| Basic Information | |
|---|---|
| Family ID | F092382 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 41 residues |
| Representative Sequence | EKGIDASRISTRVGTASTEKGSEKENRRVDFVFVPEGATY |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.87 % |
| % of genes near scaffold ends (potentially truncated) | 99.07 % |
| % of genes from short scaffolds (< 2000 bps) | 91.59 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.336 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.234 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.776 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.206 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.29% β-sheet: 0.00% Coil/Unstructured: 89.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 7.48 |
| PF00158 | Sigma54_activat | 6.54 |
| PF13570 | PQQ_3 | 5.61 |
| PF02012 | BNR | 2.80 |
| PF14870 | PSII_BNR | 1.87 |
| PF02954 | HTH_8 | 1.87 |
| PF01797 | Y1_Tnp | 1.87 |
| PF08241 | Methyltransf_11 | 0.93 |
| PF00889 | EF_TS | 0.93 |
| PF14559 | TPR_19 | 0.93 |
| PF15902 | Sortilin-Vps10 | 0.93 |
| PF02518 | HATPase_c | 0.93 |
| PF01590 | GAF | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.87 |
| COG0264 | Translation elongation factor EF-Ts | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.34 % |
| Unclassified | root | N/A | 47.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001137|JGI12637J13337_1000751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2459 | Open in IMG/M |
| 3300004080|Ga0062385_10309892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300004091|Ga0062387_101652828 | Not Available | 519 | Open in IMG/M |
| 3300004092|Ga0062389_103966208 | Not Available | 556 | Open in IMG/M |
| 3300004635|Ga0062388_102413591 | Not Available | 550 | Open in IMG/M |
| 3300005148|Ga0066819_1013250 | Not Available | 620 | Open in IMG/M |
| 3300005436|Ga0070713_101031038 | Not Available | 794 | Open in IMG/M |
| 3300005534|Ga0070735_10016850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5373 | Open in IMG/M |
| 3300005561|Ga0066699_10635895 | Not Available | 766 | Open in IMG/M |
| 3300005591|Ga0070761_10807616 | Not Available | 590 | Open in IMG/M |
| 3300005602|Ga0070762_10092778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1735 | Open in IMG/M |
| 3300005712|Ga0070764_10360263 | Not Available | 851 | Open in IMG/M |
| 3300005952|Ga0080026_10123542 | Not Available | 735 | Open in IMG/M |
| 3300006176|Ga0070765_102017477 | Not Available | 539 | Open in IMG/M |
| 3300006354|Ga0075021_10546623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300006358|Ga0068871_101042291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300006358|Ga0068871_101607189 | Not Available | 615 | Open in IMG/M |
| 3300007265|Ga0099794_10601496 | Not Available | 582 | Open in IMG/M |
| 3300009088|Ga0099830_10286859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1311 | Open in IMG/M |
| 3300009545|Ga0105237_10921815 | Not Available | 881 | Open in IMG/M |
| 3300009553|Ga0105249_11108348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 862 | Open in IMG/M |
