SoilKQFTFPFSTFETDGSDLSGIGFIRAQDPGKFQFQIDELEIK*
Ga0134124_1024400013300010397Terrestrial SoilPFSTFETDGSDLIGLGFLRTQEVGKFQFQVDELEIK*
Ga0137413_1165392623300012924Vadose Zone SoilMAATPIGFLGEPPAMTSFTAGAEWKQYTFPFSTFETDGSDISGLGFVRVQEPGKFQFQIDEVEIK*
Ga0137410_1195740623300012944Vadose Zone SoilMTSFVAGPEWKQYTFPFSALETDGSDLSGIGFIKVSGPGKFQFALDQLEIK*
Ga0157374_1071249613300013296Miscanthus RhizosphereTFPFSTFETDGSDLSGIGFLRAQEAGKFQFEIDELEIK*
Ga0157378_1120085823300013297Miscanthus RhizospherePFSTFETDGSDLTGLGFLRTQEVGKFQFQIDELEIK*
Ga0157372_1006037643300013307Corn RhizospherePPAMTTFIAAPEWKQFTFPFSTFETDGSDLTGIGFIRVMEQGKFQFQIDELEIK*
Ga0157372_1038854823300013307Corn RhizosphereSTFETDGRDLSGIGFLRAQEAGKFQFEIDELEIK*
Ga0181539_131570623300014151BogTESRSGNSGQMPAMTQFVAGPEWKLYTFPFSTFETDGSDLAGLGFVKVMSMGKFQFEIDQLQIK*
Ga0181533_137342413300014152BogSGNSGQMPAMTQFVAGPEWKLYTFPFSTFETDGSDLAGLGFVKVMSMGKFQFEIDQLQIK
Ga0181537_1063739623300014201BogKQYTFPFSTFETDGSDLSGVGFVHAQEPGKFQFEIDQVEIK*
Ga0182016_1003662513300014493BogTFPLSTFETDGSDLSGLGFVHVGEPGKFQFELDQFEIK*
Ga0182021_1307479213300014502FenPEWKQYAFTFSALDIDVSDMTGLGFVRVQEPGKFQFQIDRLEIK*
Ga0132258_1154997913300015371Arabidopsis RhizosphereATFETDGGDLSSLAFVATQPPGKFAFEIDELEIK*
Ga0132255_10270134823300015374Arabidopsis RhizosphereSTFETDGSDLIGLGFLRTQEVGKFQFQIDELEIK*
Ga0182040_1182316513300016387SoilTGPEWKQYTFPFSAFETDGSDLSGIGFIRLQEPGKIQLQIDQLEIK
Ga0182037_1082202833300016404SoilQYTFPFSTFDTDGGDLTGIGFVRINNPGKFQFALDQVEIK
Ga0182038_1136833023300016445SoilAGPGWKQYTFPFSTFDTDGSDLSGIGFIRVQEPGKFQFQIDEFEIK
Ga0187801_1047029423300017933Freshwater SedimentPDWKQFTFPFSTFQTDGSDITGLLFSRAGQPGKFQFAIDEVEIK
Ga0181520_1083557523300017988BogDMPAMTQFNAGPEWKQYTFPLSTFDTDGSDLSGLGFVQVGQPGKFQFELDQLEIK
Ga0187865_132630223300018004PeatlandLYTFPFSIFETDGSDLTGLGFVKVMEVGKFQFEIDQLQIK
Ga0187867_1025924123300018033PeatlandFSTFETDGSDLAGLGFVHAQEPGKFQFEIDELQIK
Ga0187863_1060757513300018034PeatlandTFPFSTFETDGSDLSGLGFVHVMEPGKFQFEIDEVEIK
Ga0187887_1008320213300018043PeatlandYTFPFSDFETDGSDLKGLGFLRAQEPGPFSFQIDQVEIK
Ga0187770_1178113413300018090Tropical PeatlandQFTFPFSTFQTDGSDLTGLMFAHSQEPGKFQFELDEVEIK
Ga0210388_1003586613300021181SoilAMTSFVAGPDWKKYTFPFSTFETDGSDLSGLGFVRAQEAGKFQFELDQLEIK
Ga0210388_1174701923300021181SoilFVAGPDWKQYTFPFSAFETDGGDLSGIGFIKVGQPGKFQFELDQVEIK
Ga0210383_1075986633300021407SoilGEAPAMTSFVAGPEWKQYTFPFSVFETDGSDLSGIGFIKLEPGKFQFLLDQVEIK
Ga0210391_1030271623300021433SoilEWKQYTFPFSDFETDGSDLKGLGFLHAQEPGTFSFQIDQVEIK
Ga0210391_1111008213300021433SoilGPEWKQYTFPFSVFETDGSDLSGIGFIKLVPGKFQFQLDQVEIK
