Metagenome / Metatranscriptome Family F092326

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F092326
Family Type	Metagenome / Metatranscriptome
Number of Sequences	107
Average Sequence Length	41 residues
Representative Sequence	TLYRINAETLRTIHDWSGMFARHWRGQLRRIKAHAEEER
Number of Associated Samples	93
Number of Associated Scaffolds	107

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	1.87 %
% of genes near scaffold ends (potentially truncated)	96.26 %
% of genes from short scaffolds (< 2000 bps)	94.39 %
Associated GOLD sequencing projects	85
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (100.000 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.757 % of family members)
Environment Ontology (ENVO)	Unclassified (34.579 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (52.336 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 47.76% β-sheet: 0.00% Coil/Unstructured: 52.24%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.55
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 107 Family Scaffolds
PF08327	AHSA1	16.82
PF12867	DinB_2	12.15
PF05163	DinB	7.48
PF07519	Tannase	1.87
PF13620	CarboxypepD_reg	0.93
PF00270	DEAD	0.93
PF09861	Lar_N	0.93
PF13371	TPR_9	0.93
PF01230	HIT	0.93
PF09948	DUF2182	0.93
PF04214	DUF411	0.93
PF07681	DoxX	0.93
PF12840	HTH_20	0.93

COG ID	Name	Functional Category	% Frequency in 107 Family Scaffolds
COG2318	Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)	Secondary metabolites biosynthesis, transport and catabolism [Q]	7.48
COG2259	Uncharacterized membrane protein YphA, DoxX/SURF4 family	Function unknown [S]	0.93
COG3019	Uncharacterized metal-binding protein, DUF411 family	Function unknown [S]	0.93
COG4270	Uncharacterized membrane protein	Function unknown [S]	0.93

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	100.00 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	100.00 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	100.00 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	30.84 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	27.10 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.93 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	30.84 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	3.74 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.93 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes	class	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes	30.84 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	3.74 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.93 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadales	order	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales	30.84 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3.74 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.93 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	30.84 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3.74 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.93 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
unclassified Gemmatimonadaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae	30.84 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3.74 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.93 %
Unclassified	root	N/A	0.00 %

Name	Rank	Taxonomy	Distribution
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	30.84 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	3.74 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.93 %
Unclassified	root	N/A	0.00 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459020\|G1P06HT01ER50C	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	609	Open in IMG/M
3300000955\|JGI1027J12803_108712169	All Organisms → cellular organisms → Bacteria	695	Open in IMG/M
3300000956\|JGI10216J12902_108465828	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	605	Open in IMG/M
3300000956\|JGI10216J12902_109879098	All Organisms → cellular organisms → Bacteria	1122	Open in IMG/M
