NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092389

Metagenome / Metatranscriptome Family F092389

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092389
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 42 residues
Representative Sequence AMCGFLAFIPGHLIMVVLHGWANFYSMLSGWKREPEYQE
Number of Associated Samples 103
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.77 %
% of genes near scaffold ends (potentially truncated) 89.72 %
% of genes from short scaffolds (< 2000 bps) 89.72 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.065 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(6.542 % of family members)
Environment Ontology (ENVO) Unclassified
(14.953 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.206 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 40.30%    β-sheet: 0.00%    Coil/Unstructured: 59.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF07589PEP-CTERM 12.15
PF00902TatC 6.54
PF04542Sigma70_r2 4.67
PF00486Trans_reg_C 2.80
PF01494FAD_binding_3 2.80
PF14534DUF4440 2.80
PF01292Ni_hydr_CYTB 1.87
PF08281Sigma70_r4_2 1.87
PF03781FGE-sulfatase 1.87
PF13442Cytochrome_CBB3 1.87
PF12146Hydrolase_4 0.93
PF13581HATPase_c_2 0.93
PF04224DUF417 0.93
PF08713DNA_alkylation 0.93
PF00355Rieske 0.93
PF08448PAS_4 0.93
PF10099RskA 0.93
PF10282Lactonase 0.93
PF01068DNA_ligase_A_M 0.93
PF01039Carboxyl_trans 0.93
PF02770Acyl-CoA_dh_M 0.93
PF04264YceI 0.93
PF12770CHAT 0.93
PF05199GMC_oxred_C 0.93
PF01406tRNA-synt_1e 0.93
PF13620CarboxypepD_reg 0.93
PF02801Ketoacyl-synt_C 0.93
PF02469Fasciclin 0.93
PF09190DALR_2 0.93
PF13091PLDc_2 0.93
PF00033Cytochrome_B 0.93
PF00072Response_reg 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0805Twin-arginine protein secretion pathway component TatCIntracellular trafficking, secretion, and vesicular transport [U] 6.54
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 5.61
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 4.67
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 4.67
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 4.67
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 4.67
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 2.80
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 2.80
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 2.80
COG0215Cysteinyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 1.87
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 1.87
COG4117Thiosulfate reductase cytochrome b subunitInorganic ion transport and metabolism [P] 1.87
COG3658Cytochrome b subunit of Ni2+-dependent hydrogenaseEnergy production and conversion [C] 1.87
COG3038Cytochrome b561Energy production and conversion [C] 1.87
COG1969Ni,Fe-hydrogenase I cytochrome b subunitEnergy production and conversion [C] 1.87
COG2864Cytochrome b subunit of formate dehydrogenaseEnergy production and conversion [C] 1.87
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.93
COG49123-methyladenine DNA glycosylase AlkDReplication, recombination and repair [L] 0.93
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 0.93
COG3059Reactive chlorine resistance protein RclC/YkgB, DUF417 familyDefense mechanisms [V] 0.93
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.93
COG2335Uncaracterized surface protein containing fasciclin (FAS1) repeatsGeneral function prediction only [R] 0.93
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.93
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.93
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.93
COG0018Arginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.93
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.93