Ga0224532_103482313300022863SoilSRSGNSGQMPAMTPFTAGPEWKLYSFPLSTFETDGGDLSGLGFIKTMDPGKFQFEIDQLQIK
Ga0207654_1075535023300025911Corn RhizosphereAPAMTSFTAAPEWKQYTFPFSTFETDGSDLSGIGFLRAQEAGKFQFEIDELEIK
Ga0207671_1007666313300025914Corn RhizosphereTTFIAAPEWKQFTFPFSTFETDGRDLTGIGFIRVMEQGKFQFQIDELEIK
Ga0207694_1005558713300025924Corn RhizospherePAMTSFTAEPEWKRYTFPFSTFETDGSDLSGIGFIRAQEPGKFQFEIDELEIK
Ga0207700_1008461313300025928Corn, Switchgrass And Miscanthus RhizosphereTSFTAGPAWKQYTFPFSTFETDGSDISGIGFIRAQEPGKFQFAIDEVEIK
Ga0207691_1004002113300025940Miscanthus RhizosphereKKYTFPFSTFETDGSDLIGLGFLRTQEVGKFQFQIDELEIK
Ga0207691_1036441943300025940Miscanthus RhizosphereKKYTFPFSTFETDGSDLIGLGFLRTQEVGKFQFQVDELEIK
Ga0207679_1124132513300025945Corn RhizosphereEWKQFTFPFSTFETDGSDLSGIGFLRAQDPGKFQFEVDEFEIK
Ga0207677_1005824013300026023Miscanthus RhizosphereFTFPFSTFETDGRDLTGIGFIRVMEQGKFQFQIDELEIK
Ga0207703_1167260923300026035Switchgrass RhizosphereFTFPFSTFETDGSDISGIGFLRAQEVGKFRFQIDELEIK
Ga0207639_1213069823300026041Corn RhizosphereQFTFPFSTFETDGSDISGIGFLRAQEVGKFRFQIDELEIK
Ga0207702_1152676113300026078Corn RhizosphereKYTFPFSTFETDGSDLIGLGFLRTQEVGKFQFQVDELEIK
Ga0209274_1009332233300027853SoilWKQFIFPFSTFETDGSDLTGLVFGKVETPGKLNFEIDQVEIR
Ga0209579_1059950923300027869Surface SoilFPFSAFDTDGSDIFMIGFGQVETPGKFTFDIDQVEIR
Ga0209275_1017539723300027884SoilWKQYSFPFSAFDTDGSDLTGLGFIDAQRPGKFQFQIDQVEIK
Ga0255349_105811313300028090SoilFAFSDFETDGSDIKGLGFLHAQEPGTFAFQIDQVEIK
Ga0302144_1002522913300028560BogKQYTFPLSTFETDGSDLSGLGFVHVGEPGKFQFELDQFEIK
Ga0302144_1015243823300028560BogRGGSGGEMPAMTQFTAGPEWKQYTFPLSTFETDGSDLSGVGLIHVGEPGKFQFEIDQFEI
Ga0302267_1004724913300028745BogGPEWKQYTFPFSTFETDGSDLSGVGFVHVMEPGKFQFEIDQVEIK
Ga0302202_1006252333300028762BogTPFVAGPEWKQYTFPFDTFETDGSDLSGLGFVHVMEPGKFQFEIDQVEIK
Ga0302279_1004684933300028783BogFSDFETDGSDIKGLGFLHAQEPGTFAFQIDQVEIK
Ga0302279_1031374913300028783BogFPFSTFETDGSDLSGLGFVHVQEPGKFQFQIDEVEIK
Ga0302201_1002937413300028785BogGGEMPAMTQFTAGPEWKQYTFPLSTFETDGSDLSGVGLIHVGEPGKFQFEIDQFEIK
Ga0302189_1001996913300028788BogTFAFSDFETDGSDIKGLGFLHAQEPGTFAFQIDQVEIK
Ga0302265_107431823300028859BogFPFDTFETDGSDLSGLGFVHVMEPGKFQFEIDQVEIK
Ga0302265_126486213300028859BogSRSGNSGEMPAMTSFTAGPDWKQYIFPFSTFETDGSDLAGIGFLHAQEPGKFQFEIDQFKIE
Ga0302199_102711133300028860BogWKLYTFPFSTFQTDGSDLSALAFVHAQQPGKFQFEIDELQIK
Ga0302199_113663923300028860BogTFPFSTFETDGSDLAGIGFLHAQEPGKFQFEIDQFKIE
Ga0302154_1053785913300028882BogWKQYTFPFSKFETDGSDLSGLGFVHVGEAGKFQFEIDQVEIK