3300001977\|JGI24746J21847_1021023	All Organisms → cellular organisms → Bacteria	913	Open in IMG/M
3300004156\|Ga0062589_102898001	All Organisms → cellular organisms → Bacteria	501	Open in IMG/M
3300004798\|Ga0058859_11797373	All Organisms → cellular organisms → Bacteria	635	Open in IMG/M
3300005093\|Ga0062594_101331462	All Organisms → cellular organisms → Bacteria	723	Open in IMG/M
3300005172\|Ga0066683_10368257	All Organisms → cellular organisms → Bacteria	891	Open in IMG/M
3300005329\|Ga0070683_100374712	All Organisms → cellular organisms → Bacteria	1356	Open in IMG/M
3300005340\|Ga0070689_100636083	All Organisms → cellular organisms → Bacteria	927	Open in IMG/M
3300005340\|Ga0070689_101588578	All Organisms → cellular organisms → Bacteria	594	Open in IMG/M
3300005354\|Ga0070675_101223834	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	691	Open in IMG/M
3300005356\|Ga0070674_100500842	All Organisms → cellular organisms → Bacteria	1011	Open in IMG/M
3300005543\|Ga0070672_101706087	All Organisms → cellular organisms → Bacteria	566	Open in IMG/M
3300005544\|Ga0070686_101441068	All Organisms → cellular organisms → Bacteria	579	Open in IMG/M
3300005578\|Ga0068854_101750812	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300005598\|Ga0066706_10510742	All Organisms → cellular organisms → Bacteria	957	Open in IMG/M
3300005713\|Ga0066905_100024825	All Organisms → cellular organisms → Bacteria	3278	Open in IMG/M
3300005713\|Ga0066905_100584448	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	943	Open in IMG/M
3300005718\|Ga0068866_10675852	All Organisms → cellular organisms → Bacteria	706	Open in IMG/M
3300005840\|Ga0068870_10896203	All Organisms → cellular organisms → Bacteria	626	Open in IMG/M
3300005843\|Ga0068860_101949351	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	609	Open in IMG/M
3300005844\|Ga0068862_100058787	All Organisms → cellular organisms → Bacteria	3299	Open in IMG/M
3300006196\|Ga0075422_10124715	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1009	Open in IMG/M
3300006852\|Ga0075433_10285041	All Organisms → cellular organisms → Bacteria	1463	Open in IMG/M
3300006903\|Ga0075426_10769166	All Organisms → cellular organisms → Bacteria	724	Open in IMG/M
3300007004\|Ga0079218_12854518	All Organisms → cellular organisms → Bacteria	580	Open in IMG/M
3300009012\|Ga0066710_102641281	All Organisms → cellular organisms → Bacteria → Acidobacteria	720	Open in IMG/M
3300009094\|Ga0111539_10501753	All Organisms → cellular organisms → Bacteria	1413	Open in IMG/M
3300009098\|Ga0105245_10845658	All Organisms → cellular organisms → Bacteria	955	Open in IMG/M
3300009176\|Ga0105242_11573752	All Organisms → cellular organisms → Bacteria	690	Open in IMG/M
3300009553\|Ga0105249_10520561	All Organisms → cellular organisms → Bacteria	1237	Open in IMG/M
3300009806\|Ga0105081_1016227	All Organisms → cellular organisms → Bacteria	877	Open in IMG/M
3300010036\|Ga0126305_10977454	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	580	Open in IMG/M
3300010042\|Ga0126314_10061607	All Organisms → cellular organisms → Bacteria	2468	Open in IMG/M
3300010166\|Ga0126306_11029865	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	672	Open in IMG/M
3300010360\|Ga0126372_11852355	All Organisms → cellular organisms → Bacteria	647	Open in IMG/M
3300011119\|Ga0105246_11002329	All Organisms → cellular organisms → Bacteria	756	Open in IMG/M
3300011445\|Ga0137427_10129025	All Organisms → cellular organisms → Bacteria	1032	Open in IMG/M
3300012212\|Ga0150985_104179943	All Organisms → cellular organisms → Bacteria	1360	Open in IMG/M
3300012212\|Ga0150985_109090386	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	558	Open in IMG/M
3300012212\|Ga0150985_114690490	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	867	Open in IMG/M
3300012363\|Ga0137390_10526903	All Organisms → cellular organisms → Bacteria → Acidobacteria	1153	Open in IMG/M