| 3300009615|Ga0116103_1125123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300009635|Ga0116117_1192002 | Not Available | 537 | Open in IMG/M |
| 3300009764|Ga0116134_1038282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1872 | Open in IMG/M |
| 3300009792|Ga0126374_10250172 | Not Available | 1157 | Open in IMG/M |
| 3300010046|Ga0126384_11083874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
| 3300010047|Ga0126382_12327578 | Not Available | 518 | Open in IMG/M |
| 3300010343|Ga0074044_10259084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1147 | Open in IMG/M |
| 3300010343|Ga0074044_10578414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300010359|Ga0126376_12437387 | Not Available | 570 | Open in IMG/M |
| 3300010376|Ga0126381_100384015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1951 | Open in IMG/M |
| 3300010376|Ga0126381_102396661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
| 3300010376|Ga0126381_104804311 | Not Available | 519 | Open in IMG/M |
| 3300012096|Ga0137389_10806100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
| 3300012189|Ga0137388_10474646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1161 | Open in IMG/M |
| 3300012202|Ga0137363_11438091 | Not Available | 580 | Open in IMG/M |
| 3300012211|Ga0137377_11212850 | Not Available | 684 | Open in IMG/M |
| 3300012349|Ga0137387_10942413 | Not Available | 622 | Open in IMG/M |
| 3300012361|Ga0137360_10991135 | Not Available | 725 | Open in IMG/M |
| 3300012918|Ga0137396_10824738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300012923|Ga0137359_10618235 | Not Available | 949 | Open in IMG/M |
| 3300013308|Ga0157375_11465177 | Not Available | 805 | Open in IMG/M |
| 3300014201|Ga0181537_10482762 | Not Available | 848 | Open in IMG/M |
| 3300015373|Ga0132257_104634486 | Not Available | 500 | Open in IMG/M |
| 3300016387|Ga0182040_11127781 | Not Available | 658 | Open in IMG/M |
| 3300016422|Ga0182039_11066123 | Not Available | 727 | Open in IMG/M |
| 3300017974|Ga0187777_10087836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2030 | Open in IMG/M |
| 3300017995|Ga0187816_10576767 | Not Available | 506 | Open in IMG/M |
| 3300018006|Ga0187804_10079997 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| 3300018038|Ga0187855_10787942 | Not Available | 554 | Open in IMG/M |
| 3300018482|Ga0066669_10326618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1261 | Open in IMG/M |
| 3300019788|Ga0182028_1091647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
| 3300020579|Ga0210407_10775713 | Not Available | 740 | Open in IMG/M |
| 3300020581|Ga0210399_10321742 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300020581|Ga0210399_10528690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 979 | Open in IMG/M |
| 3300021168|Ga0210406_10656293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
| 3300021178|Ga0210408_10569960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 898 | Open in IMG/M |
| 3300021401|Ga0210393_10010540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7192 | Open in IMG/M |
| 3300021405|Ga0210387_10372512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1264 | Open in IMG/M |
| 3300021420|Ga0210394_10997228 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300021432|Ga0210384_11830776 | Not Available | 513 | Open in IMG/M |
| 3300021475|Ga0210392_10190051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1427 | Open in IMG/M |
| 3300021475|Ga0210392_10653548 | Not Available | 781 | Open in IMG/M |
| 3300021477|Ga0210398_10386854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1141 | Open in IMG/M |
| 3300021478|Ga0210402_10815341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300021559|Ga0210409_10012298 | All Organisms → cellular organisms → Bacteria | 8547 | Open in IMG/M |
| 3300021559|Ga0210409_10450631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1147 | Open in IMG/M |
| 3300021559|Ga0210409_11510068 | Not Available | 548 | Open in IMG/M |
| 3300024179|Ga0247695_1011011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1274 | Open in IMG/M |
| 3300024182|Ga0247669_1026908 | Not Available | 975 | Open in IMG/M |
| 3300025914|Ga0207671_10605080 | Not Available | 873 | Open in IMG/M |
| 3300025916|Ga0207663_10492191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
| 3300025961|Ga0207712_12050817 | Not Available | 512 | Open in IMG/M |
| 3300026839|Ga0207764_115846 | Not Available | 687 | Open in IMG/M |
| 3300027288|Ga0208525_1020668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
| 3300027605|Ga0209329_1122502 | Not Available | 572 | Open in IMG/M |
| 3300027645|Ga0209117_1083200 | Not Available | 893 | Open in IMG/M |
| 3300027795|Ga0209139_10356798 | Not Available | 511 | Open in IMG/M |
| 3300027857|Ga0209166_10504959 | Not Available | 621 | Open in IMG/M |
| 3300027894|Ga0209068_10512877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300027908|Ga0209006_10640048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300027986|Ga0209168_10052929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2166 | Open in IMG/M |
| 3300028536|Ga0137415_11039671 | Not Available | 631 | Open in IMG/M |
| 3300028759|Ga0302224_10162677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300028906|Ga0308309_11557295 | Not Available | 563 | Open in IMG/M |
| 3300031057|Ga0170834_102466482 | Not Available | 576 | Open in IMG/M |
| 3300031545|Ga0318541_10702324 | Not Available | 565 | Open in IMG/M |
| 3300031546|Ga0318538_10372737 | Not Available | 771 | Open in IMG/M |
| 3300031573|Ga0310915_10581398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300031682|Ga0318560_10062688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1859 | Open in IMG/M |
| 3300031771|Ga0318546_10652130 | Not Available | 741 | Open in IMG/M |
| 3300031879|Ga0306919_10424291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1022 | Open in IMG/M |
| 3300031912|Ga0306921_11514139 | Not Available | 733 | Open in IMG/M |
| 3300031912|Ga0306921_12343440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300031942|Ga0310916_10831973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
| 3300032042|Ga0318545_10020550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2097 | Open in IMG/M |
| 3300032091|Ga0318577_10108288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1305 | Open in IMG/M |
| 3300032174|Ga0307470_10143045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1450 | Open in IMG/M |
| 3300032180|Ga0307471_100073197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2968 | Open in IMG/M |
| 3300032180|Ga0307471_104243983 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300032770|Ga0335085_10687714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1139 | Open in IMG/M |
| 3300032782|Ga0335082_10714851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
| 3300032897|Ga0335071_11971574 | Not Available | 527 | Open in IMG/M |
| 3300032955|Ga0335076_11359349 | Not Available | 596 | Open in IMG/M |
| 3300033158|Ga0335077_10090448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3612 | Open in IMG/M |
| 3300033289|Ga0310914_10612362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300033983|Ga0371488_0131414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1337 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.23% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.28% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.54% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.74% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.80% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.87% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.93% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.93% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.93% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005148 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMA | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009615 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024179 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36 | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026839 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 52 (SPAdes) | Environmental | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12637J13337_10007513 | 3300001137 | Forest Soil | LSRVSTRVGTASTEKGSEKANRRVDFIFVPEGANY* |
| Ga0062385_103098922 | 3300004080 | Bog Forest Soil | AKKYLGEKGIDASRVSTRTGEAAAGPEKDNRRVDFIFVPEGATY* |
| Ga0062387_1016528281 | 3300004091 | Bog Forest Soil | AKKYLGEKGIDASRISTRVGTASTEKGSEKDNRRVDFILVPEGATY* |
| Ga0062389_1039662082 | 3300004092 | Bog Forest Soil | LGEKGIDASRSTTRTGQASTEKGTEKENRRVEFIFVPEGATY* |
| Ga0062388_1024135911 | 3300004635 | Bog Forest Soil | ELAGKYLIEKGIDASRISTRVGEAKKDSEKDNRRVDFIFVPEGATF* |
| Ga0066819_10132502 | 3300005148 | Soil | GEKGIDAARISTRVGEASKEKGQEKANRRVDFVIVPEGATY* |
| Ga0070713_1010310381 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | YIVEKGIDASRISTRTGTASTEKGSEKDNRRVEFVLVPEGATY* |
| Ga0070735_100168501 | 3300005534 | Surface Soil | KGIDASRSTTRTGQASTEKGSEKENRRVEFIFVPEGATY* |
| Ga0066699_106358952 | 3300005561 | Soil | LGEKGIDASRGTTRTGQASTEKGSEKENRRVEFIFVPEGATY* |
| Ga0070761_108076162 | 3300005591 | Soil | YLGEKGIDASRIETRVGTASTEKGSEKDNRRVDFIFVPEGATY* |