COG1290Cytochrome b subunit of the bc complexEnergy production and conversion [C] 0.93
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 0.93
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.07 %
UnclassifiedrootN/A0.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352024|deeps__Contig_79341All Organisms → cellular organisms → Bacteria → Acidobacteria651Open in IMG/M
3300000567|JGI12270J11330_10091214All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1378Open in IMG/M
3300000956|JGI10216J12902_101947914All Organisms → cellular organisms → Bacteria → Acidobacteria1629Open in IMG/M
3300002917|JGI25616J43925_10235719All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300004080|Ga0062385_10265902All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae964Open in IMG/M
3300004080|Ga0062385_10608257All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae692Open in IMG/M
3300004092|Ga0062389_102427617All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300004092|Ga0062389_104456046All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89527Open in IMG/M
3300004104|Ga0058891_1460982All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300004156|Ga0062589_101099857All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300005175|Ga0066673_10740678All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300005445|Ga0070708_101423841All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300005451|Ga0066681_10638680All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300005541|Ga0070733_10522677All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae794Open in IMG/M
3300005542|Ga0070732_10057504All Organisms → cellular organisms → Bacteria2254Open in IMG/M
3300005552|Ga0066701_10877907All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300005764|Ga0066903_106082211All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300005897|Ga0075281_1031913All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300006028|Ga0070717_11164880All Organisms → cellular organisms → Bacteria → Acidobacteria702Open in IMG/M
3300006049|Ga0075417_10227963All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300006059|Ga0075017_100528841All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300006059|Ga0075017_101361725All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300006086|Ga0075019_10225758All Organisms → cellular organisms → Bacteria1113Open in IMG/M
3300006102|Ga0075015_101000985All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300006176|Ga0070765_101606576All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae611Open in IMG/M
3300006354|Ga0075021_11016302All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300006800|Ga0066660_11702836All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae503Open in IMG/M
3300006904|Ga0075424_101736987All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300007004|Ga0079218_10848620All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300009100|Ga0075418_11293869All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300009137|Ga0066709_102297785All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300009177|Ga0105248_12358973All Organisms → cellular organisms → Bacteria → Acidobacteria606Open in IMG/M
3300009523|Ga0116221_1484540All Organisms → cellular organisms → Bacteria → Acidobacteria541Open in IMG/M
3300009524|Ga0116225_1224372All Organisms → cellular organisms → Bacteria → Acidobacteria846Open in IMG/M
3300009553|Ga0105249_12886679All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300009824|Ga0116219_10680324All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300010339|Ga0074046_10107425All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1799Open in IMG/M