3300012469\|Ga0150984_101522969	All Organisms → cellular organisms → Bacteria → Acidobacteria	1034	Open in IMG/M
3300012532\|Ga0137373_10773289	All Organisms → cellular organisms → Bacteria	711	Open in IMG/M
3300012906\|Ga0157295_10407790	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	509	Open in IMG/M
3300012907\|Ga0157283_10181702	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	647	Open in IMG/M
3300012948\|Ga0126375_10848374	All Organisms → cellular organisms → Bacteria	728	Open in IMG/M
3300012958\|Ga0164299_10937140	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	632	Open in IMG/M
3300012988\|Ga0164306_11885842	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	520	Open in IMG/M
3300013297\|Ga0157378_10739481	All Organisms → cellular organisms → Bacteria → Acidobacteria	1006	Open in IMG/M
3300014157\|Ga0134078_10599578	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	527	Open in IMG/M
3300014326\|Ga0157380_10880715	All Organisms → cellular organisms → Bacteria → Acidobacteria	920	Open in IMG/M
3300014326\|Ga0157380_11359921	All Organisms → cellular organisms → Bacteria → Acidobacteria	759	Open in IMG/M
3300015077\|Ga0173483_10013331	All Organisms → cellular organisms → Bacteria → Acidobacteria	2833	Open in IMG/M
3300015371\|Ga0132258_10172330	All Organisms → cellular organisms → Bacteria → Acidobacteria	5218	Open in IMG/M
3300015371\|Ga0132258_11442670	All Organisms → cellular organisms → Bacteria → Acidobacteria	1738	Open in IMG/M
3300015372\|Ga0132256_101836598	All Organisms → cellular organisms → Bacteria	714	Open in IMG/M
3300015374\|Ga0132255_103833684	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	639	Open in IMG/M
3300015374\|Ga0132255_104885358	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	568	Open in IMG/M
3300015374\|Ga0132255_105348023	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	543	Open in IMG/M
3300018056\|Ga0184623_10380568	All Organisms → cellular organisms → Bacteria	626	Open in IMG/M
3300018432\|Ga0190275_11972625	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	662	Open in IMG/M
3300018465\|Ga0190269_10256657	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	989	Open in IMG/M
3300018466\|Ga0190268_11938431	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	538	Open in IMG/M
3300018466\|Ga0190268_12217322	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	514	Open in IMG/M
3300018920\|Ga0190273_12185214	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	519	Open in IMG/M
3300021412\|Ga0193736_1056518	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	542	Open in IMG/M
3300023275\|Ga0247776_10362595	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	534	Open in IMG/M
3300025899\|Ga0207642_10417286	All Organisms → cellular organisms → Bacteria	806	Open in IMG/M
3300025922\|Ga0207646_11398402	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	609	Open in IMG/M
3300025927\|Ga0207687_10816250	All Organisms → cellular organisms → Bacteria → Acidobacteria	796	Open in IMG/M
3300025932\|Ga0207690_11082505	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	668	Open in IMG/M
3300025945\|Ga0207679_10485991	All Organisms → cellular organisms → Bacteria → Acidobacteria	1100	Open in IMG/M
3300025961\|Ga0207712_10309518	All Organisms → cellular organisms → Bacteria → Acidobacteria	1299	Open in IMG/M
3300025981\|Ga0207640_11570356	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	592	Open in IMG/M
3300025986\|Ga0207658_11090933	All Organisms → cellular organisms → Bacteria → Acidobacteria	729	Open in IMG/M
3300026023\|Ga0207677_10833095	All Organisms → cellular organisms → Bacteria → Acidobacteria	828	Open in IMG/M
3300026023\|Ga0207677_11872384	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	557	Open in IMG/M
3300027907\|Ga0207428_10572743	All Organisms → cellular organisms → Bacteria → Acidobacteria	815	Open in IMG/M