| Ga0070762_100927782 | 3300005602 | Soil | EKGIDASRSTTRTGQASTEKGSEKENRRVEFIFVPEGATY* |
| Ga0070764_103602631 | 3300005712 | Soil | GEKGIDASRSTTRTGQASTEKGSEKENRRVEFIFVPEGATY* |
| Ga0080026_101235421 | 3300005952 | Permafrost Soil | IDASRVTTRTGTASKEKGAEKENRRVDFTFVPEGATY* |
| Ga0070765_1020174771 | 3300006176 | Soil | AYLGEKGIDASRSTTRTGQASTEKGSEKENRRVEFIFVPEGATY* |
| Ga0075021_105466231 | 3300006354 | Watersheds | DLAKAFIIEKGIDASRISTRIAKGSADKAAEKDNRRVDFVMVPEGATY* |
| Ga0068871_1010422911 | 3300006358 | Miscanthus Rhizosphere | KKYIVEKGVDASRISTRTGEASKEKGQEKANRRVDFVIVPEGATY* |
| Ga0068871_1016071892 | 3300006358 | Miscanthus Rhizosphere | KGVDESRISTRVGEASAEKGQEKANRRVEFVVVPEGATY* |
| Ga0099794_106014962 | 3300007265 | Vadose Zone Soil | ASRISTRVGTASTEKGSEKTNRRVDFIFVPEGATY* |
| Ga0099830_102868591 | 3300009088 | Vadose Zone Soil | IDASRISTRAGTASTEKGADNRRVDFVIVPEGAAF* |
| Ga0105237_109218152 | 3300009545 | Corn Rhizosphere | AYLGEKGIDASRGTTRVGQASTEKGSEKENRRVEFIFVPEGATY* |
| Ga0105249_111083481 | 3300009553 | Switchgrass Rhizosphere | LAKKYIVEKGVDASRISTRTGEASKEKGQEKANRRVDFVIVPEGATY* |
| Ga0116103_11251232 | 3300009615 | Peatland | GIDASRISTRAGTASTEKGMEKDNRRVDFIFVPEGATY* |
| Ga0116117_11920021 | 3300009635 | Peatland | KGIDASRVSTRTGEAAAGPEKDNRRVDFIFVPEGATY* |
| Ga0116134_10382821 | 3300009764 | Peatland | KKYLGEKGIDASRISTRAGTASTEKGMEKDNRRVDFVFVPEGAAY* |
| Ga0126374_102501721 | 3300009792 | Tropical Forest Soil | IDAARISTRVGEASKEKGQEKANRRVDFVIVPEGATY* |
| Ga0126384_110838741 | 3300010046 | Tropical Forest Soil | KAIDASRISTRTGQATGTGADNRRVDFVIVPEGATY* |
| Ga0126382_123275781 | 3300010047 | Tropical Forest Soil | YIVEKGVDASRISTRTGEASKEKGQEKANRRVDFVVVPEGATY* |
| Ga0074044_102590841 | 3300010343 | Bog Forest Soil | EKGIDASRISTRVGTASTEKGSEKENRRVDFVFVPEGATY* |
| Ga0074044_105784142 | 3300010343 | Bog Forest Soil | ASRISTRAGKASTEKGSENANRRVDFVFVPEGATY* |
| Ga0126376_124373871 | 3300010359 | Tropical Forest Soil | KYIVEKGVDASRISTRVGQASTEKGQEKANRRVDFVIVPEGATY* |
| Ga0126381_1003840151 | 3300010376 | Tropical Forest Soil | KGIDASRISTRTGTASTEKGAEKENRRVEFIFVPEGATY* |
| Ga0126381_1023966611 | 3300010376 | Tropical Forest Soil | AKKYLGEKGIDASRISTRVGSASREKGAAAENRRVDFIFVPEGATY* |
| Ga0126381_1048043112 | 3300010376 | Tropical Forest Soil | IVEKGVDASRISTRVGEASKEKGQEKANRRVDFVVVPEGATY* |
| Ga0137389_108061002 | 3300012096 | Vadose Zone Soil | DASRVSTRAGSASTEKGSEKANRRVDFVIVPEGATF* |
| Ga0137388_104746462 | 3300012189 | Vadose Zone Soil | EKGIDASRVSTRAGSASTEKGSEKANRRVDFVIVPEGATF* |
| Ga0137363_114380911 | 3300012202 | Vadose Zone Soil | KGVDASRISTRAGEASPEKGQEKANRRVDFVIVPEGATY* |
| Ga0137377_112128501 | 3300012211 | Vadose Zone Soil | IVEKGVDASRIATRTGEASKEKDQEKANRRVDFVVVPEGATY* |
| Ga0137387_109424131 | 3300012349 | Vadose Zone Soil | AKKYIVEKGVDASRISTRSGEASTEKGQEKANRRVDFVVVPEGATY* |
| Ga0137360_109911352 | 3300012361 | Vadose Zone Soil | GEKEIDASRISTRVGTASAEKGMEKTNRRVDFIFVPEGANY* |
| Ga0137396_108247382 | 3300012918 | Vadose Zone Soil | AKQFLGEKGIDASRITARTGEASKEKGSEKENRRIEMVFVPEGATY* |
| Ga0137359_106182352 | 3300012923 | Vadose Zone Soil | DASRISTRTGEASKEKGQEKANRRVDFIVVPEGATY* |
