| Basic Information | |
|---|---|
| Family ID | F092262 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 49 residues |
| Representative Sequence | EASLALDNHWRAHVALGEMLARLDRHDEANAHLSAALKLALAELERQ |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.96 % |
| % of genes near scaffold ends (potentially truncated) | 96.26 % |
| % of genes from short scaffolds (< 2000 bps) | 87.85 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.68 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.832 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (8.411 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.579 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.860 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.67% β-sheet: 0.00% Coil/Unstructured: 45.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.68 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF00970 | FAD_binding_6 | 28.97 |
| PF00175 | NAD_binding_1 | 26.17 |
| PF03401 | TctC | 6.54 |
| PF00528 | BPD_transp_1 | 2.80 |
| PF00496 | SBP_bac_5 | 1.87 |
| PF03167 | UDG | 1.87 |
| PF02810 | SEC-C | 1.87 |
| PF01370 | Epimerase | 1.87 |
| PF05523 | FdtA | 0.93 |
| PF13480 | Acetyltransf_6 | 0.93 |
| PF12161 | HsdM_N | 0.93 |
| PF02776 | TPP_enzyme_N | 0.93 |
| PF13460 | NAD_binding_10 | 0.93 |
| PF01694 | Rhomboid | 0.93 |
| PF00111 | Fer2 | 0.93 |
| PF00535 | Glycos_transf_2 | 0.93 |
| PF09834 | DUF2061 | 0.93 |
| PF13489 | Methyltransf_23 | 0.93 |
| PF02604 | PhdYeFM_antitox | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 6.54 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 1.87 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 1.87 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 1.87 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.93 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.83 % |
| Unclassified | root | N/A | 26.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_107522221 | Not Available | 517 | Open in IMG/M |
| 3300004157|Ga0062590_102367832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 560 | Open in IMG/M |
| 3300005181|Ga0066678_10283241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1080 | Open in IMG/M |
| 3300005205|Ga0068999_10095147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 586 | Open in IMG/M |
| 3300005328|Ga0070676_10075572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2032 | Open in IMG/M |
| 3300005332|Ga0066388_101708534 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300005333|Ga0070677_10200625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 962 | Open in IMG/M |
| 3300005333|Ga0070677_10828702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 530 | Open in IMG/M |
| 3300005339|Ga0070660_101374230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
| 3300005341|Ga0070691_10862066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 556 | Open in IMG/M |
| 3300005344|Ga0070661_100459704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1014 | Open in IMG/M |
| 3300005356|Ga0070674_100375580 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300005364|Ga0070673_102381241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300005365|Ga0070688_100699020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 785 | Open in IMG/M |
| 3300005434|Ga0070709_11095727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 637 | Open in IMG/M |
| 3300005436|Ga0070713_102218404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 532 | Open in IMG/M |
