| Basic Information | |
|---|---|
| Family ID | F092326 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 41 residues |
| Representative Sequence | TLYRINAETLRTIHDWSGMFARHWRGQLRRIKAHAEEER |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.87 % |
| % of genes near scaffold ends (potentially truncated) | 96.26 % |
| % of genes from short scaffolds (< 2000 bps) | 94.39 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.757 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.579 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.336 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.76% β-sheet: 0.00% Coil/Unstructured: 52.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF08327 | AHSA1 | 16.82 |
| PF12867 | DinB_2 | 12.15 |
| PF05163 | DinB | 7.48 |
| PF07519 | Tannase | 1.87 |
| PF13620 | CarboxypepD_reg | 0.93 |
| PF00270 | DEAD | 0.93 |
| PF09861 | Lar_N | 0.93 |
| PF13371 | TPR_9 | 0.93 |
| PF01230 | HIT | 0.93 |
| PF09948 | DUF2182 | 0.93 |
| PF04214 | DUF411 | 0.93 |
| PF07681 | DoxX | 0.93 |
| PF12840 | HTH_20 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 7.48 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.93 |
| COG3019 | Uncharacterized metal-binding protein, DUF411 family | Function unknown [S] | 0.93 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459020|G1P06HT01ER50C | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 609 | Open in IMG/M |
| 3300000955|JGI1027J12803_108712169 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300000956|JGI10216J12902_108465828 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 605 | Open in IMG/M |
| 3300000956|JGI10216J12902_109879098 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300001977|JGI24746J21847_1021023 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300004156|Ga0062589_102898001 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300004798|Ga0058859_11797373 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005093|Ga0062594_101331462 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300005172|Ga0066683_10368257 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300005329|Ga0070683_100374712 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300005340|Ga0070689_100636083 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300005340|Ga0070689_101588578 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300005354|Ga0070675_101223834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 691 | Open in IMG/M |
| 3300005356|Ga0070674_100500842 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300005543|Ga0070672_101706087 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005544|Ga0070686_101441068 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005578|Ga0068854_101750812 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005598|Ga0066706_10510742 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300005713|Ga0066905_100024825 | All Organisms → cellular organisms → Bacteria | 3278 | Open in IMG/M |
| 3300005713|Ga0066905_100584448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 943 | Open in IMG/M |
| 3300005718|Ga0068866_10675852 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300005840|Ga0068870_10896203 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300005843|Ga0068860_101949351 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 609 | Open in IMG/M |
| 3300005844|Ga0068862_100058787 | All Organisms → cellular organisms → Bacteria | 3299 | Open in IMG/M |
| 3300006196|Ga0075422_10124715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1009 | Open in IMG/M |
| 3300006852|Ga0075433_10285041 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300006903|Ga0075426_10769166 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300007004|Ga0079218_12854518 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300009012|Ga0066710_102641281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300009094|Ga0111539_10501753 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300009098|Ga0105245_10845658 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300009176|Ga0105242_11573752 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300009553|Ga0105249_10520561 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300009806|Ga0105081_1016227 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300010036|Ga0126305_10977454 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 580 | Open in IMG/M |
| 3300010042|Ga0126314_10061607 | All Organisms → cellular organisms → Bacteria | 2468 | Open in IMG/M |
| 3300010166|Ga0126306_11029865 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 672 | Open in IMG/M |
| 3300010360|Ga0126372_11852355 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300011119|Ga0105246_11002329 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300011445|Ga0137427_10129025 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300012212|Ga0150985_104179943 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300012212|Ga0150985_109090386 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 558 | Open in IMG/M |
| 3300012212|Ga0150985_114690490 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 867 | Open in IMG/M |
| 3300012363|Ga0137390_10526903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1153 | Open in IMG/M |
| 3300012469|Ga0150984_101522969 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1034 | Open in IMG/M |
| 3300012532|Ga0137373_10773289 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300012906|Ga0157295_10407790 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 509 | Open in IMG/M |
| 3300012907|Ga0157283_10181702 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 647 | Open in IMG/M |
| 3300012948|Ga0126375_10848374 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300012958|Ga0164299_10937140 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 632 | Open in IMG/M |
| 3300012988|Ga0164306_11885842 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 520 | Open in IMG/M |
| 3300013297|Ga0157378_10739481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
| 3300014157|Ga0134078_10599578 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 527 | Open in IMG/M |
| 3300014326|Ga0157380_10880715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
| 3300014326|Ga0157380_11359921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300015077|Ga0173483_10013331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2833 | Open in IMG/M |
| 3300015371|Ga0132258_10172330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5218 | Open in IMG/M |
| 3300015371|Ga0132258_11442670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1738 | Open in IMG/M |
| 3300015372|Ga0132256_101836598 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300015374|Ga0132255_103833684 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 639 | Open in IMG/M |
| 3300015374|Ga0132255_104885358 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 568 | Open in IMG/M |
| 3300015374|Ga0132255_105348023 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 543 | Open in IMG/M |
| 3300018056|Ga0184623_10380568 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300018432|Ga0190275_11972625 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 662 | Open in IMG/M |
| 3300018465|Ga0190269_10256657 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 989 | Open in IMG/M |
| 3300018466|Ga0190268_11938431 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 538 | Open in IMG/M |
| 3300018466|Ga0190268_12217322 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 514 | Open in IMG/M |
| 3300018920|Ga0190273_12185214 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 519 | Open in IMG/M |
| 3300021412|Ga0193736_1056518 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 542 | Open in IMG/M |
| 3300023275|Ga0247776_10362595 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 534 | Open in IMG/M |
| 3300025899|Ga0207642_10417286 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300025922|Ga0207646_11398402 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 609 | Open in IMG/M |
| 3300025927|Ga0207687_10816250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300025932|Ga0207690_11082505 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 668 | Open in IMG/M |
| 3300025945|Ga0207679_10485991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1100 | Open in IMG/M |
| 3300025961|Ga0207712_10309518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1299 | Open in IMG/M |
| 3300025981|Ga0207640_11570356 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 592 | Open in IMG/M |
| 3300025986|Ga0207658_11090933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300026023|Ga0207677_10833095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300026023|Ga0207677_11872384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 557 | Open in IMG/M |
| 3300027907|Ga0207428_10572743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300027907|Ga0207428_10923228 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300028380|Ga0268265_11203509 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300028381|Ga0268264_10902681 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300028708|Ga0307295_10156219 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 635 | Open in IMG/M |
| 3300028754|Ga0307297_10077897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1063 | Open in IMG/M |
| 3300028811|Ga0307292_10325631 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 646 | Open in IMG/M |
| 3300030620|Ga0302046_10530564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
| 3300031114|Ga0308187_10195653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
| 3300031548|Ga0307408_101830726 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 581 | Open in IMG/M |
| 3300031562|Ga0310886_10306552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
| 3300031562|Ga0310886_10384652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300031892|Ga0310893_10073336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1198 | Open in IMG/M |
| 3300031901|Ga0307406_12034449 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 514 | Open in IMG/M |
| 3300031908|Ga0310900_10930844 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300031908|Ga0310900_11545246 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 560 | Open in IMG/M |
| 3300031944|Ga0310884_10198252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
| 3300032012|Ga0310902_10869996 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 618 | Open in IMG/M |
| 3300032017|Ga0310899_10700316 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300032075|Ga0310890_10795684 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300032144|Ga0315910_10068507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2584 | Open in IMG/M |
| 3300032174|Ga0307470_11154499 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 626 | Open in IMG/M |
| 3300033412|Ga0310810_10671551 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300033475|Ga0310811_10484227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1305 | Open in IMG/M |
| 3300034147|Ga0364925_0113546 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
| 3300034149|Ga0364929_0231585 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 618 | Open in IMG/M |
| 3300034668|Ga0314793_122379 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 564 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 9.35% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.74% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.80% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.80% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.87% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.87% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.87% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.93% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.93% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459020 | Litter degradation NP2 | Engineered | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Host-Associated | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009806 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300021412 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1 | Environmental | Open in IMG/M |
| 3300023275 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2NP_02990900 | 2170459020 | Switchgrass, Maize And Mischanthus Litter | RRDGRRTLHRTNAETLRTIHEWSRIFAQHWRGQLRRIKSHAEEER |
| JGI1027J12803_1087121693 | 3300000955 | Soil | VRRDGRRTLARINPETLRTIHDWIALFERHWRGQLRRIKAHAEEDR* |
| JGI10216J12902_1084658281 | 3300000956 | Soil | MNPETLRTIHDWSGMFAQYWRGQLRRIKAHAEEKR* |
| JGI10216J12902_1098790983 | 3300000956 | Soil | RREGRRTMYRINPETLRSIHEWSGMFAQYWRGQLRRVKAHAEEKQ* |
| JGI24746J21847_10210233 | 3300001977 | Corn, Switchgrass And Miscanthus Rhizosphere | TNAETLRTIHDWSGMFAQHWRGQLRRVKAHAEGKR* |
| Ga0062589_1028980012 | 3300004156 | Soil | VRRDGRRTMYRINGETLRTIHDWSGMFAQYWSGQLRRIKAHAEGER* |
| Ga0058859_117973732 | 3300004798 | Host-Associated | RRTLYRTNSETLKTIHDWSGMFAQHWRGQLRRIKAHAEEKQ* |
| Ga0062594_1013314621 | 3300005093 | Soil | RRTMYRINADTLRTVHDWSGMFARYWRGQLRRIKAHAEEER* |
| Ga0066683_103682571 | 3300005172 | Soil | LVYVRREGRRTMYRINAETLRTIHDWSGMFARYWRGQLRRIKAHAEEER* |
| Ga0070683_1003747123 | 3300005329 | Corn Rhizosphere | VRARRDGRRTLYRANADTLRAIHDWSRQFARHWRSQLQRIKEHAEEA* |
| Ga0070689_1006360833 | 3300005340 | Switchgrass Rhizosphere | RRDGRRILYRANARTLKTIHDWSGMFAQHWRGQLRRIKAHAEEKR* |
| Ga0070689_1015885781 | 3300005340 | Switchgrass Rhizosphere | MRREGRRTMYRINGETLRTIHDWSSMFARHWRAQLRRIKAQAEEE* |
| Ga0070675_1012238342 | 3300005354 | Miscanthus Rhizosphere | VGLVSARREGKRTMYRTNPEPLQGVHEWCGMFARYWRGQLRRIKRHAEGKS* |
| Ga0070674_1005008421 | 3300005356 | Miscanthus Rhizosphere | RTLYRTNSETLRTIHDWSGMFAQHWRGQLRRIKAHAEENK* |
| Ga0070672_1017060871 | 3300005543 | Miscanthus Rhizosphere | RTNAETLRTIHDWSGMFAQYWRAQLRRIKNHAEEKP* |
| Ga0070686_1014410681 | 3300005544 | Switchgrass Rhizosphere | RTLYRINAEGLRTIHDWSGMFSRHWRGQLRRIKAHAEEER* |
| Ga0068854_1017508122 | 3300005578 | Corn Rhizosphere | RTLYRVNGETLRTIHDWSGMFARHWRGQLRRIKAHAEEER* |
| Ga0066706_105107421 | 3300005598 | Soil | RRTMYRINAETLRTIHDWSGMFARYWRGQLRRIKAHAEEER* |
| Ga0066905_1000248255 | 3300005713 | Tropical Forest Soil | NAQTLKTIHDWSGMFAQHWRGQLGRIKAHAEEKR* |
| Ga0066905_1005844481 | 3300005713 | Tropical Forest Soil | NPAPLRTVHDWSGMFAQYWRGQLRRIKAHAEGKR* |
| Ga0068866_106758521 | 3300005718 | Miscanthus Rhizosphere | NAETLRTIHEWSRMFAQHWRGQLRRIKAHAEEER* |
| Ga0068870_108962032 | 3300005840 | Miscanthus Rhizosphere | LYRTNPHPLRSIHEWSGLFARHWRGQLQRIKAHAEEDR* |
| Ga0068860_1019493512 | 3300005843 | Switchgrass Rhizosphere | RTNAEVLRTIHDWSRMFARHWRGQLRRIKAHAEEE* |
| Ga0068862_1000587871 | 3300005844 | Switchgrass Rhizosphere | TMYRTNAETLRTIHEWSRMFAQHWRGQLRRIKAHAEEER* |
| Ga0075422_101247153 | 3300006196 | Populus Rhizosphere | RTNAEALRTIHDWAQMFAQYWRGQLRRIKAHAEEKR* |
| Ga0075433_102850414 | 3300006852 | Populus Rhizosphere | TNAETLRTIHDWSGMFAQYWRAQLRRIKNHAEEKR* |
| Ga0075426_107691661 | 3300006903 | Populus Rhizosphere | GRNTWYRTNAEVLRTIHDWSRMFAQHWRGQLRRIKAHAEEER* |
| Ga0079218_128545182 | 3300007004 | Agricultural Soil | RPRRDGKRVLYRADAHSLKTIHDWTGMFQRHWSGQLNRIKQHAERKEE* |
| Ga0066710_1026412811 | 3300009012 | Grasslands Soil | DLVTVRRDGRRILYRANAQALKTIHDWSGMFAQHWRGQLRRIKAHAEEKR |
| Ga0111539_105017531 | 3300009094 | Populus Rhizosphere | MYRTNPEGLRGVHEWTGMFARYWRGQLRRIKAHAEGKR* |
| Ga0105245_108456583 | 3300009098 | Miscanthus Rhizosphere | NAETLRTIHEWSRMFAQHWRGQLRRIKSHAEEER* |
| Ga0105242_115737521 | 3300009176 | Miscanthus Rhizosphere | NPHPLRSIHEWSGLFARHWRGQLQRIKAHAEEDR* |
| Ga0105249_105205614 | 3300009553 | Switchgrass Rhizosphere | VNPEPLRTIHDWVALFERHWRGQLRRIKAHAEEDR* |
| Ga0105081_10162271 | 3300009806 | Groundwater Sand | VRRDGRRTMYRINADTLRTIHDWSGMFARYWRGQLRRIKAHAEEER* |
| Ga0126305_109774542 | 3300010036 | Serpentine Soil | SNPEALRTVHDWCRMFTQHWRGQLRRIKAHAEEDR* |
| Ga0126314_100616071 | 3300010042 | Serpentine Soil | TLYRINAETLRTIHDWSGMFARHWRGQLRRIKAHAEEER* |
| Ga0126306_110298651 | 3300010166 | Serpentine Soil | GRQTLYRSNPEALRTVHDWCRMFTQHWRGQLRRIKAHAEEVR* |
| Ga0126372_118523552 | 3300010360 | Tropical Forest Soil | IRREGRKAMVRINPETLRTIHDWVALFERHWRGQLRRIKAHAELDR* |
| Ga0105246_110023293 | 3300011119 | Miscanthus Rhizosphere | VGLVDARRDGRNTLYRTNPHPLRSIHEWSGLFARHWRGQLQRIKAHAEEDR* |
| Ga0137427_101290253 | 3300011445 | Soil | LVRVRREGRRTMYRINAETLRTIHDWSGMFARYWRGQLRRIKAHAEEER* |
| Ga0150985_1041799431 | 3300012212 | Avena Fatua Rhizosphere | VRRDGRRTLYRVNGETLRTIHDWSSMFARHWRGQLRRIKAHAEEER* |
| Ga0150985_1090903861 | 3300012212 | Avena Fatua Rhizosphere | NGEALRTIHDWSRMFAQHWRGQLRRIKAHAEEER* |
| Ga0150985_1146904903 | 3300012212 | Avena Fatua Rhizosphere | DARRDGRNTLYRTNPHPLRSIHEWSGLFARHWRGQLQRIKSHAEEDR* |
| Ga0137390_105269033 | 3300012363 | Vadose Zone Soil | RREGRRTMYRINAETLRTIYDWSGMFARYWRGQLRRIKAHAEEER* |
| Ga0150984_1015229692 | 3300012469 | Avena Fatua Rhizosphere | MYRTNAETIRTIHEWSQMFAQHWRGQLRRIKAHAEEER* |
| Ga0137373_107732893 | 3300012532 | Vadose Zone Soil | RRTMYRINPATLRTIHDWSGMFTRHWRGQLRRIKARAEEER* |
| Ga0157295_104077902 | 3300012906 | Soil | RTNAETLRTIHDWCGMFARHWRGQLRRIKAHAEEKR* |
| Ga0157283_101817022 | 3300012907 | Soil | LLNVDLVTVRRDGRRTLYRTNSETLRTIHDWSGMFAQHWRGQLRRIKAHAEGNK* |
| Ga0126375_108483741 | 3300012948 | Tropical Forest Soil | RANAQTLKTIHDWSSMFAQHWRGQLGRIKAHAEEKR* |
| Ga0164299_109371402 | 3300012958 | Soil | TNAETLRTIHDWSGMFAQHWRGQLKRIKAHAEGKR* |
| Ga0164306_118858422 | 3300012988 | Soil | NAETLRTIHDWSGMFAQHWRNQLRRIKAHAEEER* |
| Ga0157378_107394811 | 3300013297 | Miscanthus Rhizosphere | LVTVRRDGRRTLCRTNAETLRTFHDWCGMFAQHWRGQLRRIKAHAEEKR* |
| Ga0134078_105995782 | 3300014157 | Grasslands Soil | LVTVRREGRRTMVSIKPETLRTIHDWIALFERHWRGQLRRIKAHAEEDR* |
| Ga0157380_108807151 | 3300014326 | Switchgrass Rhizosphere | GRRTMYRINPETLRTIHDWSGMFARHCRGQLRRIKAHAEEER* |
| Ga0157380_113599213 | 3300014326 | Switchgrass Rhizosphere | VVMVSVRREGRWTRYRVKHETLRTIHDWSGMFARHWRGQLRRIKAHAEEER* |
| Ga0173483_100133311 | 3300015077 | Soil | RDGRRTLYRTNSETLKTIHDWSGMFAQHWRGQLRRIKAHAEEKQ* |
| Ga0132258_101723301 | 3300015371 | Arabidopsis Rhizosphere | GRKTMVRINPETLRTIHDWVALFERHWRGQLRRIKAHAEEDR* |
| Ga0132258_114426701 | 3300015371 | Arabidopsis Rhizosphere | TNSETLRTIHDWSGMFAQHWRGQLRRIKAHAEGNK* |
| Ga0132256_1018365981 | 3300015372 | Arabidopsis Rhizosphere | RRDGRRVLYRTNPEALRTIHEWCGMFARHWGGQLRRIKAHAEEKR* |
| Ga0132255_1038336841 | 3300015374 | Arabidopsis Rhizosphere | TNAHTLRTIHDWSRMFEQYWRGQLQRIKSHAGGKR* |
| Ga0132255_1048853581 | 3300015374 | Arabidopsis Rhizosphere | GRQILYRANAHTLKTIHDWAGMFAGHWRGQLARIKKHAEVKK* |
| Ga0132255_1053480231 | 3300015374 | Arabidopsis Rhizosphere | TNADRLRTIHDWCGMFAQHWRGQLRRIKTHAEEKR* |
| Ga0184623_103805681 | 3300018056 | Groundwater Sediment | DVGLVTVRREGRRTMVSINPATLRTIHDWIALFERHWRGQLRRIKAHAEANR |
| Ga0190275_119726251 | 3300018432 | Soil | RAMSRINVDTLRTVHDWSGMFARYWRGQLRRIKAHAEEER |
| Ga0190269_102566572 | 3300018465 | Soil | VGLVGARREGRSTLYRTNPTPLRTVHEWSGLFARHWRGQLQRIKAHAEEDR |
| Ga0190268_119384311 | 3300018466 | Soil | TLVRINPDTLRTIHDWIALFERHWRAQLRRIKAHAEEDR |
| Ga0190268_122173221 | 3300018466 | Soil | IYRINGETLRTIHDWSGMFARHWRGQLRRIKAHAEEDR |
| Ga0190273_121852142 | 3300018920 | Soil | VGLVSARREGQRTMYRTNPETLRTIHDWSGIFAQHWRGQLRRIKAHAEEKP |
| Ga0193736_10565182 | 3300021412 | Soil | MYRTNADTLRTVHDWSGMFAQYWRSQLRRIKAHAEAKK |
| Ga0247776_103625951 | 3300023275 | Plant Litter | DGRRTMYRTNAQALRAVHEWSSMFEQYWRGQLRRIKAHAEGKS |
| Ga0207642_104172863 | 3300025899 | Miscanthus Rhizosphere | LNVDLVTVRRDGRRTLYRTNSETLRTIHDWSGMFAQHWRGQLRRIKAHAEGKR |
| Ga0207646_113984022 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VLYRTNAGQLRTIHDWCAMFEQHWRGQLRRIKAHAEEKR |
| Ga0207687_108162501 | 3300025927 | Miscanthus Rhizosphere | TNAEVLRTIHDWSRMFAQHWRGQLRRIKAHAEEER |
| Ga0207690_110825052 | 3300025932 | Corn Rhizosphere | MYRTNAEVLRTIHDWSRMFARHWRGQLRRIKAHAEEE |
| Ga0207679_104859911 | 3300025945 | Corn Rhizosphere | SLYRTNADRLRTIHDWCGMFAQHWRGQLRRIKAHAEEKR |
| Ga0207712_103095181 | 3300025961 | Switchgrass Rhizosphere | MVRVNPEPFRTIHDWVALFERHWRGQLRRIKAHAEEDR |
| Ga0207640_115703562 | 3300025981 | Corn Rhizosphere | VTVRRDGRRTLYRVNGETLRTIHDWSGMFARHWRGQLRRIKAHAEEER |
| Ga0207658_110909333 | 3300025986 | Switchgrass Rhizosphere | TNAETLRTIHDWSGMFAQHWRGQLKRIKAHAEGKR |
| Ga0207677_108330953 | 3300026023 | Miscanthus Rhizosphere | TVRRDGRRTLYRTNSATLRTIHDWSGMFAQHWRGQLRRIKTHAEENK |
| Ga0207677_118723841 | 3300026023 | Miscanthus Rhizosphere | RRDGQRTMYRTNAQTLRTIHDWAGMFAQHWRGQLRRIKAHAEEER |
| Ga0207428_105727431 | 3300027907 | Populus Rhizosphere | LYRTNSETLRTIHDWSGMFAQHWRGQLRRIKAHAEGNK |
| Ga0207428_109232282 | 3300027907 | Populus Rhizosphere | RRDGRRTMVSINPDTLRTIHDWVALFERHWRSQLRRIKAHAEQDR |
| Ga0268265_112035091 | 3300028380 | Switchgrass Rhizosphere | TNAETLRTIHDWSGMFAQHWRGQLRRIKAHAEGKR |
| Ga0268264_109026811 | 3300028381 | Switchgrass Rhizosphere | WYRTNAEVLRTIHDWSRMFAQHWRGQLRRIKAHAEEER |
| Ga0307295_101562192 | 3300028708 | Soil | MYRINPETLRTIHDWSGMFARHWRGQLRRIKAHAEEER |
| Ga0307297_100778973 | 3300028754 | Soil | INPDTLRTIHDWIALFERHWRGQLRRIKAHAEEER |
| Ga0307292_103256312 | 3300028811 | Soil | DGRRTMYRINPETLRTIHDWSGMFARHWRGQLRRIKAHAEEER |
| Ga0302046_105305643 | 3300030620 | Soil | RRTLYRTNADTLRTIHDWCGMFARHWRGQLGRIKAHAEERR |
| Ga0308187_101956531 | 3300031114 | Soil | MYRINAETLRTIHEWSGMFARHWRGQLRRIKAHAEEER |
| Ga0307408_1018307262 | 3300031548 | Rhizosphere | RNTLYRTNPYPLRTIHEWSGLFARHWRAQLQRIKVHAEENR |
| Ga0310886_103065521 | 3300031562 | Soil | DGRRTLYRINAETLRTIHDWSGMFARHWRGQLRRIKAHAEEER |
| Ga0310886_103846521 | 3300031562 | Soil | RREGRQTMCRINAETLRTVHDWCGMFAQHWRGQLRRIKAHAEENR |
| Ga0310893_100733363 | 3300031892 | Soil | RTLYRTNSETLRTIHDWSGMFAQHWRGQLRRIKAHAEGNK |
| Ga0307406_120344492 | 3300031901 | Rhizosphere | LYRTNPYPLRTIHEWSGLFARHWRAQLQRIKVHAEEDR |
| Ga0310900_109308441 | 3300031908 | Soil | RINAQTLRTIHDWSGMFERYWRGQLHRIKAHAEEKR |
| Ga0310900_115452461 | 3300031908 | Soil | TNAETLRTIHDWCGMFARHWRGQLRRIKAHAEEKR |
| Ga0310884_101982521 | 3300031944 | Soil | TNADTLRTVHDWCRMFAQHWGGQLRRIKAHAEGKR |
| Ga0310902_108699961 | 3300032012 | Soil | GRRTMYRINGETLRTIHDWSSMFARHWRTQLRRIKAQAEEE |
| Ga0310899_107003162 | 3300032017 | Soil | KHLQVLLNVDLVTVRRDGRRTLYRTNSETLRTIHDWSGMFAQHWRGQLRRIKAHAEGNK |
| Ga0310890_107956843 | 3300032075 | Soil | NMRREGRQTMCRINAETLRTVHDWCGMFAQHWRGQLRRIKAHAEEKSR |
| Ga0315910_100685074 | 3300032144 | Soil | RTLYRTNSETLRTIHDWSGMFAQHWRGQLRRIKAHAEGHK |
| Ga0307470_111544992 | 3300032174 | Hardwood Forest Soil | MFYRTNAETLRTIHDWSGMFAQHWRGQLRRIKAHAEGKR |
| Ga0310810_106715511 | 3300033412 | Soil | RRDGRRTMVSINPDTLRTIHDWIALFERHWRGQLRRIKARAEEDR |
| Ga0310811_104842271 | 3300033475 | Soil | RANAQTLKTIHDWSGMFAQHWRGQLRRIKAHAEEKR |
| Ga0364925_0113546_847_966 | 3300034147 | Sediment | TLYRTNSETLRTIHDWSGMFAQHWRGQLRRIKAHAEENK |
| Ga0364929_0231585_3_122 | 3300034149 | Sediment | TLYRTNSETLRTIHDWSGMFAQHWRGQLRRIKAHAEEKR |
| Ga0314793_122379_456_563 | 3300034668 | Soil | TNAETLRTIHDWCGLFARHWHGQLRRIKAHAEEKR |
| ⦗Top⦘ |