| Ga0157375_114651771 | 3300013308 | Miscanthus Rhizosphere | YIVEKGVDASRISTRTGEASKEKGQEKANRRVDFVIVPEGATY* |
| Ga0181537_104827622 | 3300014201 | Bog | YLGEKGIDASRITTRTGQASTGKGTEKENRRVEFIFVPEGATY* |
| Ga0132257_1046344862 | 3300015373 | Arabidopsis Rhizosphere | VDASRISTRTGEASKEKGQEKANRRVDFVIVPEGATY* |
| Ga0182040_111277811 | 3300016387 | Soil | VDASRISTRVGEASTEKGQEKANRHVDFVIVPEGATY |
| Ga0182039_110661231 | 3300016422 | Soil | KYMVEKGIDASRIETRVGTASTEKGSEKENRRVDFVFVPEGATY |
| Ga0187777_100878361 | 3300017974 | Tropical Peatland | KGIDASRISTRVGTASTEKGSEKENRRVDFIFVPEGATY |
| Ga0187816_105767672 | 3300017995 | Freshwater Sediment | ASRISTRVGTASTEKGSEKDNRRVDFIYVPEGASY |
| Ga0187804_100799973 | 3300018006 | Freshwater Sediment | AKKYLGEKGIDASRISTRVGTASTEKGSEKENRRVDFIFVPEGATY |
| Ga0187855_107879421 | 3300018038 | Peatland | AKKYLGEKGIDASRITTRTGTANAMKGMEKDNRRVDFVFVPEGATY |
| Ga0066669_103266181 | 3300018482 | Grasslands Soil | YIVEKGVDASRISTRTGEASKEKGQEKANRRVDFIVVPEGATY |
| Ga0182028_10916471 | 3300019788 | Fen | VPGGEKGIDASRISTRAGTASTEKGMEKDNRRVDFVFVPEGAAY |
| Ga0210407_107757131 | 3300020579 | Soil | LIEKEAKAYLGENGIDASRISTRTGEAATEKGAEKVRRTPQEA |
| Ga0210399_103217422 | 3300020581 | Soil | KYLAEKEIDLSRVSTRVGTASTEKGTEKENRRVDFIFVPEGANY |
| Ga0210399_105286901 | 3300020581 | Soil | EKEIDLSRVSTRVGTASTEKGTEKENRRVDFIFVPEGANY |
| Ga0210406_106562932 | 3300021168 | Soil | KYIVEKGVDASRISTRAGEASTEKGQEKANRRVDFVVVPEGATY |
| Ga0210408_105699602 | 3300021178 | Soil | KKYIVEKGIDASRISTRTGTASTEKGSEKDNRRVEFVLVPEGATY |
| Ga0210393_100105401 | 3300021401 | Soil | KGIDASRISTRTGTASTEKGSEKDNRRVEFVLVPEGATY |
| Ga0210387_103725122 | 3300021405 | Soil | IDASRSTTRTGQASTEKGSEKENRRVEFIFVPEGATY |
| Ga0210394_109972282 | 3300021420 | Soil | ARKFLGEKGIDASRITTRTGTAAKEKGAEKDNRRVEFIFVPEGATY |
| Ga0210384_118307761 | 3300021432 | Soil | LIEKEAKAYLGEKGIDASRISTRTGEASTEKGAEKVNRRVEFVFVP |
| Ga0210392_101900512 | 3300021475 | Soil | YLGEKGIDASRISTRTGEATAGAEKDNRRVDFIFVPEGATY |
| Ga0210392_106535482 | 3300021475 | Soil | LAKKYLGEKGIDASRITTRTGTASTEKGMEKENRRVDFVIVPEGATF |
| Ga0210398_103868542 | 3300021477 | Soil | DLAKAYLGEKGIDASRSTTRTGQASTEKGSEKENRRVEFIFVPEGATY |
| Ga0210402_108153411 | 3300021478 | Soil | ELAKKYLGEKGIDASRISTRVGEASAEKGQEKENRRVDFVLVPEGATY |
| Ga0210409_100122989 | 3300021559 | Soil | VEKGIDASRISTRTGTASTEKGSEKDNRRVEFVLVPEGATY |
| Ga0210409_104506311 | 3300021559 | Soil | KFLGEKGIDASRITTRTGTASKEKGAEKENRRVEFIFVPEGATY |
| Ga0210409_115100681 | 3300021559 | Soil | LSRVSSRVGTASTEKGMEKENRRVEFIFVPEGATY |
| Ga0247695_10110112 | 3300024179 | Soil | LAKKYLGEKGIDAARISTRVGEASKEKGQEKANRRVDFVIVPEGATY |
| Ga0247669_10269081 | 3300024182 | Soil | KGIDAARISTRVGEASTEKGQEKANRRVDFVIVPEGATY |
| Ga0207671_106050802 | 3300025914 | Corn Rhizosphere | AYLGEKGIDASRGTTRVGQASTEKGSEKENRRVEFIFVPEGATY |
| Ga0207663_104921912 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GVDESRISTRVGEASAEKGQEKANRRVEFVVVPEGATY |
| Ga0207712_120508171 | 3300025961 | Switchgrass Rhizosphere | LAKKYIVEKGVDASRISTRTGEASKEKGQEKANRRVDFVIVPEGATY |
| Ga0207764_1158462 | 3300026839 | Tropical Forest Soil | IDASRISTRTGTASTEKGAEKENRRVEFIFVPEGATY |
| Ga0208525_10206681 | 3300027288 | Soil | KGIDAARISTRVGEASKEKGQEKANRRVDFVIVPEGATY |
| Ga0209329_11225021 | 3300027605 | Forest Soil | IDLSRVSTRVGTASTEKGTEKENRRVDFIFVPEGANY |
| Ga0209117_10832002 | 3300027645 | Forest Soil | KGIDASRITTRTGTASKEKGAEKENRRVDFIFVPEGATY |
| Ga0209139_103567982 | 3300027795 | Bog Forest Soil | KKYLIEKGIDASRISTRVGEATKGAEKDNRRVDFIFVPEGATY |
| Ga0209166_105049591 | 3300027857 | Surface Soil | AKKYLGEKGIDAARISTRVGEASKEKGQEKANRRVDFVIVPEGATY |
| Ga0209068_105128772 | 3300027894 | Watersheds | DLAKAFIIEKGIDASRISTRIAKGSADKAAEKDNRRVDFVMVPEGATY |
| Ga0209006_106400481 | 3300027908 | Forest Soil | DASRITTRTGTASKEKGAEKENRRVEFIFVPEGATY |
| Ga0209168_100529292 | 3300027986 | Surface Soil | KGIDASRSTTRTGQASTEKGSEKENRRVEFIFVPEGATY |
| Ga0137415_110396712 | 3300028536 | Vadose Zone Soil | AYLGEKGIDASRSTTRTGQASTEKGAEKENRRVEFIFVPEGATY |
| Ga0302224_101626772 | 3300028759 | Palsa | LGEKGIDASRVSTRTGEAAKGPEKENRRVDFIFVPEGATY |
| Ga0308309_115572951 | 3300028906 | Soil | AYLGEKGIDASRSTTRTGQASTEKGSEKENRRVEFIFVPEGATY |
| Ga0170834_1024664821 | 3300031057 | Forest Soil | EKGVDASRISTRSGEASTEKGQEKANRRVDFVVVPEGATY |
| Ga0318541_107023241 | 3300031545 | Soil | EKGIDASRISTRAGTASTEKGAEKENRRVEFIFVPEGATY |
| Ga0318538_103727371 | 3300031546 | Soil | DLAKKYMVEKGVDASRISTRTGEASTEKGQEKANRRVDFVIVPEGATY |
| Ga0310915_105813982 | 3300031573 | Soil | KKYLVEKGIDASRMSTRTGTASTEKGAEKENRRVEFIFVPEGATY |
| Ga0318560_100626881 | 3300031682 | Soil | YLIEKGIDASRISTRVGTASTEKGQEKANRRVEFIFVPEGATY |
| Ga0318546_106521301 | 3300031771 | Soil | GIDASRISTRTGTASTEKGTEKENRRVEFIFVPEGATY |
| Ga0306919_104242912 | 3300031879 | Soil | GIDASRIETRVGQASTEKGTEKENRRVEFIFVPEGATY |
| Ga0306921_115141391 | 3300031912 | Soil | GVDASRISTRVGEASTEKGQEKANRHVDFVVVPEGATY |
| Ga0306921_123434401 | 3300031912 | Soil | IVEKGVDASRISTRVGEASTEKGQEKANRHVDFVIVPEGATY |
| Ga0310916_108319731 | 3300031942 | Soil | IEKGIDASRISTRTGTASTEKGAEKENRRVEFIFVPEGATY |
| Ga0318545_100205501 | 3300032042 | Soil | EGAKKYLIEKGIDASRISTRTGTASTEKGTEKENRRVEFIFVPEGATY |
| Ga0318577_101082881 | 3300032091 | Soil | IDASRISTRAGTASTEKGAEKENRRVEFIFVPEGATY |
| Ga0307470_101430451 | 3300032174 | Hardwood Forest Soil | KEIDLSRVSTRVGTASTEKGSEKANRRVDFIFVPEGATY |
| Ga0307471_1000731973 | 3300032180 | Hardwood Forest Soil | GEKNIDASRISTRVGQASGAAAENRRVDFVIVPEGATY |
| Ga0307471_1042439831 | 3300032180 | Hardwood Forest Soil | VEKGVDASRISTRTGEASTEKGQEKANRRVDFVVVPEGATY |
| Ga0335085_106877142 | 3300032770 | Soil | GIDAARISTRVGEASKEKGQEKANRRVDFVIVPEGATY |
| Ga0335082_107148512 | 3300032782 | Soil | GEKGIDAARISTRVGEASKEKGQEKANRRVDFVIVPEGATY |
| Ga0335071_119715742 | 3300032897 | Soil | IDASRISTRVGTASTEKGSEKENRRVDFIFVPEGATY |
| Ga0335076_113593492 | 3300032955 | Soil | DGAKKYLGEKGIDASRISTRVGTASTERTAEAQKENRRVEFVFVPEGATY |
| Ga0335077_100904483 | 3300033158 | Soil | VDESRISTRVGEASKEKGEEKANRRVDFVLVPQGATY |
| Ga0310914_106123622 | 3300033289 | Soil | KYLVEKGIDASRISTRAGTASTEKGAEKENRRVEFIFVPEGATY |
| Ga0371488_0131414_1202_1330 | 3300033983 | Peat Soil | LGEKGIDASRISTRVGTASTEKGMEKDNRRVDFVFVPEGATY |
| ⦗Top⦘ |