3300027907\|Ga0207428_10923228	All Organisms → cellular organisms → Bacteria	616	Open in IMG/M
3300028380\|Ga0268265_11203509	All Organisms → cellular organisms → Bacteria	755	Open in IMG/M
3300028381\|Ga0268264_10902681	All Organisms → cellular organisms → Bacteria	887	Open in IMG/M
3300028708\|Ga0307295_10156219	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	635	Open in IMG/M
3300028754\|Ga0307297_10077897	All Organisms → cellular organisms → Bacteria → Acidobacteria	1063	Open in IMG/M
3300028811\|Ga0307292_10325631	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	646	Open in IMG/M
3300030620\|Ga0302046_10530564	All Organisms → cellular organisms → Bacteria → Acidobacteria	962	Open in IMG/M
3300031114\|Ga0308187_10195653	All Organisms → cellular organisms → Bacteria → Acidobacteria	704	Open in IMG/M
3300031548\|Ga0307408_101830726	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	581	Open in IMG/M
3300031562\|Ga0310886_10306552	All Organisms → cellular organisms → Bacteria → Acidobacteria	909	Open in IMG/M
3300031562\|Ga0310886_10384652	All Organisms → cellular organisms → Bacteria → Acidobacteria	824	Open in IMG/M
3300031892\|Ga0310893_10073336	All Organisms → cellular organisms → Bacteria → Acidobacteria	1198	Open in IMG/M
3300031901\|Ga0307406_12034449	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	514	Open in IMG/M
3300031908\|Ga0310900_10930844	All Organisms → cellular organisms → Bacteria	711	Open in IMG/M
3300031908\|Ga0310900_11545246	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	560	Open in IMG/M
3300031944\|Ga0310884_10198252	All Organisms → cellular organisms → Bacteria → Acidobacteria	1070	Open in IMG/M
3300032012\|Ga0310902_10869996	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	618	Open in IMG/M
3300032017\|Ga0310899_10700316	All Organisms → cellular organisms → Bacteria	514	Open in IMG/M
3300032075\|Ga0310890_10795684	All Organisms → cellular organisms → Bacteria	748	Open in IMG/M
3300032144\|Ga0315910_10068507	All Organisms → cellular organisms → Bacteria → Acidobacteria	2584	Open in IMG/M
3300032174\|Ga0307470_11154499	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	626	Open in IMG/M
3300033412\|Ga0310810_10671551	All Organisms → cellular organisms → Bacteria	972	Open in IMG/M
3300033475\|Ga0310811_10484227	All Organisms → cellular organisms → Bacteria → Acidobacteria	1305	Open in IMG/M
3300034147\|Ga0364925_0113546	All Organisms → cellular organisms → Bacteria → Acidobacteria	968	Open in IMG/M
3300034149\|Ga0364929_0231585	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	618	Open in IMG/M
3300034668\|Ga0314793_122379	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	564	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	56.07%
Host-Associated	Host-Associated	42.99%
Engineered	Engineered	0.93%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	54.21%
Plants	Host-Associated → Plants	42.06%
Aquatic	Environmental → Aquatic	1.87%
Human	Host-Associated → Human	0.93%
Solid Waste	Engineered → Solid Waste	0.93%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	51.40%
Rhizosphere	Host-Associated → Plants → Rhizosphere	23.36%
Rhizoplane	Host-Associated → Plants → Rhizoplane	18.69%
Sediment	Environmental → Aquatic → Sediment	1.87%
Floodplain	Environmental → Terrestrial → Floodplain	1.87%
Plant Litter	Environmental → Terrestrial → Plant Litter	0.93%
Digestive System	Host-Associated → Human → Digestive System	0.93%
Grass	Engineered → Solid Waste → Grass	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	43.93%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	15.89%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	11.21%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	7.48%
Soil	Host-Associated → Plants → Rhizosphere → Soil	7.48%
Loam	Environmental → Terrestrial → Soil → Loam	6.54%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.87%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	1.87%