3300010360|Ga0126372_12566419All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300010371|Ga0134125_13017222All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300010379|Ga0136449_102420884All Organisms → cellular organisms → Bacteria → Acidobacteria756Open in IMG/M
3300010401|Ga0134121_11533620All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300012043|Ga0136631_10012213All Organisms → cellular organisms → Bacteria3016Open in IMG/M
3300012046|Ga0136634_10533387All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300012092|Ga0136621_1310942All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300012093|Ga0136632_10508634All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300012096|Ga0137389_10101825All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1172284Open in IMG/M
3300012202|Ga0137363_10514606All Organisms → cellular organisms → Bacteria → Acidobacteria1006Open in IMG/M
3300012202|Ga0137363_11133886All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium665Open in IMG/M
3300012363|Ga0137390_10224247All Organisms → cellular organisms → Bacteria → Acidobacteria1866Open in IMG/M
3300012917|Ga0137395_10246750All Organisms → cellular organisms → Bacteria → Acidobacteria1254Open in IMG/M
3300012955|Ga0164298_10601488All Organisms → cellular organisms → Bacteria → Acidobacteria755Open in IMG/M
3300014056|Ga0120125_1072403All Organisms → cellular organisms → Bacteria → Acidobacteria779Open in IMG/M
3300016319|Ga0182033_10833313All Organisms → cellular organisms → Bacteria → Acidobacteria814Open in IMG/M
3300016357|Ga0182032_10415307All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1091Open in IMG/M
3300016445|Ga0182038_10241635All Organisms → cellular organisms → Bacteria1446Open in IMG/M
3300017656|Ga0134112_10372531All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300017996|Ga0187891_1118842All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300018006|Ga0187804_10149158All Organisms → cellular organisms → Bacteria → Acidobacteria984Open in IMG/M
3300018024|Ga0187881_10036400All Organisms → cellular organisms → Bacteria2499Open in IMG/M
3300018038|Ga0187855_10176934All Organisms → cellular organisms → Bacteria → Acidobacteria1265Open in IMG/M
3300018040|Ga0187862_10877226All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → Ideonella azotifigens515Open in IMG/M
3300018047|Ga0187859_10020502All Organisms → cellular organisms → Bacteria3664Open in IMG/M
3300018468|Ga0066662_12228338All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300019362|Ga0173479_10569572All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300019377|Ga0190264_11018020All Organisms → cellular organisms → Bacteria → Acidobacteria664Open in IMG/M
3300020199|Ga0179592_10199404All Organisms → cellular organisms → Bacteria → Acidobacteria907Open in IMG/M
3300020581|Ga0210399_10362166All Organisms → cellular organisms → Bacteria → Acidobacteria1210Open in IMG/M
3300021181|Ga0210388_10080343All Organisms → cellular organisms → Bacteria2765Open in IMG/M
3300025500|Ga0208686_1002386All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6933Open in IMG/M
3300025938|Ga0207704_10224198All Organisms → cellular organisms → Bacteria → Acidobacteria1393Open in IMG/M
3300026121|Ga0207683_10033363All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis4471Open in IMG/M
3300026331|Ga0209267_1334630All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300026480|Ga0257177_1034548All Organisms → cellular organisms → Bacteria → Acidobacteria753Open in IMG/M