Ga0308309_1085487833300028906SoilMAGFVAGPEWKQFIFPFSTFETDGSDLTGLVFGKVETPGKLNFEIDQVEIR
Ga0311368_1003424953300029882PalsaEWKQYTFPFSTFETDGSDLSGVGFVHAQEPGKFQFEIDQVEIK
Ga0311368_1028147413300029882PalsaTFIAGPEWKQLAFPFSTFETDGSDLSGVGFVLAQQPGTFQFQIDQLEIK
Ga0311329_1026475733300029907BogESRSGSSGDMPAMTPFTAGGEWKQYTFPLSTFETDGSDLSGLGFVHVGEPGKFQFELDQLEIK
Ga0311329_1037249513300029907BogAGPEWKLYTFPFSTFQTDGSDLSALAFVHAQQPGKFQFEIDELQIK
Ga0311361_1097144223300029911BogGEMPAMTQFTAGPEWKQYTFPLSTFETDGSDLSGVGLIHVGEPGKFQFEIDQFEIK
Ga0311326_1016220423300029917BogQYTFPLSTFETDGSDLSGVGLIHVGEPGKFQFEIDQFEIK
Ga0311343_1003046453300029953BogRSGSSGDMPAMTPFTAGGEWKQYTFPLSTFETDGSDLSGLGFVHVGEPGKFQFELDQLEI
Ga0311343_1103319123300029953BogPLSTFETDGSDLSGLGFVHVGEPGKFQFELDQFEIK
Ga0302274_1011043813300030041BogSRGGSGGEMPAMTQFTAGPEWKQYTFPLSTFETDGSDLSGVGLIHVGEPGKFQFEIDQFEIK
Ga0302195_1006924333300030051BogTTTFVAGPDWKQYTFPFETFETDGSDLSGVGFVHVMEPGKFQFEIDQVEIK
Ga0311353_1012257343300030399PalsaTTFIAGPEWKQLAFPFSTFETDGSDLSGVGFVLAQQPGTFQFQIDQLEIK
Ga0311353_1151386123300030399PalsaYTFPFSTFETDGSDLSGLGFVRAQEPGKFQFELDDLEIK
Ga0302275_1011241323300030518BogYTFPFSTFETDGSDLTGIGFLHAQEPGNFQFEIDQFQIE
Ga0311372_1032862413300030520PalsaPEWKHFSFPFSTFETDGSDLSGLGFVHVQEPGKFQFEIDQVEIK
Ga0302313_1017274733300030693PalsaFPFSTFDTDGSDLSGLGFVHVQEPGKFQFQLDQLEIK
Ga0170824_10419717213300031231Forest SoilFAAGPEWKQYTFPFSTFETDPSDLSGIGFIRVQEPGKLQFQLDEVEIK
Ga0302324_10069064223300031236PalsaQYTFPFTDFETDGSDLKGLGFLHAQEPGTFSFQIDQLEIK
Ga0265328_1028941823300031239RhizosphereQYTFPFSTFETDGSDISGIGFIRIQEPGKFQFAIDEVEIK
Ga0302318_1011394813300031258BogTQFVAGPEWKQYTFPFSAFETDGSDLTGLGFVRIKEPGKFQFQIDQFQIQ
Ga0302187_1013507933300031259BogKLYTFPFSTFQTDGSDLSALAFVHAQQPGKFQFEIDELQIK
Ga0302140_1098756823300031261BogEWKHYSFPFSTFETDGSDLSGLGFVHVQVPGKFQFEIDQVEIK
Ga0302326_1034640313300031525PalsaDWKQYTFAFSDFETDGSDLKGLGFLHAQEPGTFSFQIDQVEIK
Ga0302319_1053238513300031788BogKHYSFPFSTFETDGSDLSGLGFVHVQVPGKFQFEIDQVEIK
Ga0318568_1062643423300031819SoilRFPFSAFETDGSDLSGLGFIRMQEQGKFQFELDEVEIK
Ga0302322_10386587313300031902FenWKKISIPFKQFETDGSDISGLGFMHVKEAGKYQFEIDQVRFE
Ga0306921_1222062413300031912SoilMTTFVAGPEWKQYAFPFSTFETDGSDVTGLGFVRINNPGKFQFAPDHVEIK
Ga0335085_1228910013300032770SoilFSAFETNGSDLIGIGFIRVQEPGKFQFDLDEFEIK
Ga0335081_1071360713300032892SoilAGPEWKQYSLPFTQFQTDGSDISGLSFVRAGQPGKFQFEIDEVEIK
Ga0334827_125616_1_1233300034065SoilQYVFPFSAFDTDGSDLTGLGFIRILEPAKFQFQLDQLEIK
Ga0334827_140553_648_7583300034065SoilPFSTFETDGSDLSGVGFVHVMEPGKFQFEIDQVEIK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.