Sand	Environmental → Terrestrial → Soil → Sand	0.93%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	0.93%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	0.93%
Composting	Engineered → Solid Waste → Grass → Composting	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	25.23%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	15.89%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	11.21%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	9.35%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	7.48%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	7.48%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.61%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.67%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.80%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.87%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.87%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	1.87%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.93%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.93%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	0.93%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	0.93%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.93%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	17.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	9.35%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.67%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	4.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	4.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.74%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.74%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	2.80%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	2.80%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	2.80%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.80%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.87%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.87%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.87%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.87%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	1.87%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.87%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.87%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.87%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.87%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.87%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.93%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.93%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.93%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.93%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.93%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.93%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.93%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.93%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.93%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	0.93%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	0.93%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.93%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.93%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.93%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.93%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459020	Litter degradation NP2	Engineered	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Host-Associated	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004798	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005172	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132	Environmental	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006196	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009806	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60	Environmental	Open in IMG/M
3300010036	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26	Environmental	Open in IMG/M
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental	Open in IMG/M
3300010166	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300011445	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012532	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG	Environmental	Open in IMG/M
3300012906	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1	Environmental	Open in IMG/M
3300012907	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014157	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300015077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300018056	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018465	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental	Open in IMG/M
3300021412	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1	Environmental	Open in IMG/M
3300023275	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028708	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152	Environmental	Open in IMG/M
3300028754	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157	Environmental	Open in IMG/M
3300028811	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149	Environmental	Open in IMG/M
3300030620	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111	Environmental	Open in IMG/M
3300031114	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031892	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2	Environmental	Open in IMG/M
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300032012	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3	Environmental	Open in IMG/M
3300032017	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033475	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC	Environmental	Open in IMG/M
3300034147	Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17	Environmental	Open in IMG/M
3300034149	Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17	Environmental	Open in IMG/M
3300034668	Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
2NP_02990900	2170459020	Switchgrass, Maize And Mischanthus Litter	RRDGRRTLHRTNAETLRTIHEWSRIFAQHWRGQLRRIKSHAEEER
JGI1027J12803_1087121693	3300000955	Soil	VRRDGRRTLARINPETLRTIHDWIALFERHWRGQLRRIKAHAEEDR*
JGI10216J12902_1084658281	3300000956	Soil	MNPETLRTIHDWSGMFAQYWRGQLRRIKAHAEEKR*
JGI10216J12902_1098790983	3300000956	Soil	RREGRRTMYRINPETLRSIHEWSGMFAQYWRGQLRRVKAHAEEKQ*
JGI24746J21847_10210233	3300001977	Corn, Switchgrass And Miscanthus Rhizosphere	TNAETLRTIHDWSGMFAQHWRGQLRRVKAHAEGKR*
Ga0062589_1028980012	3300004156	Soil	VRRDGRRTMYRINGETLRTIHDWSGMFAQYWSGQLRRIKAHAEGER*
Ga0058859_117973732	3300004798	Host-Associated	RRTLYRTNSETLKTIHDWSGMFAQHWRGQLRRIKAHAEEKQ*
Ga0062594_1013314621	3300005093	Soil	RRTMYRINADTLRTVHDWSGMFARYWRGQLRRIKAHAEEER*
Ga0066683_103682571	3300005172	Soil	LVYVRREGRRTMYRINAETLRTIHDWSGMFARYWRGQLRRIKAHAEEER*
Ga0070683_1003747123	3300005329	Corn Rhizosphere	VRARRDGRRTLYRANADTLRAIHDWSRQFARHWRSQLQRIKEHAEEA*
Ga0070689_1006360833	3300005340	Switchgrass Rhizosphere	RRDGRRILYRANARTLKTIHDWSGMFAQHWRGQLRRIKAHAEEKR*
Ga0070689_1015885781	3300005340	Switchgrass Rhizosphere	MRREGRRTMYRINGETLRTIHDWSSMFARHWRAQLRRIKAQAEEE*
Ga0070675_1012238342	3300005354	Miscanthus Rhizosphere	VGLVSARREGKRTMYRTNPEPLQGVHEWCGMFARYWRGQLRRIKRHAEGKS*
Ga0070674_1005008421	3300005356	Miscanthus Rhizosphere	RTLYRTNSETLRTIHDWSGMFAQHWRGQLRRIKAHAEENK*
Ga0070672_1017060871	3300005543	Miscanthus Rhizosphere	RTNAETLRTIHDWSGMFAQYWRAQLRRIKNHAEEKP*
Ga0070686_1014410681	3300005544	Switchgrass Rhizosphere	RTLYRINAEGLRTIHDWSGMFSRHWRGQLRRIKAHAEEER*
Ga0068854_1017508122	3300005578	Corn Rhizosphere	RTLYRVNGETLRTIHDWSGMFARHWRGQLRRIKAHAEEER*
Ga0066706_105107421	3300005598	Soil	RRTMYRINAETLRTIHDWSGMFARYWRGQLRRIKAHAEEER*
Ga0066905_1000248255	3300005713	Tropical Forest Soil	NAQTLKTIHDWSGMFAQHWRGQLGRIKAHAEEKR*
Ga0066905_1005844481	3300005713	Tropical Forest Soil	NPAPLRTVHDWSGMFAQYWRGQLRRIKAHAEGKR*
Ga0068866_106758521	3300005718	Miscanthus Rhizosphere	NAETLRTIHEWSRMFAQHWRGQLRRIKAHAEEER*