3300026482|Ga0257172_1099092All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300026529|Ga0209806_1266739All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300027394|Ga0209904_1021250All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300027655|Ga0209388_1135936All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium698Open in IMG/M
3300027783|Ga0209448_10116401All Organisms → cellular organisms → Bacteria → Acidobacteria895Open in IMG/M
3300027812|Ga0209656_10184970All Organisms → cellular organisms → Bacteria → Acidobacteria1020Open in IMG/M
3300027854|Ga0209517_10476154All Organisms → cellular organisms → Bacteria → Acidobacteria685Open in IMG/M
3300027898|Ga0209067_10063864All Organisms → cellular organisms → Bacteria1884Open in IMG/M
3300027905|Ga0209415_10398619All Organisms → cellular organisms → Bacteria → Acidobacteria1113Open in IMG/M
3300028565|Ga0302145_10266208All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300028747|Ga0302219_10155864All Organisms → cellular organisms → Bacteria → Acidobacteria875Open in IMG/M
3300028780|Ga0302225_10537762All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium544Open in IMG/M
3300028889|Ga0247827_10892797All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300029922|Ga0311363_11207316All Organisms → cellular organisms → Bacteria → Acidobacteria637Open in IMG/M
3300029984|Ga0311332_10125099All Organisms → cellular organisms → Bacteria1889Open in IMG/M
3300029986|Ga0302188_10175936All Organisms → cellular organisms → Bacteria → Acidobacteria914Open in IMG/M
3300029987|Ga0311334_10110862All Organisms → cellular organisms → Bacteria2034Open in IMG/M
3300029999|Ga0311339_10024801All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8728Open in IMG/M
3300030518|Ga0302275_10469709All Organisms → cellular organisms → Bacteria → Acidobacteria639Open in IMG/M
3300030991|Ga0073994_10054306All Organisms → cellular organisms → Bacteria → Acidobacteria742Open in IMG/M
3300031640|Ga0318555_10419565All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium725Open in IMG/M
3300031682|Ga0318560_10151800All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1226Open in IMG/M
3300031718|Ga0307474_10987144All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300031754|Ga0307475_10694935All Organisms → cellular organisms → Bacteria → Acidobacteria811Open in IMG/M
3300031847|Ga0310907_10730972All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M
3300031943|Ga0310885_10186134All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1018Open in IMG/M
3300032012|Ga0310902_10434692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi843Open in IMG/M
3300032261|Ga0306920_101172311All Organisms → cellular organisms → Bacteria → Acidobacteria1111Open in IMG/M
3300032805|Ga0335078_11124589All Organisms → cellular organisms → Bacteria → Acidobacteria916Open in IMG/M
3300032954|Ga0335083_11497257All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300033004|Ga0335084_10692126All Organisms → cellular organisms → Bacteria → Acidobacteria1039Open in IMG/M
3300033134|Ga0335073_11444518All Organisms → cellular organisms → Bacteria → Acidobacteria668Open in IMG/M
3300033829|Ga0334854_042263All Organisms → cellular organisms → Bacteria → Acidobacteria1094Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.54%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.54%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil5.61%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds5.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.67%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand3.