| 3300005439|Ga0070711_101129203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 676 | Open in IMG/M |
| 3300005539|Ga0068853_101722048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300005548|Ga0070665_100014675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 7861 | Open in IMG/M |
| 3300005577|Ga0068857_100009456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 8464 | Open in IMG/M |
| 3300005616|Ga0068852_101461766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 706 | Open in IMG/M |
| 3300005840|Ga0068870_10564886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 768 | Open in IMG/M |
| 3300005842|Ga0068858_100348365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1419 | Open in IMG/M |
| 3300006237|Ga0097621_100582817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1021 | Open in IMG/M |
| 3300006237|Ga0097621_102325617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 513 | Open in IMG/M |
| 3300006358|Ga0068871_101181990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 717 | Open in IMG/M |
| 3300006358|Ga0068871_101535107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 630 | Open in IMG/M |
| 3300006604|Ga0074060_11516217 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300006804|Ga0079221_11437037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 550 | Open in IMG/M |
| 3300006871|Ga0075434_100553221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1170 | Open in IMG/M |
| 3300006894|Ga0079215_10647775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 701 | Open in IMG/M |
| 3300006904|Ga0075424_102507498 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300009036|Ga0105244_10379172 | Not Available | 651 | Open in IMG/M |
| 3300009053|Ga0105095_10210814 | Not Available | 1064 | Open in IMG/M |
| 3300009100|Ga0075418_10487879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1322 | Open in IMG/M |
| 3300009162|Ga0075423_10389652 | Not Available | 1462 | Open in IMG/M |
| 3300009171|Ga0105101_10082989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1556 | Open in IMG/M |
| 3300009797|Ga0105080_1016023 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300010366|Ga0126379_12249649 | Not Available | 646 | Open in IMG/M |
| 3300010371|Ga0134125_12378735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 576 | Open in IMG/M |
| 3300010375|Ga0105239_10345528 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1679 | Open in IMG/M |
| 3300010376|Ga0126381_100529339 | Not Available | 1667 | Open in IMG/M |
| 3300010396|Ga0134126_12767449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 532 | Open in IMG/M |
| 3300010400|Ga0134122_12332343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 581 | Open in IMG/M |
| 3300010401|Ga0134121_13237018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300012533|Ga0138256_10539476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 936 | Open in IMG/M |
| 3300012905|Ga0157296_10022563 | Not Available | 1251 | Open in IMG/M |
| 3300012911|Ga0157301_10125144 | Not Available | 788 | Open in IMG/M |
| 3300012984|Ga0164309_10491356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 937 | Open in IMG/M |
| 3300013100|Ga0157373_10359274 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300013100|Ga0157373_10616352 | Not Available | 791 | Open in IMG/M |
| 3300013105|Ga0157369_10416047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1394 | Open in IMG/M |
| 3300013105|Ga0157369_11322542 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 734 | Open in IMG/M |
| 3300014317|Ga0075343_1101905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 656 | Open in IMG/M |
| 3300015371|Ga0132258_11464133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1725 | Open in IMG/M |
| 3300015373|Ga0132257_104642693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 500 | Open in IMG/M |
| 3300018027|Ga0184605_10273597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 767 | Open in IMG/M |
| 3300018476|Ga0190274_10886710 | Not Available | 958 | Open in IMG/M |
| 3300021445|Ga0182009_10856311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 500 | Open in IMG/M |
| 3300025878|Ga0209584_10162842 | Not Available | 843 | Open in IMG/M |
| 3300025907|Ga0207645_10082406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2062 | Open in IMG/M |
| 3300025907|Ga0207645_10988707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 570 | Open in IMG/M |
| 3300025917|Ga0207660_11088742 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300025920|Ga0207649_10241724 | Not Available | 1296 | Open in IMG/M |
| 3300025930|Ga0207701_10045450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4064 | Open in IMG/M |
| 3300025944|Ga0207661_10359308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1315 | Open in IMG/M |
| 3300025960|Ga0207651_11899553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 535 | Open in IMG/M |
| 3300026089|Ga0207648_11653494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 602 | Open in IMG/M |
| 3300027682|Ga0209971_1016798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1735 | Open in IMG/M |
| 3300027775|Ga0209177_10089105 | Not Available | 957 | Open in IMG/M |
| 3300027831|Ga0209797_10026512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2636 | Open in IMG/M |
| 3300027850|Ga0209591_10265729 | Not Available | 1301 | Open in IMG/M |
| 3300027890|Ga0209496_10131784 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1118 | Open in IMG/M |
| 3300027899|Ga0209668_10162949 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300028381|Ga0268264_11662270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300028587|Ga0247828_10562179 | Not Available | 689 | Open in IMG/M |
| 3300028652|Ga0302166_10021793 | Not Available | 1255 | Open in IMG/M |
| 3300028739|Ga0302205_10142478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 613 | Open in IMG/M |
| 3300028868|Ga0302163_10193672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 560 | Open in IMG/M |
| 3300029984|Ga0311332_10114874 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1968 | Open in IMG/M |
| 3300030010|Ga0302299_10403365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 698 | Open in IMG/M |
| 3300030052|Ga0302217_10157369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 538 | Open in IMG/M |
| 3300030339|Ga0311360_10999379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300031232|Ga0302323_100007335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 9113 | Open in IMG/M |
| 3300031726|Ga0302321_100628653 | Not Available | 1198 | Open in IMG/M |
| 3300031795|Ga0318557_10049932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1756 | Open in IMG/M |
| 3300031873|Ga0315297_10677321 | Not Available | 864 | Open in IMG/M |
| 3300031873|Ga0315297_11272081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 601 | Open in IMG/M |
| 3300031941|Ga0310912_11269473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Candidatus Nitrotoga | 559 | Open in IMG/M |
| 3300031996|Ga0308176_10053401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3330 | Open in IMG/M |
| 3300031997|Ga0315278_10969596 | Not Available | 849 | Open in IMG/M |
| 3300031999|Ga0315274_11060294 | Not Available | 821 | Open in IMG/M |
| 3300031999|Ga0315274_11634742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 603 | Open in IMG/M |
| 3300032008|Ga0318562_10642363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Candidatus Nitrotoga | 612 | Open in IMG/M |
| 3300032012|Ga0310902_11250393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 524 | Open in IMG/M |
| 3300032143|Ga0315292_11034265 | Not Available | 681 | Open in IMG/M |
| 3300032256|Ga0315271_10584216 | Not Available | 953 | Open in IMG/M |
| 3300032397|Ga0315287_11887215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 662 | Open in IMG/M |
| 3300033233|Ga0334722_11139027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 547 | Open in IMG/M |
| 3300033419|Ga0316601_100772323 | Not Available | 948 | Open in IMG/M |
| 3300033486|Ga0316624_11687258 | Not Available | 585 | Open in IMG/M |
| 3300033551|Ga0247830_11119102 | Not Available | 629 | Open in IMG/M |
| 3300034129|Ga0370493_0019627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2018 | Open in IMG/M |
| 3300034169|Ga0370480_0013070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2915 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 8.41% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 7.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 3.74% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.87% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.87% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.93% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.93% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.93% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.93% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.93% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.93% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009797 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014317 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027850 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028652 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300028739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028868 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300030052 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034129 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16 | Environmental | Open in IMG/M |
| 3300034169 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1075222212 | 3300000559 | Soil | SLAHEDAWRTRVALGELFARLGREHDANVHLAAALKLALSELDPE* |
| Ga0062590_1023678322 | 3300004157 | Soil | KAQSYLEASLAHDDAWRTRVALGELFARLGSEHEANVHLAAALKLALSELEP* |
| Ga0066678_102832411 | 3300005181 | Soil | AQTYLEASLALDNSWRANLALGEMQANLGRTDEANAHLAAALKLALAALNRR* |
| Ga0068999_100951471 | 3300005205 | Natural And Restored Wetlands | YFEASLALDDAFETRVALGELFARLDRTDEANAQLAAALKLALAELRARD* |
| Ga0070676_100755723 | 3300005328 | Miscanthus Rhizosphere | LEASLALDNHWRAHVALAELFAKLDRPDEANAHRSAALTLALAELAREK* |
| Ga0066388_1017085342 | 3300005332 | Tropical Forest Soil | EASLALDDAYETRVALGELFAELGRTDEANTQLAAALRLALAELRERA* |
| Ga0070677_102006252 | 3300005333 | Miscanthus Rhizosphere | TYLEASLALDDNWRTHLALGELHGRLDRSDLANTHLAAALKLSLVELERPGR* |
| Ga0070677_108287022 | 3300005333 | Miscanthus Rhizosphere | SLAVEDGWRTRVALGELFARLGRVSDANAQLALALKLAIKELNRG* |
| Ga0070660_1013742301 | 3300005339 | Corn Rhizosphere | TYLEASLALDNHWRTHVALGELFATLGRTDEANAHLAAALRLALEALRAPRH* |
| Ga0070691_108620661 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | SLALDNHWRAHVALGEMLAKLDRRTEADAHFAAALRLALAELERR* |
| Ga0070661_1004597042 | 3300005344 | Corn Rhizosphere | YLEASLALDNHWRTHVALGELFTKLGRRDEAQAHLGAALRLALDALTRDEDRGSSV* |
| Ga0070674_1003755801 | 3300005356 | Miscanthus Rhizosphere | TYFEASVAVEDTWRTRVALGELFARLGRASDANAQLAAALKLAIRELNRS* |
| Ga0070673_1023812411 | 3300005364 | Switchgrass Rhizosphere | ASLALDNDWRAHLALGEMQAKLNHTDEANAHLAAALKLALVALERRG* |
| Ga0070688_1006990202 | 3300005365 | Switchgrass Rhizosphere | YLEASLALDNHWRAHVALGEMLARLDRHDEANAHLSAALKLALAELERQ* |
| Ga0070709_110957271 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LEASLALDNHWRAHVALGELLAELGRHDEANAHLAAALKLALGELTTREG* |
| Ga0070713_1022184042 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ALDNHWRAHVALGEMLEKLDRRAEADAHFAAALRLALAELERS* |
| Ga0070711_1011292032 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | QTYLEASLALDNHWRAHVALGELLAELGRHDEANAHLAAALKLALGELTTREG* |
| Ga0068853_1017220481 | 3300005539 | Corn Rhizosphere | LEASLALDNHWRAHVALGEMLAKLDRNAEADAHFAAALRLALAELERTIR* |
| Ga0070665_1000146751 | 3300005548 | Switchgrass Rhizosphere | LEASLALAESWRTHLALGELHAKLGRADEANAHLAAALKLALADLRSKPVEDRG* |
| Ga0068857_10000945610 | 3300005577 | Corn Rhizosphere | ASLALDNHWRAHVALGEMLAKLDRRTEADAHFAAALRLALAELERR* |
| Ga0068852_1014617662 | 3300005616 | Corn Rhizosphere | EASLALDNHWRAHVALGEMLARLDRHDEANAHLSAALKLALAELERQ* |
| Ga0068870_105648862 | 3300005840 | Miscanthus Rhizosphere | LEASLALDDHWRAHVALGEMLGRLGRDEAANSHLASALSLALAELKRRPR* |
| Ga0068858_1003483651 | 3300005842 | Switchgrass Rhizosphere | YLEASLALDDHWRTHVALGELHARLGNAELANTHLAAALKRSLVELGRAQPSAEA* |
| Ga0068858_1025127291 | 3300005842 | Switchgrass Rhizosphere | NVWQTRVALGELLVKLGRNDEANAQLAQALKLAIAELNTIRSPG* |
| Ga0097621_1005828172 | 3300006237 | Miscanthus Rhizosphere | ASVAVEDAWRTRVALGELFARLNRASDASAQLAAALKLAIKELNRN* |
| Ga0097621_1023256171 | 3300006237 | Miscanthus Rhizosphere | ALDNHWRAHVALGELLAELGRHDEANAHLAAALKLALGELTTREG* |
| Ga0068871_1011819901 | 3300006358 | Miscanthus Rhizosphere | LALDNHWRAHVALADLFAKLDRPDEANAHRSAALTLALAELAREK* |
| Ga0068871_1015351072 | 3300006358 | Miscanthus Rhizosphere | ALDNHWRAHVALGEMLAKLDRNAEADAHFAAALRLALAELERTIR* |
| Ga0074060_115162171 | 3300006604 | Soil | SLALDNHWRAHVALGELLARLGRDDAANAHLATALKLALAELEQVPARNVAV* |
| Ga0079221_114370372 | 3300006804 | Agricultural Soil | SLALDNHWRAHVALGELLAELGRHDEANAHLAAALKLALGELTTREG* |
| Ga0075434_1005532212 | 3300006871 | Populus Rhizosphere | QSYLEASLAHEDAWRTRVALGELFARLGREHEANLHLAAALKLALSELEEG* |
| Ga0079215_106477752 | 3300006894 | Agricultural Soil | AQTYYEASLALDDGWHAHVALGEMLARLGRDQEANAHLAAALKLALSELSDR* |
| Ga0075424_1025074982 | 3300006904 | Populus Rhizosphere | KAQTYFEASLALDDAYETRVALGELFARLGRTDEANAQLAAALKQALSELRARS* |
| Ga0105244_103791721 | 3300009036 | Miscanthus Rhizosphere | ASLAIENSWRTRVALGELFARLNRDFDANAQLAAALKLALAELDRG* |
| Ga0105095_102108141 | 3300009053 | Freshwater Sediment | SLALDNTYRTHVALGELFARLGRHDEANAHLAAALKLALAELGTPG* |
| Ga0075418_104878793 | 3300009100 | Populus Rhizosphere | SLALDDAWRTHLALGEMLAKLGRHDQANAHLAAALKLALAELERRTG* |
| Ga0075423_103896522 | 3300009162 | Populus Rhizosphere | YLEASLALDNHWRAHVALGEMLEKLDRHDEANAHLAAALRLALGELERNES* |
| Ga0105101_100829891 | 3300009171 | Freshwater Sediment | QTYYEASLALDDGWRTRVALGEMLARLGRADAANAHLAAALKLALAELERGAAPR* |
| Ga0105080_10160231 | 3300009797 | Groundwater Sand | LEASLALDDTWRTRVALGELFGRLGRDSDANAQLAAALKLALAELGK* |
| Ga0126379_122496491 | 3300010366 | Tropical Forest Soil | KAQSYLEASLAHEDAWRTRVALGELFARLGREHEANVHLAAALKLALSELAES* |
| Ga0134125_123787351 | 3300010371 | Terrestrial Soil | HVALADLFTKLDRPDEASAHRSAALTLALAELARDE* |
| Ga0105239_103455281 | 3300010375 | Corn Rhizosphere | QTYLEASLALDNHWRTHVALGELFATLGRTDQANAHLAAALRLAITALDTPAG* |
| Ga0126381_1005293391 | 3300010376 | Tropical Forest Soil | SLALDDAYETRVALGELFAQLGRTDEANAQLAAALRLALAELRGRG* |
| Ga0134126_127674491 | 3300010396 | Terrestrial Soil | SLALASSWRTHVALGEMLARLDQHDAANAHLAAALKLALSELRARPAP* |
| Ga0134122_123323431 | 3300010400 | Terrestrial Soil | TYFEASLAIEDTWRTRVALGEHFAHRGLDGEANIQLAAAFKLALAELRRE* |
| Ga0134121_132370182 | 3300010401 | Terrestrial Soil | EASLALDDNWRTHLALGELHGRLDRSDLANTHLAAALKLSLVELERPGR* |
| Ga0138256_105394761 | 3300012533 | Active Sludge | TYYEASLALDDHWRSHVLLGNMLARLGREDEANAHLAAGLKLAIAELGEPGHGR* |
| Ga0157296_100225631 | 3300012905 | Soil | LEASLALDNHWRAHVALGEMLAKLDRRTEADAHFAAALRLALAELERR* |
| Ga0157301_101251441 | 3300012911 | Soil | TYLEASLALDNHWRAHVALGEMLAKLDRNAEADAHFAAALRLALAELERR* |
| Ga0164309_104913561 | 3300012984 | Soil | AQSYLEASLAHEDAWRTRVALGELFARLGREHDANVHLAAALKIALTELEPE* |
| Ga0157373_103592742 | 3300013100 | Corn Rhizosphere | EASLALDNHWRAHVALGELLAELGRQDEANAHLAAALQLALGELTTREA* |
| Ga0157373_106163522 | 3300013100 | Corn Rhizosphere | LEASLALDNHWRAHVALGEMLSQLGRHDEANAHLAAALKLALADLSRD* |
| Ga0157369_104160473 | 3300013105 | Corn Rhizosphere | SLALDNHWRAHVALGEMLAKLDRNAEADAHFAAALRLALAELERTIR* |
| Ga0157369_113225421 | 3300013105 | Corn Rhizosphere | TYLEASLALDNHWRAHVALGELLAHLGRDDEANAHLAAALKLALGELAARDGG* |
| Ga0075343_11019051 | 3300014317 | Natural And Restored Wetlands | SLALEDGWRTRVALGELMVRLGRNDEANAHLAAALKLALTELRPPDA* |
| Ga0157379_109329961 | 3300014968 | Switchgrass Rhizosphere | AVEDTWRTRVALGELFARLGRASDANAQLAAALKLAIRELNRS* |
| Ga0132258_114641331 | 3300015371 | Arabidopsis Rhizosphere | LALDDACETRVALGDLLARLGRTDDANTQLAAALKLALAELRSRV* |
| Ga0132257_1046426931 | 3300015373 | Arabidopsis Rhizosphere | SLALDNHWRAHVALGELLTELGRQDEANAHLAAALKLALGELEGRDGV* |
| Ga0184605_102735971 | 3300018027 | Groundwater Sediment | SLALDHGWRAHLALGEMQAKLGRSDQANAHLAAALRLALAELEQR |
| Ga0190274_108867101 | 3300018476 | Soil | SLALDDHWRAHVALGEMLGRLGRNEAANSHLASALSLALAELKRRPR |
| Ga0182009_108563111 | 3300021445 | Soil | SLALDNHWRAHVALGEMLEKLDRNEEADAHLSAALKLALAELERGPPTAASTSGSEQ |
| Ga0209584_101628422 | 3300025878 | Arctic Peat Soil | SVALDNHWRAHVALGEMQGRLGRDDLANSHLAMALKLALAELKQAPA |
| Ga0207645_100824063 | 3300025907 | Miscanthus Rhizosphere | YLEASLALDNHWRAHVALAELFAKLDRPDEANAHRSAALTLALAELAREK |
| Ga0207645_109887072 | 3300025907 | Miscanthus Rhizosphere | MTMTINGVAVDDTWRTRVALGELFARLGRASDANAQLAAALKLAIKELNRN |
| Ga0207660_110887422 | 3300025917 | Corn Rhizosphere | TYLEASLALDNHWRAHVALGEMLAKLGRTDEANAHLAAALRLALGELTAREG |
| Ga0207649_102417242 | 3300025920 | Corn Rhizosphere | LDNHWRAHVALADLFTKLDRPDEASAHRSAALTLALAELARDP |
| Ga0207701_100454501 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | ASLAIENRWRTRVALGELFARLNRDFDANAQLAAALKLALAELDRG |
| Ga0207661_103593083 | 3300025944 | Corn Rhizosphere | DNHWRAHVALGEMLAKLDRNAEADAHFAAALRLALAELERTIR |
| Ga0207651_118995532 | 3300025960 | Switchgrass Rhizosphere | EASLALDNHWRAHVALGEMLARLDRHDEANAHLSAALKLALAELERQ |
| Ga0207648_116534942 | 3300026089 | Miscanthus Rhizosphere | FEASLAVADTWRTRVALGELFARLNRDSDANAQLAAALKLALAELEK |
| Ga0209971_10167983 | 3300027682 | Arabidopsis Thaliana Rhizosphere | ALDNHWRAHVALADLFTKLDRPDEASAHRSAALTLALAELARNE |
| Ga0209177_100891052 | 3300027775 | Agricultural Soil | EASVALDNHWRAHVALGELLATLGRHDEANAHLAAALRLALAELSQD |
| Ga0209797_100265123 | 3300027831 | Wetland Sediment | EASLALADVCRTHVALGELFARLGRSDEANAHLAAALKLALAELGPL |
| Ga0209591_102657291 | 3300027850 | Freshwater | EASLALDTHWRTQVALGELLARLDRHDEANVHLAAALKLTLATLESRKP |
| Ga0209496_101317843 | 3300027890 | Wetland | EASLALEDGWRTRVALGEMLARLGRADAANAHLAAALKLALAELEDGAAGR |
| Ga0209668_101629494 | 3300027899 | Freshwater Lake Sediment | SLALDDHWRAHVLLGNMLARLGRDDEANAHLAAGLRRALADLGASGLAGNQGP |
| Ga0268264_116622702 | 3300028381 | Switchgrass Rhizosphere | ALDDHWRTHVALGELHGRLGQTALANTHLAAALKRSLVALGNPNFPSALEREP |
| Ga0247828_105621791 | 3300028587 | Soil | YYEASLALDDGWRARVALGEMLARLGRHDAANAHLAAALKLAIDVLSRDDVPAPFRQ |
| Ga0302166_100217932 | 3300028652 | Fen | GKAQTYYEASLALDNHWRAHVALGEMHGKLGRDESANSHLATALKLALAELKRTARP |
| Ga0302205_101424782 | 3300028739 | Fen | LALANDWRTHVALGEMLGQLGRVAEANDHLSAAFKLAIAELESAAA |
| Ga0302163_101936722 | 3300028868 | Fen | SLALDDHWRTHVALGELHARLDRTDQANAHLAAALSRSLVELGEPRR |
| Ga0311332_101148741 | 3300029984 | Fen | YFEASLALDDAYETRVALGELFARLGRTDEANAQLAAALKQALAELRSRG |
| Ga0302299_104033652 | 3300030010 | Fen | GKAQTYYEASLALANDWRTHVALGEMLGQLGRVAEANDHLSAAFKLAIAELESAAA |
| Ga0302217_101573692 | 3300030052 | Fen | LDNHWRAHVALGEMHGRLGRDESANSHLAAALKLALAELKRTARP |
| Ga0311360_109993791 | 3300030339 | Bog | LEASLALDDHWRTHVALGELHARLDRTDQANAHLAAALSRSLVELGEPRR |
| Ga0302323_10000733512 | 3300031232 | Fen | EASLALENHWRAHVALGEMQGRLGRDESANSHLAAALRLALAELKRSARP |
| Ga0302321_1006286532 | 3300031726 | Fen | SLALDNHWRAHVALGEMHGRLGRDESANSHLAAALKLALAELKRTARP |
| Ga0318557_100499321 | 3300031795 | Soil | SYYEASLALSDNWRTRIALGELLGQLGRHEDANAHLAAALKLAVAELERAPSA |
| Ga0315297_106773211 | 3300031873 | Sediment | LEASLALDDTWRTRVALGELFGRLGRDFDANAQLAAALKLALAELEK |
| Ga0315297_112720812 | 3300031873 | Sediment | EASLALDNHWRTHVALGELHGRLGREDKANPHFATALKLALAELKRPG |
| Ga0310912_112694732 | 3300031941 | Soil | LALDDRWRVHLALGELHAKLERPDQANAHLAAALKLALDALERRGD |
| Ga0308176_100534016 | 3300031996 | Soil | ASLALDNHWRAHVALGEMLAQLGRHGEANAHLAAALKLALGELEGREGRV |
| Ga0315278_109695961 | 3300031997 | Sediment | SLALDNHWRTRVALGEMQARLGREESANSHLAMALKLALAELKRLPR |
| Ga0315274_110602941 | 3300031999 | Sediment | SLALDDTWRTRVALGELFGRLGRDAEANAQLAAALKLALAALEK |
| Ga0315274_116347421 | 3300031999 | Sediment | LEASLALDDTWRTRVALGELFGRIGRDADANAQLAAALKLALAELKSGSDTQ |
| Ga0318562_106423632 | 3300032008 | Soil | TYYEASLALDDRWRVHLALGELHAKLERPDQANAHLAAALKLALDALERRGD |
| Ga0310902_112503932 | 3300032012 | Soil | QTYFEASLAIENSWRTRVALGELFARLNRDFDANAQLAAALKLALAELDRG |
| Ga0315292_110342652 | 3300032143 | Sediment | SLALGEGYRAHVALGELFARLGRDGEANTHLAAALKLALAELERA |
| Ga0315271_105842161 | 3300032256 | Sediment | QTYFEASLALDNHWRAHVALGEMFGRLGRDEAANAHLASALKLALAELRRSPR |
| Ga0315287_118872151 | 3300032397 | Sediment | LDDTWRTRVALGELCGRIGRDAEANAQLAAALKLALAELKSGSDTPN |
| Ga0335085_125114342 | 3300032770 | Soil | EASLALEEHWRTHLALGELLARLHQAPAANTHLATALRLALDELRAAEQR |
| Ga0334722_111390272 | 3300033233 | Sediment | GKAQTYLEASLALDDTWRTRVALGELFARLGRDGEANAHLAAALKLALAELDR |
| Ga0316601_1007723232 | 3300033419 | Soil | AQTYLEASLAVDDSWRTRVALGELFGRLGRDGEANAQLAAALKLALAELEK |
| Ga0316624_116872582 | 3300033486 | Soil | SLALDNAYATHVALGELLVRLGRTAEANAHLAAALNLALAALKAERRPEERVAAPG |
| Ga0247830_111191022 | 3300033551 | Soil | ASLALDNHWRAHVALGEMLAKLDRRTEADAHFAAALRLALAELERR |
| Ga0370493_0019627_1860_2018 | 3300034129 | Untreated Peat Soil | QTYLEASLALDDRYRTHVALGELFARLGRHDEANAHLAAALREALGELDAGG |
| Ga0370480_0013070_2747_2914 | 3300034169 | Untreated Peat Soil | KAQTYYEASLALAPSYRTHLGLGELHAGLGRDAEANAHLAAALRLALAELDPPDR |
| ⦗Top⦘ |