Ga0068870_108962032	3300005840	Miscanthus Rhizosphere	LYRTNPHPLRSIHEWSGLFARHWRGQLQRIKAHAEEDR*
Ga0068860_1019493512	3300005843	Switchgrass Rhizosphere	RTNAEVLRTIHDWSRMFARHWRGQLRRIKAHAEEE*
Ga0068862_1000587871	3300005844	Switchgrass Rhizosphere	TMYRTNAETLRTIHEWSRMFAQHWRGQLRRIKAHAEEER*
Ga0075422_101247153	3300006196	Populus Rhizosphere	RTNAEALRTIHDWAQMFAQYWRGQLRRIKAHAEEKR*
Ga0075433_102850414	3300006852	Populus Rhizosphere	TNAETLRTIHDWSGMFAQYWRAQLRRIKNHAEEKR*
Ga0075426_107691661	3300006903	Populus Rhizosphere	GRNTWYRTNAEVLRTIHDWSRMFAQHWRGQLRRIKAHAEEER*
Ga0079218_128545182	3300007004	Agricultural Soil	RPRRDGKRVLYRADAHSLKTIHDWTGMFQRHWSGQLNRIKQHAERKEE*
Ga0066710_1026412811	3300009012	Grasslands Soil	DLVTVRRDGRRILYRANAQALKTIHDWSGMFAQHWRGQLRRIKAHAEEKR
Ga0111539_105017531	3300009094	Populus Rhizosphere	MYRTNPEGLRGVHEWTGMFARYWRGQLRRIKAHAEGKR*
Ga0105245_108456583	3300009098	Miscanthus Rhizosphere	NAETLRTIHEWSRMFAQHWRGQLRRIKSHAEEER*
Ga0105242_115737521	3300009176	Miscanthus Rhizosphere	NPHPLRSIHEWSGLFARHWRGQLQRIKAHAEEDR*
Ga0105249_105205614	3300009553	Switchgrass Rhizosphere	VNPEPLRTIHDWVALFERHWRGQLRRIKAHAEEDR*
Ga0105081_10162271	3300009806	Groundwater Sand	VRRDGRRTMYRINADTLRTIHDWSGMFARYWRGQLRRIKAHAEEER*
Ga0126305_109774542	3300010036	Serpentine Soil	SNPEALRTVHDWCRMFTQHWRGQLRRIKAHAEEDR*
Ga0126314_100616071	3300010042	Serpentine Soil	TLYRINAETLRTIHDWSGMFARHWRGQLRRIKAHAEEER*
Ga0126306_110298651	3300010166	Serpentine Soil	GRQTLYRSNPEALRTVHDWCRMFTQHWRGQLRRIKAHAEEVR*
Ga0126372_118523552	3300010360	Tropical Forest Soil	IRREGRKAMVRINPETLRTIHDWVALFERHWRGQLRRIKAHAELDR*
Ga0105246_110023293	3300011119	Miscanthus Rhizosphere	VGLVDARRDGRNTLYRTNPHPLRSIHEWSGLFARHWRGQLQRIKAHAEEDR*
Ga0137427_101290253	3300011445	Soil	LVRVRREGRRTMYRINAETLRTIHDWSGMFARYWRGQLRRIKAHAEEER*
Ga0150985_1041799431	3300012212	Avena Fatua Rhizosphere	VRRDGRRTLYRVNGETLRTIHDWSSMFARHWRGQLRRIKAHAEEER*
Ga0150985_1090903861	3300012212	Avena Fatua Rhizosphere	NGEALRTIHDWSRMFAQHWRGQLRRIKAHAEEER*
Ga0150985_1146904903	3300012212	Avena Fatua Rhizosphere	DARRDGRNTLYRTNPHPLRSIHEWSGLFARHWRGQLQRIKSHAEEDR*
Ga0137390_105269033	3300012363	Vadose Zone Soil	RREGRRTMYRINAETLRTIYDWSGMFARYWRGQLRRIKAHAEEER*
Ga0150984_1015229692	3300012469	Avena Fatua Rhizosphere	MYRTNAETIRTIHEWSQMFAQHWRGQLRRIKAHAEEER*
Ga0137373_107732893	3300012532	Vadose Zone Soil	RRTMYRINPATLRTIHDWSGMFTRHWRGQLRRIKARAEEER*
Ga0157295_104077902	3300012906	Soil	RTNAETLRTIHDWCGMFARHWRGQLRRIKAHAEEKR*
Ga0157283_101817022	3300012907	Soil	LLNVDLVTVRRDGRRTLYRTNSETLRTIHDWSGMFAQHWRGQLRRIKAHAEGNK*
Ga0126375_108483741	3300012948	Tropical Forest Soil	RANAQTLKTIHDWSSMFAQHWRGQLGRIKAHAEEKR*
Ga0164299_109371402	3300012958	Soil	TNAETLRTIHDWSGMFAQHWRGQLKRIKAHAEGKR*
Ga0164306_118858422	3300012988	Soil	NAETLRTIHDWSGMFAQHWRNQLRRIKAHAEEER*
Ga0157378_107394811	3300013297	Miscanthus Rhizosphere	LVTVRRDGRRTLCRTNAETLRTFHDWCGMFAQHWRGQLRRIKAHAEEKR*
Ga0134078_105995782	3300014157	Grasslands Soil	LVTVRREGRRTMVSIKPETLRTIHDWIALFERHWRGQLRRIKAHAEEDR*
Ga0157380_108807151	3300014326	Switchgrass Rhizosphere	GRRTMYRINPETLRTIHDWSGMFARHCRGQLRRIKAHAEEER*
Ga0157380_113599213	3300014326	Switchgrass Rhizosphere	VVMVSVRREGRWTRYRVKHETLRTIHDWSGMFARHWRGQLRRIKAHAEEER*
Ga0173483_100133311	3300015077	Soil	RDGRRTLYRTNSETLKTIHDWSGMFAQHWRGQLRRIKAHAEEKQ*
Ga0132258_101723301	3300015371	Arabidopsis Rhizosphere	GRKTMVRINPETLRTIHDWVALFERHWRGQLRRIKAHAEEDR*
Ga0132258_114426701	3300015371	Arabidopsis Rhizosphere	TNSETLRTIHDWSGMFAQHWRGQLRRIKAHAEGNK*
Ga0132256_1018365981	3300015372	Arabidopsis Rhizosphere	RRDGRRVLYRTNPEALRTIHEWCGMFARHWGGQLRRIKAHAEEKR*
Ga0132255_1038336841	3300015374	Arabidopsis Rhizosphere	TNAHTLRTIHDWSRMFEQYWRGQLQRIKSHAGGKR*
Ga0132255_1048853581	3300015374	Arabidopsis Rhizosphere	GRQILYRANAHTLKTIHDWAGMFAGHWRGQLARIKKHAEVKK*
Ga0132255_1053480231	3300015374	Arabidopsis Rhizosphere	TNADRLRTIHDWCGMFAQHWRGQLRRIKTHAEEKR*