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.74%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.80%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.80%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.80%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.80%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.87%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.87%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.87%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.87%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.87%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.93%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.93%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.93%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.93%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.93%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.93%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004104Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005897Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012043Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06)EnvironmentalOpen in IMG/M
3300012046Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06)EnvironmentalOpen in IMG/M
3300012092Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06)EnvironmentalOpen in IMG/M
3300012093Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06)EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300014056Permafrost microbial communities from Nunavut, Canada - A20_5cm_0MEnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026480Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-BEnvironmentalOpen in IMG/M
3300026482Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-BEnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027394Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3DEnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028565Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028780Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029986Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1EnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033829Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deeps_013165902199352024SoilFPLARLWHFLALCGFLSFIPGHLIMVLLHGWQNFYSMLAGWKRDPEYLR
JGI12270J11330_1009121413300000567Peatlands SoilWIRIWHFAAMCGFLAFIPGHLIMVLLHGWANFYSMLSGWKREPEYQE*
JGI10216J12902_10194791423300000956SoilMIHFSALLGFAAFIPGHLFMVALHGWNNFASMLTGWKKDPDYLRSSDSL*
JGI25616J43925_1023571913300002917Grasslands SoilHFVAMCGFLAFIPGHLIMVVLHGWANFYSMLSGWKREPEYQE*
Ga0062385_1026590223300004080Bog Forest SoilHFAAMCGFLAFIPGHLIMVLLHGWSNFFSMLSGWKREPEYQE*
Ga0062385_1060825713300004080Bog Forest SoilAMCGFVAFIPGHLIMVVLHGWNNFYSMVTGWKRDPEYLG*
Ga0062389_10242761713300004092Bog Forest SoilAMCGFVAFIPGHLIMVLLHGWNNFYSMMTGWKRDPEYLD*
Ga0062389_10445604613300004092Bog Forest SoilAMCGFVAFIPGHLIMVALHGWNNFYSMITGWKRDPEYIE*
Ga0058891_146098223300004104Forest SoilHFAAMCGFLAFIPGHLIMVVLHGWANFYSMFSGWKREPEYQE*
Ga0062589_10109985713300004156SoilAMCGFLAFIPGHLIMVALHGWTNFVSMLVGWKRDPEYHAD*
Ga0066673_1074067813300005175SoilAMCGFLAFIPGHLIMVVLHGWNNFASMLTGWKRDPGYRVPLS*
Ga0065715_1028208013300005293Miscanthus RhizosphereGYGLVRGWHFFALCGFAAFIPGHLVMVAIHGWRNFTAMLTGWKRDPEYVKR*
Ga0070708_10142384123300005445Corn, Switchgrass And Miscanthus RhizosphereCGFLAFIPGHLVMVAIHGWDNFQSMLTGWKRHPEYLKPR*
Ga0066681_1063868023300005451SoilFAAMCGFLAFIPGHLIMVVLHGWNNFYSMLTGWKKDPEYAGD*
Ga0070733_1052267723300005541Surface SoilHFAAMCGFLAFIPGHLLMVVLHGWDNFASMLTGWKRNPGYRTPLA*
Ga0070732_1005750413300005542Surface SoilGHLIMVVLHGWSNFASMLTGWKRDPEYLPRRSSE*
Ga0066701_1087790713300005552SoilWHFAAMCGFLAFIPGHLIMVVLHGWNNFASMLTGWKRDPGYRLPAS*
Ga0066903_10608221133300005764Tropical Forest SoilLVHFLSMCALLAFIPGHLIMVVLHGWDNFSSILTGWKRHPEYVAVEREP*
Ga0075281_103191313300005897Rice Paddy SoilGFLAFIPGHVIMVVLHGWSNFASMLTGWKRDPEYLSRRSAE*
Ga0070717_1116488023300006028Corn, Switchgrass And Miscanthus RhizosphereIPGHLIMVAIHGWNNFMAMLTGWKRDPEYSDRGAKAGG*
Ga0075417_1022796313300006049Populus RhizosphereLAMCGFLAFIPGHLVMVLLHGWHNFVAMLTGWKRDPEYLKAPVER*
Ga0075017_10052884123300006059WatershedsFAAMCGFLAFIPGHLIMVLLHGWSNFFAMLSGWKRDPEYQE*
Ga0075017_10136172523300006059WatershedsWHFFAMCGFLAFIPGHLIMVLLHGWSNFFSMLSGWKREPEYQE*
Ga0075019_1022575813300006086WatershedsFHLTRLWHFAAMCGFLAFIPGHLIMVVLHGWSNFFSMLSGWKREPEYQE*
Ga0075015_10100098513300006102WatershedsRGWHFAAMCGFLAFIPGHLIMVLLHGWSNFFAMLSGWKRDPEYQE*
Ga0070765_10160657623300006176SoilAMCGFLAFIPGHLIMVLLHGWSNFYSMLSGWKREPDYQE*
Ga0075021_1101630213300006354WatershedsRLWHFAAMCGFLAFIPGHLIMVLLHGWSNVYSMLSGWKREPEYQE*
Ga0066660_1170283623300006800SoilCGFLAFIPGHLIMVVLHGWNNFYSMLTGWKKDPEYAGD*
Ga0075424_10173698723300006904Populus RhizosphereVHFVAMCGILGFIPGHLIMVGLHGWDNFVSIFTGWKRHPEYVPLGRKP*
Ga0079218_1084862023300007004Agricultural SoilMTHFAAMIGFLSFIPGHLLMVALHGWSNFYSMLTGWKSDPDYFNSRW*
Ga0075418_1129386913300009100Populus RhizosphereFLAMCSFLVFLPGHLIMVALHGWNNFRSMLTGWKRDPDYLKAL*
Ga0066709_10229778523300009137Grasslands SoilLFLSFVPGHLLMVAIHGWDNFYSMMVGWKRDPEYLRKKD*
Ga0105248_1235897313300009177Switchgrass RhizosphereRIWHFLALCGFAAFVPGHLVMVALHGWQNFVAMLTGWKRDPEYLGRKGA*
Ga0116221_148454013300009523Peatlands SoilAMCGFLAFIPGHLIMVLLHGWSNFFSMLSGWKREPEYQE*
Ga0116225_122437223300009524Peatlands SoilMKGSSGVRWIRICHFAAMCGFLAFIPGHLIMVLLHGWANFYSMLSGWKREPEYQE*
Ga0105249_1288667923300009553Switchgrass RhizosphereFVATCGFLAFIPGHLIMVALHGWKNFVSMIVGWKRDSEYHAG*
Ga0116219_1068032423300009824Peatlands SoilMKGSSGVRWIRIWHFAAMCGFLAFIPGHLIMVLLHGWANFYSMLSGWKREPEYQE*
Ga0074046_1010742513300010339Bog Forest SoilLARIWHFLAMCGFLAFIPGHLIMVALHGWKNFYSMVTGWKRDPEYWG*
Ga0126372_1256641923300010360Tropical Forest SoilRIWHFFSMVGFVAFIPGHLIMVGLHGWNNFYSMITGWKRDPEYVKTVDSK*
Ga0134125_1301722223300010371Terrestrial SoilPGHLIMVVLHGWSNFASMLTGWKRDPEYLSRRSTP*
Ga0136449_10242088413300010379Peatlands SoilRLWHFVAMCGFLAFIPGHLVMVVLHGWSNFVSMLVGWKKDPGYLR*
Ga0134121_1153362023300010401Terrestrial SoilGFLAFIPGHLIMVAVHGWTNFVSMLVGWKRDPEYRAD*
Ga0136631_1001221353300012043Polar Desert SandMCGFLAFIPGHLLMVAVHGWSNFASMLVGWKKDPEYGAPE
Ga0136634_1053338713300012046Polar Desert SandRLIHFLSMCGLLAFIPGHLIMVLLHGWDNFASMVTGWKRYPEYTSGNKS*
Ga0136621_131094223300012092Polar Desert SandMCGFLAFTPGHLVMVALHGWNNFASMLVGWKKDPEYGKPETLR*
Ga0136632_1050863413300012093Polar Desert SandMCGFLAFIPGHLVMVGLHGWNNFVSMLVGWKKTQSTG
Ga0137389_1010182513300012096Vadose Zone SoilGFLAFIPGHLIMVAIHGWNNFMAMLTGWKRDPEYVKPGDVSGD*
Ga0137363_1051460633300012202Vadose Zone SoilLAFIPGHLIMVALHGWANFYSMLSGWKREPEYQE*
Ga0137363_1113388613300012202Vadose Zone SoilMYGLLAFIPGHLVMVALHGWDNFASMLTGWKRHPEYTPSQEAR*
Ga0137390_1022424743300012363Vadose Zone SoilMCGFLAFIPGHLIMVVLHGWANFLSMLSGWKREPEYQE*
Ga0137395_1024675033300012917Vadose Zone SoilWHFAAMCGFLAFIPGHLIMVVLHGWANFLSMLSGWKREPEYQE*
Ga0164298_1060148823300012955SoilFALCGFAAFIPGHLVMVAIHGWRNFTAMLTGWKRDPEYVKR*
Ga0120125_107240333300014056PermafrostMCGFLAFIPGHLIMVLLHGWNNFYSMVTGWKRDPEYLG*
Ga0182033_1083331333300016319SoilFIPGHLIMVVLHGWDNFASMITGWKRHPEYVAAEREP
Ga0182032_1041530713300016357SoilMVRLGHFLAMCGLLAFIPGHLPLVALHGWNNCRAMLDGYKREPEYLE
Ga0182038_1024163513300016445SoilFLAMCGLLAFIPGHLLIVALHGWNNCRAMLDGYKREPEYLE
Ga0134112_1037253133300017656Grasslands SoilGFLAFIPGHLIMVVLHGWNNFASMLTGWKRDPGYRLPTS
Ga0187891_111884213300017996PeatlandRIWHFAAMCGFLAFIPGHLIMVLLHGWSNFYSMLSGWKREPEYQE
Ga0187804_1014915823300018006Freshwater SedimentFAVMAGLLFFIVGHLIMVVLHGWRNFASMLTGWKRDPEYPV
Ga0187881_1003640013300018024PeatlandFVAFIPGHLIMVLLHGWNNFYSMMTGWKRDPEYLD
Ga0187855_1017693413300018038PeatlandAMCGFLAFIPGHLIMVLLHGWSNFFSMLSGWKREPEYQE
Ga0187862_1087722613300018040PeatlandIWHFVAMCGFVAFIPGHLIMVLLHGWNNFYSMMTGWKRDPEYLD
Ga0187859_1002050213300018047PeatlandWHFAAMCGFLAFIPGHLIMVLLHGWSNFFSMLSGWKREPEYQE
Ga0066662_1222833833300018468Grasslands SoilMCGFLAFIPGHLIMVLLHGWNNFYSMLAGWKRDPEYL
Ga0173479_1056957213300019362SoilHFFALCGFAAFIPGHLVMVAIHGWRNFTAMLTGWKRDPEYVKR
Ga0190264_1101802023300019377SoilFAAFVPGHLVMVAIHGWQNFASMLTGWKRNPEYLRSRGS
Ga0179592_1019940413300020199Vadose Zone SoilCGFLAFIPGHLIMVVLHGWANFYSMLSGWKREPEYQE
Ga0210399_1036216623300020581SoilVWHFAATCGFLAFIPGHLIMVVLHGWANFYSMLSGWKREPEYQE
Ga0210388_1008034343300021181SoilMCGFLAFIPGHLIMVLLHGWSNFYSMLSGWKREPEYQE
Ga0208686_100238693300025500PeatlandMWHFAAMCGFLAFIPGHLIMVLLHGWSNFFSMLSGWKREPEYQE
Ga0207704_1022419843300025938Miscanthus RhizosphereVPGHLVMVALHGWENFVAMLTGWKRDPEYLGRKGA
Ga0207683_1003336363300026121Miscanthus RhizosphereVRIWHFLALCGFAAFVPGHLVMVALHGWQNFVAMLTGWKRDPEYLGRKGA
Ga0209267_133463023300026331SoilFIPGHLIMVVLHGWNNFASMLTGWKRDPGYRLPAS
Ga0257177_103454813300026480SoilFAAMCGFLAFIPGHLIMVVLHGWANFLSMLSGWKREPEYQE
Ga0257172_109909223300026482SoilGFLAFIPGHLIMVVLHGWANFYSMLSGWKREPEYQE
Ga0209806_126673923300026529SoilVWHFAAMCGFLAFIPGHLIMVVLHGWNNFYSMLTGWKKDPEYAGD
Ga0209904_102125023300027394Thawing PermafrostMCGFLAFIPGHLIMVVLHGWANFYSMLSGWKREPGYQE
Ga0209388_113593613300027655Vadose Zone SoilLVHFLAMCGLLAFIPGHLMMVALHGWDNFTSMLTGWKRRPEYEPQRSER
Ga0209448_1011640133300027783Bog Forest SoilMCGFLAFIPGHLIMVLLHGWSNFFSMLSGWKRDPEYQE
Ga0209656_1018497033300027812Bog Forest SoilFAAMCGFLAFIPGHLLMVVLHGWSNFFSMLSGWKREPEYQE
Ga0209517_1047615413300027854Peatlands SoilMKGSSGVRWIRIWHFAAMCGFLAFIPGHLIMVLLHGWANFYSMLSGWKREPEYQE
Ga0209067_1006386423300027898WatershedsFHLTRLWHFAAMCGFLAFIPGHLIMVVLHGWSNFFSMLSGWKREPEYQE
Ga0209415_1039861933300027905Peatlands SoilFVAMCGFLAFIPGHLVMVVLHGWSNFASMLVGWKKDPEYLR
Ga0302145_1026620813300028565BogIWHFAAMCGFLAFIPGHLIMVALHGWSNFYSMLSGWKREPEYQE
Ga0302219_1015586413300028747PalsaWHFAAMCGFLAFIPGHLIMVALHGWANFFSMFSGWKREPEYQE
Ga0302225_1053776213300028780PalsaCGFVAFIPGHLIMVSLHGWNNFYSMLTGYKRDPEYID
Ga0247827_1089279723300028889SoilFAAFVPGHLVMVALHGWQNFVAMLTGWKRDPEYLGRKGA
Ga0311363_1120731613300029922FenISMCGFVAFIPGHLIMVLLHGWNNFYSMITGWKRDPEYLD
Ga0311332_1012509963300029984FenFLSFIPGHLIMVVLHGWSNFMSMLSGWKREPEYQE
Ga0302188_1017593613300029986BogAAMCGFLAFIPGHLIMVALHGWSNFYSMLSGWKREPEYQE
Ga0311334_1011086213300029987FenMCGFVSFIPGHLLMVALHGWNNFYSMLTGWKKNPDYLAK
Ga0311339_1002480113300029999PalsaCGFLAFIPGHLIMVLLHGWSNFFSMLSGWKREPEYQE
Ga0302275_1046970913300030518BogWHFAAMCGFLAFIPGHLIMVALHGWSNFYSMLSGWKREPEYQE
Ga0073994_1005430613300030991SoilAAMCGFLAFIPGHLIMVVLHGWANFYSMLSGWKREPEYQE
Ga0318555_1041956533300031640SoilRLVHFLSMCALLAFIPGHLIMVVLHGWDNFASILTGWKRHPEYVAVEREP
Ga0318560_1015180033300031682SoilCALLAFIPGHLIMVVLHGWDNFASILTGWKRHPEYVAVEREP
Ga0307474_1098714413300031718Hardwood Forest SoilGVLCAFVLFVLGHLVMVILHGWNNFTSMLTGWKRDPEYLQ
Ga0307475_1069493543300031754Hardwood Forest SoilAMCGFLAFIPGHLIMVVLHGWANFYSMLSGWKREPEYQE
Ga0310907_1073097213300031847SoilVPGHLVMVALHGWQNFVAMLTGWKRDPEYLGRKGA
Ga0310885_1018613423300031943SoilFLAMCGFLAFIPGHLIMVVLHGWKNFVSMLVGWKRDPEYHAD
Ga0310902_1043469213300032012SoilNARTIHFLAMCGMLAFIPGHLVMVALHGWDNFASMVTGWKRHPEYVVGSK
Ga0306920_10117231133300032261SoilMCGFVAFIPGHLIMVALHGWNNFYSMITGWKRDPEYLGGRPNLR
Ga0335078_1112458923300032805SoilISMCGFLAFIPGHLIMVALHGWNNFYSMLTGWKRDPEYRG
Ga0335083_1149725713300032954SoilMCGFVAFIPGHLIMVALHGWNNFYSMITGWKRDPEYIDRA
Ga0335084_1069212613300033004SoilMCGFVAFIPGHLVMVVLHGWNNFYSMITGWKRDPEYLR
Ga0335073_1144451813300033134SoilFVAFIPGHLIMVGLHGWNNFYSMITGWKHDPEYVE
Ga0334854_042263_17_1333300033829SoilMCGFLAFIPGHLIMVALHGWANFFSMFSGWKREPEYQE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.