Ga0184623_103805681	3300018056	Groundwater Sediment	DVGLVTVRREGRRTMVSINPATLRTIHDWIALFERHWRGQLRRIKAHAEANR
Ga0190275_119726251	3300018432	Soil	RAMSRINVDTLRTVHDWSGMFARYWRGQLRRIKAHAEEER
Ga0190269_102566572	3300018465	Soil	VGLVGARREGRSTLYRTNPTPLRTVHEWSGLFARHWRGQLQRIKAHAEEDR
Ga0190268_119384311	3300018466	Soil	TLVRINPDTLRTIHDWIALFERHWRAQLRRIKAHAEEDR
Ga0190268_122173221	3300018466	Soil	IYRINGETLRTIHDWSGMFARHWRGQLRRIKAHAEEDR
Ga0190273_121852142	3300018920	Soil	VGLVSARREGQRTMYRTNPETLRTIHDWSGIFAQHWRGQLRRIKAHAEEKP
Ga0193736_10565182	3300021412	Soil	MYRTNADTLRTVHDWSGMFAQYWRSQLRRIKAHAEAKK
Ga0247776_103625951	3300023275	Plant Litter	DGRRTMYRTNAQALRAVHEWSSMFEQYWRGQLRRIKAHAEGKS
Ga0207642_104172863	3300025899	Miscanthus Rhizosphere	LNVDLVTVRRDGRRTLYRTNSETLRTIHDWSGMFAQHWRGQLRRIKAHAEGKR
Ga0207646_113984022	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	VLYRTNAGQLRTIHDWCAMFEQHWRGQLRRIKAHAEEKR
Ga0207687_108162501	3300025927	Miscanthus Rhizosphere	TNAEVLRTIHDWSRMFAQHWRGQLRRIKAHAEEER
Ga0207690_110825052	3300025932	Corn Rhizosphere	MYRTNAEVLRTIHDWSRMFARHWRGQLRRIKAHAEEE
Ga0207679_104859911	3300025945	Corn Rhizosphere	SLYRTNADRLRTIHDWCGMFAQHWRGQLRRIKAHAEEKR
Ga0207712_103095181	3300025961	Switchgrass Rhizosphere	MVRVNPEPFRTIHDWVALFERHWRGQLRRIKAHAEEDR
Ga0207640_115703562	3300025981	Corn Rhizosphere	VTVRRDGRRTLYRVNGETLRTIHDWSGMFARHWRGQLRRIKAHAEEER
Ga0207658_110909333	3300025986	Switchgrass Rhizosphere	TNAETLRTIHDWSGMFAQHWRGQLKRIKAHAEGKR
Ga0207677_108330953	3300026023	Miscanthus Rhizosphere	TVRRDGRRTLYRTNSATLRTIHDWSGMFAQHWRGQLRRIKTHAEENK
Ga0207677_118723841	3300026023	Miscanthus Rhizosphere	RRDGQRTMYRTNAQTLRTIHDWAGMFAQHWRGQLRRIKAHAEEER
Ga0207428_105727431	3300027907	Populus Rhizosphere	LYRTNSETLRTIHDWSGMFAQHWRGQLRRIKAHAEGNK
Ga0207428_109232282	3300027907	Populus Rhizosphere	RRDGRRTMVSINPDTLRTIHDWVALFERHWRSQLRRIKAHAEQDR
Ga0268265_112035091	3300028380	Switchgrass Rhizosphere	TNAETLRTIHDWSGMFAQHWRGQLRRIKAHAEGKR
Ga0268264_109026811	3300028381	Switchgrass Rhizosphere	WYRTNAEVLRTIHDWSRMFAQHWRGQLRRIKAHAEEER
Ga0307295_101562192	3300028708	Soil	MYRINPETLRTIHDWSGMFARHWRGQLRRIKAHAEEER
Ga0307297_100778973	3300028754	Soil	INPDTLRTIHDWIALFERHWRGQLRRIKAHAEEER
Ga0307292_103256312	3300028811	Soil	DGRRTMYRINPETLRTIHDWSGMFARHWRGQLRRIKAHAEEER
Ga0302046_105305643	3300030620	Soil	RRTLYRTNADTLRTIHDWCGMFARHWRGQLGRIKAHAEERR
Ga0308187_101956531	3300031114	Soil	MYRINAETLRTIHEWSGMFARHWRGQLRRIKAHAEEER
Ga0307408_1018307262	3300031548	Rhizosphere	RNTLYRTNPYPLRTIHEWSGLFARHWRAQLQRIKVHAEENR
Ga0310886_103065521	3300031562	Soil	DGRRTLYRINAETLRTIHDWSGMFARHWRGQLRRIKAHAEEER
Ga0310886_103846521	3300031562	Soil	RREGRQTMCRINAETLRTVHDWCGMFAQHWRGQLRRIKAHAEENR
Ga0310893_100733363	3300031892	Soil	RTLYRTNSETLRTIHDWSGMFAQHWRGQLRRIKAHAEGNK
Ga0307406_120344492	3300031901	Rhizosphere	LYRTNPYPLRTIHEWSGLFARHWRAQLQRIKVHAEEDR
Ga0310900_109308441	3300031908	Soil	RINAQTLRTIHDWSGMFERYWRGQLHRIKAHAEEKR
Ga0310900_115452461	3300031908	Soil	TNAETLRTIHDWCGMFARHWRGQLRRIKAHAEEKR
Ga0310884_101982521	3300031944	Soil	TNADTLRTVHDWCRMFAQHWGGQLRRIKAHAEGKR
Ga0310902_108699961	3300032012	Soil	GRRTMYRINGETLRTIHDWSSMFARHWRTQLRRIKAQAEEE
Ga0310899_107003162	3300032017	Soil	KHLQVLLNVDLVTVRRDGRRTLYRTNSETLRTIHDWSGMFAQHWRGQLRRIKAHAEGNK
Ga0310890_107956843	3300032075	Soil	NMRREGRQTMCRINAETLRTVHDWCGMFAQHWRGQLRRIKAHAEEKSR
Ga0315910_100685074	3300032144	Soil	RTLYRTNSETLRTIHDWSGMFAQHWRGQLRRIKAHAEGHK
Ga0307470_111544992	3300032174	Hardwood Forest Soil	MFYRTNAETLRTIHDWSGMFAQHWRGQLRRIKAHAEGKR
Ga0310810_106715511	3300033412	Soil	RRDGRRTMVSINPDTLRTIHDWIALFERHWRGQLRRIKARAEEDR
Ga0310811_104842271	3300033475	Soil	RANAQTLKTIHDWSGMFAQHWRGQLRRIKAHAEEKR
Ga0364925_0113546_847_966	3300034147	Sediment	TLYRTNSETLRTIHDWSGMFAQHWRGQLRRIKAHAEENK
Ga0364929_0231585_3_122	3300034149	Sediment	TLYRTNSETLRTIHDWSGMFAQHWRGQLRRIKAHAEEKR
Ga0314793_122379_456_563	3300034668	Soil	TNAETLRTIHDWCGLFARHWHGQLRRIKAHAEEKR

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F092326

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences