Metagenome Family F092259

Overview

Basic Information

• Family ID: F092259
• Family Type: Metagenome
• Number of Sequences: 107
• Average Sequence Length: 41 residues
• Representative Sequence: MKKMILLEEANHAIELVDLHMTVGLEILDETAGQENNREGG
• Number of Associated Samples: 68
• Number of Associated Scaffolds: 107

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 67.92 %
• % of genes near scaffold ends (potentially truncated): 20.56 %
• % of genes from short scaffolds (< 2000 bps): 98.13 %
• Associated GOLD sequencing projects: 64
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (97.196 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (77.570 % of family members)
• Environment Ontology (ENVO): Unclassified (80.374 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (80.374 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 4.35%
  β-sheet: 15.94%
  Coil/Unstructured: 79.71%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.20 %
All Organisms	root	All Organisms	2.80 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.20 %
cellular organisms	root	All Organisms → cellular organisms	2.80 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.20 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	2.80 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.20 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	2.80 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.20 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	2.80 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.20 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	2.80 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.20 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2.80 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.20 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	1.87 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.20 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	1.87 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.20 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	1.87 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.20 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1.87 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.20 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	1.87 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.20 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	1.87 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.20 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	1.87 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.20 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	1.87 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.20 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	1.87 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.20 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1.87 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.20 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	0.93 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.20 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	0.93 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300003319|soilL2_10113101	Not Available	1677
3300005334|Ga0068869_100307762	Not Available	1281
3300005334|Ga0068869_100920426	Not Available	757
3300005354|Ga0070675_102172258	Not Available	512
3300005459|Ga0068867_100241038	Not Available	1466
3300005719|Ga0068861_101064114	Not Available	776
3300005840|Ga0068870_11404663	Not Available	511
3300006237|Ga0097621_100659545	Not Available	961
3300006237|Ga0097621_100750135	Not Available	901
3300006881|Ga0068865_100383087	Not Available	1147
3300009148|Ga0105243_10788724	Not Available	935
3300011119|Ga0105246_12398617	Not Available	517
3300013297|Ga0157378_10864106	Not Available	933
3300013297|Ga0157378_10991309	Not Available	874
3300013297|Ga0157378_12427261	Not Available	576
3300014745|Ga0157377_10240527	Not Available	1168
3300015268|Ga0182154_1006934	Not Available	947
3300015269|Ga0182113_1002015	Not Available	1524
3300015269|Ga0182113_1038732	Not Available	664
3300015275|Ga0182172_1000955	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	1710
3300015275|Ga0182172_1074828	Not Available	506
3300015276|Ga0182170_1004899	Not Available	1075
3300015276|Ga0182170_1057641	Not Available	550
3300015276|Ga0182170_1073042	Not Available	512
3300015279|Ga0182174_1081673	Not Available	510
3300015283|Ga0182156_1015573	Not Available	824
3300015283|Ga0182156_1074731	Not Available	528
3300015285|Ga0182186_1041129	Not Available	619
3300015285|Ga0182186_1079460	Not Available	510
3300015286|Ga0182176_1059551	Not Available	565
3300015287|Ga0182171_1041396	Not Available	629
3300015287|Ga0182171_1085976	Not Available	506
3300015288|Ga0182173_1022910	Not Available	733
3300015289|Ga0182138_1018754	Not Available	781
3300015291|Ga0182125_1007438	Not Available	1028
3300015292|Ga0182141_1004252	Not Available	1190
3300015294|Ga0182126_1009455	Not Available	970
3300015294|Ga0182126_1015176	Not Available	853
3300015294|Ga0182126_1016638	Not Available	832
3300015294|Ga0182126_1026142	Not Available	734
3300015296|Ga0182157_1007884	Not Available	1050
3300015299|Ga0182107_1043630	Not Available	655
3300015302|Ga0182143_1017180	Not Available	848
3300015302|Ga0182143_1101765	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	506
3300015303|Ga0182123_1022053	Not Available	768
3300015303|Ga0182123_1052037	Not Available	607
3300015304|Ga0182112_1015241	Not Available	881
3300015304|Ga0182112_1074515	Not Available	561
3300015305|Ga0182158_1088348	Not Available	530
3300015305|Ga0182158_1088650	Not Available	529
3300015307|Ga0182144_1079591	Not Available	554
3300015307|Ga0182144_1086168	Not Available	541
3300015314|Ga0182140_1043882	Not Available	676
3300015321|Ga0182127_1046013	Not Available	686
3300015322|Ga0182110_1011111	Not Available	1027
3300015322|Ga0182110_1106570	Not Available	528
3300015323|Ga0182129_1079983	Not Available	564
3300015323|Ga0182129_1103407	Not Available	521
3300015341|Ga0182187_1024517	Not Available	1030
3300015341|Ga0182187_1133847	Not Available	583
3300015343|Ga0182155_1060229	Not Available	805
3300015343|Ga0182155_1222143	Not Available	504
3300015346|Ga0182139_1198755	Not Available	546
3300015347|Ga0182177_1118329	Not Available	668
3300015347|Ga0182177_1210377	Not Available	537
3300015351|Ga0182161_1200261	Not Available	565
3300015351|Ga0182161_1216076	Not Available	548
3300015351|Ga0182161_1261303	Not Available	507
3300015361|Ga0182145_1072510	Not Available	700
3300015361|Ga0182145_1163550	Not Available	533
3300017407|Ga0182220_1003420	Not Available	1273
3300017409|Ga0182204_1002435	Not Available	1553
3300017410|Ga0182207_1004414	Not Available	1543
3300017410|Ga0182207_1086555	Not Available	640
3300017410|Ga0182207_1157749	Not Available	522
3300017411|Ga0182208_1009591	Not Available	1087
3300017411|Ga0182208_1019607	Not Available	885
3300017413|Ga0182222_1024647	Not Available	736
3300017413|Ga0182222_1030687	Not Available	697
3300017415|Ga0182202_1007154	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1234
3300017417|Ga0182230_1071353	Not Available	621
3300017420|Ga0182228_1018157	Not Available	1078
3300017420|Ga0182228_1033628	Not Available	836
3300017420|Ga0182228_1073914	Not Available	616
3300017427|Ga0182190_1004834	Not Available	1565
3300017430|Ga0182192_1094519	Not Available	621
3300017433|Ga0182206_1156757	Not Available	505
3300017436|Ga0182209_1138584	Not Available	542
3300017438|Ga0182191_1102459	Not Available	612
3300017443|Ga0182193_1079894	Not Available	685
3300017443|Ga0182193_1093851	Not Available	650
3300017680|Ga0182233_1025282	Not Available	1054
3300017680|Ga0182233_1051925	Not Available	724
3300017683|Ga0182218_1044845	Not Available	732
3300017684|Ga0182225_1135287	Not Available	513
3300017685|Ga0182227_1086385	Not Available	596
3300017686|Ga0182205_1147174	Not Available	529
3300017690|Ga0182223_1003009	Not Available	1362
3300021060|Ga0182232_1039482	Not Available	796
3300021060|Ga0182232_1048403	Not Available	707
3300021060|Ga0182232_1055876	Not Available	651
3300025908|Ga0207643_10042863	Not Available	2552
3300025935|Ga0207709_11217239	Not Available	621
3300025938|Ga0207704_10525902	Not Available	957
3300026089|Ga0207648_10335858	Not Available	1360
3300026089|Ga0207648_10411216	Not Available	1227

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	99.07%
Environmental	Environmental	0.93%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	99.07%
Terrestrial	Environmental → Terrestrial	0.93%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	80.37%
Rhizoplane	Host-Associated → Plants → Rhizoplane	9.35%
Rhizosphere	Host-Associated → Plants → Rhizosphere	7.48%
Roots	Host-Associated → Plants → Roots	1.87%
Soil	Environmental → Terrestrial → Soil	0.93%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	80.37%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	9.35%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.54%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.87%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	0.93%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.93%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	80.37%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	9.35%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.54%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.87%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.93%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.93%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	77.57%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	8.41%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.74%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.80%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	2.80%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	1.87%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.93%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300003319	Sugarcane bulk soil Sample L2	Environmental
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
soilL2_101131013	3300003319	Sugarcane Root And Bulk Soil	MKKMILLEEANHAIELVDLHMTVGLELLDETTGQENNKEEE*
Ga0068869_1003077623	3300005334	Miscanthus Rhizosphere	MKKMILLEKDNHAIGLDDLHMTVGLEILDETAGPENNRGG*
Ga0068869_1009204262	3300005334	Miscanthus Rhizosphere	MKKMILLEEANHAIELVDLHMTVGLEILDETTGQENKKKNEGILAG*
Ga0070675_1021722581	3300005354	Miscanthus Rhizosphere	LKKMILLEKANHAIELVDLHMTVGLEILDETTGQENNRGG*
Ga0068867_1002410383	3300005459	Miscanthus Rhizosphere	MKKMILLEEANHAIELADLHMTVGLELLDETASQENKKKNEGILTG*
Ga0068861_1010641142	3300005719	Switchgrass Rhizosphere	MKKMILLEEANHVIELVDLHMTVGLELLDETASQENKKKNEGILTC*
Ga0068870_114046631	3300005840	Miscanthus Rhizosphere	MKKMILLEEANHAIELVDLHMTVGLEILDETTGQENNREGG*
Ga0097621_1006595453	3300006237	Miscanthus Rhizosphere	MKKMILLEKDNHAIGLDDLHMTVGLEILDETAGQENNREGG*
Ga0097621_1007501351	3300006237	Miscanthus Rhizosphere	MKKMILLEEANHAIELVDLHMTVGLELLDETASQENKKKNEGILTC*
Ga0068865_1003830871	3300006881	Miscanthus Rhizosphere	MKKMILLEEANHAIELVDLHMTVGLELLDETVGQENNREG*
Ga0105243_107887241	3300009148	Miscanthus Rhizosphere	MKKMILLEEANHAIELADLHMTVGLELLDETASQENNKEEE*
Ga0105246_123986172	3300011119	Miscanthus Rhizosphere	MKKMILLEEDNHAIGLVDLHMTVGLEILDETAGQENNREGG*
Ga0157378_108641061	3300013297	Miscanthus Rhizosphere	MKKMILLEKDNHAIGLDDLHMTVGLEILDETAGQENNKEEE*
Ga0157378_109913091	3300013297	Miscanthus Rhizosphere	MKKMILLEEANHAIELADLHMTVGLELLDETASQENKKKNEGILTC*
Ga0157378_124272611	3300013297	Miscanthus Rhizosphere	MKKMILLEEDNHAIELVDLHMTVGLELLYETASQENKKKNEGILTG*
Ga0157377_102405272	3300014745	Miscanthus Rhizosphere	MILLEKANHAIELVDLHMAVGVEIMDETAGQENNREGG*
Ga0182154_10069341	3300015268	Miscanthus Phyllosphere	MKKMILLEEANHAIELVDLHMTVGLELLDETAGQENNKEEE*
Ga0182113_10020151	3300015269	Miscanthus Phyllosphere	MKKMILLEEANHAIELVDLHMTVGLELLDETASQENNKEEE*
Ga0182113_10387321	3300015269	Miscanthus Phyllosphere	MILLEEANHAIGLVDRNMTVGLEILDETVGQENNGEGE*
Ga0182172_10009551	3300015275	Miscanthus Phyllosphere	MILLEKANHAIELVDLHMAVGLEIMDETAGQGNNGEGE*
Ga0182172_10748281	3300015275	Miscanthus Phyllosphere	MILLEKANHAIELVDLYMTVGLEIMDETAGQENNREGG*
Ga0182170_10048992	3300015276	Miscanthus Phyllosphere	ILLEEANHAIELVDLHMTVGLELLDETAGQENNKEEE*
Ga0182170_10576411	3300015276	Miscanthus Phyllosphere	MILLEEANHTIELVDQHVTVSLEILDGTVGQGNNREG
Ga0182170_10730421	3300015276	Miscanthus Phyllosphere	MSSRGEEMILLEEVNHAIELVDLRLAVGLEIMDETVGQGNNREEEGGDFCR
Ga0182174_10816731	3300015279	Miscanthus Phyllosphere	MILLEKDDHAIGLVDLHMTVGLELLDETVGQENNRD*
Ga0182156_10155731	3300015283	Miscanthus Phyllosphere	LKKIILLEKDNHAIGLVDLHMTVGLEILDETTGQENNREGG*
Ga0182156_10747311	3300015283	Miscanthus Phyllosphere	MILLEKDNHAIGLVDLHMTVGLELLDETVGQENNREGG*
Ga0182186_10411291	3300015285	Miscanthus Phyllosphere	MILLEKANHAIELVELDMAVGLEIMDETAGQGNKGEGE*
Ga0182186_10794601	3300015285	Miscanthus Phyllosphere	MKKMILLEEANHAIKLVDLQMDVGLEILDETVGQGNNGEGE*
Ga0182176_10595511	3300015286	Miscanthus Phyllosphere	MILLEEANHAIELVDLHLAVGLEIMDETAGQGNNGEGEG
Ga0182171_10413961	3300015287	Miscanthus Phyllosphere	EMKKMILLEKDNHAIGLVDLHMTVGLEILDETAGQENNREGG*
Ga0182171_10859761	3300015287	Miscanthus Phyllosphere	MSSRGEETILLEEANHAIELIDLHMAVGLEILDETAGQE
Ga0182173_10229101	3300015288	Miscanthus Phyllosphere	MSSRDEEMRLLEEANHAIGLVDLHMAVDLEIMDETTGQGNNGEGE*
Ga0182138_10187541	3300015289	Miscanthus Phyllosphere	MKKMILLEMDNHAIGLDDLHMTVGLEILDETAGPENNRGG*
Ga0182125_10074381	3300015291	Miscanthus Phyllosphere	MKKMILLEKDNHAIGLVDLHMAVDLEIMDETMGQGNNGEGE*
Ga0182141_10042521	3300015292	Miscanthus Phyllosphere	MILLEKANHAIELVDLHMAVGLEIMDETAGQENNREGG*
Ga0182126_10094551	3300015294	Miscanthus Phyllosphere	MKKMILLEKDNHAIGLDDLHMTVGLEILDETVGQENNK*
Ga0182126_10151762	3300015294	Miscanthus Phyllosphere	ALEMKKMILLEEANHAIELVDLHMTVGLELLDETAGQENNKEEE*
Ga0182126_10166381	3300015294	Miscanthus Phyllosphere	MKKMILLEKDNHAIGLDDLHMTVGLEIQDETAGPENNREGG*
Ga0182126_10261422	3300015294	Miscanthus Phyllosphere	MKKMILLKEANHAIELVDLYMAVGLEIMDETAGQENNREGG*
Ga0182157_10078841	3300015296	Miscanthus Phyllosphere	MKKTILLEEDNHAIGLVDLHMTVGLELLDETASQENKKKNEGILTG*
Ga0182107_10436301	3300015299	Miscanthus Phyllosphere	MKKMILLEKDNHAIGLVDLHMTVGLEILDETTGQENNREGG*
Ga0182143_10171801	3300015302	Miscanthus Phyllosphere	KTILLEEANHAIELVDLHMTVGLELLDETASQENKKKNEGILTV*
Ga0182143_11017651	3300015302	Miscanthus Phyllosphere	MKKMILLEEANHGIELVDLHMTVGLEILDETTGQENKKNNEGVLAG*
Ga0182123_10220531	3300015303	Miscanthus Phyllosphere	MILLEKDNHAIGLVDLHMTVGLEILDETAGQENNREGG*
Ga0182123_10520371	3300015303	Miscanthus Phyllosphere	MILLEEANHAIGLVDQHVTVSLEILDETVGQGNNGEGE*
Ga0182112_10152411	3300015304	Miscanthus Phyllosphere	LLEKANHAIELVDLHMAVGLEMLDETAGQGNNGEGE*
Ga0182112_10745152	3300015304	Miscanthus Phyllosphere	MILLEEANHAIELVDQHVTVSLEILDGTMGQRNNREGG*
Ga0182158_10883481	3300015305	Miscanthus Phyllosphere	KMILLEKDNHAIGLVDLHMTVGLEILDETAGQENNREGG*
Ga0182158_10886501	3300015305	Miscanthus Phyllosphere	MILLEKANHAIELVDLHMAVGLEIMDETAGQENNREGDEEIFVG*
Ga0182144_10795911	3300015307	Miscanthus Phyllosphere	MKKMILLEEANHAIELVDLHMAVDLEIMDETAGQGNNGEGE*
Ga0182144_10861681	3300015307	Miscanthus Phyllosphere	MSSRDEEMILLEEANHAIGLVDLHMTVGLEIMDETAGQENNREGE*
Ga0182140_10438821	3300015314	Miscanthus Phyllosphere	MSSRDEEMRLLEEANHAIGLVDLHMAVDLEIMDETMGQGNNREGG*
Ga0182127_10460131	3300015321	Miscanthus Phyllosphere	MKKMILLEKDNHAIGLVDLHMTVGLEILDETTSQENNREGG*
Ga0182110_10111111	3300015322	Miscanthus Phyllosphere	MKKIILLEEANHVIELVDLHMTVGLELLDETAGQENNKEEE*
Ga0182110_11065701	3300015322	Miscanthus Phyllosphere	MKKMILLEKANHAIELVDLHMAVGLEIMDETAGQENNREGG*
Ga0182129_10799831	3300015323	Miscanthus Phyllosphere	MILLEKANHAIELVDLHMAVDLEIMDEIVGQENNREG*
Ga0182129_11034071	3300015323	Miscanthus Phyllosphere	KMILLEEANHAIELVDLHMTVGLELLDETVSQENKKKNEGILAG*
Ga0182187_10245171	3300015341	Miscanthus Phyllosphere	KMILLEKDNHAIGLDDLHMTVGLEILDETAGPENNRGG*
Ga0182187_11338471	3300015341	Miscanthus Phyllosphere	MKKMILLEEANHVIELVDLHMTVGLELLDETVGQENNKEEE*
Ga0182155_10602292	3300015343	Miscanthus Phyllosphere	ALELKKMILLEKANHAIELVDLHMAVGLEIMDETAGQENNREGG*
Ga0182155_12221431	3300015343	Miscanthus Phyllosphere	MKKIILLEETNHTIRLVDLHMAVGLEILDETAGQGNNGEGK*
Ga0182139_11987551	3300015346	Miscanthus Phyllosphere	MSSKDKEMILLEEANHAIELVDLHLAVGLEIMDETAGQGNNGEGE*
Ga0182177_11183291	3300015347	Miscanthus Phyllosphere	LRKIILLEKANHAIEPVDLHMAVGLEILDETAGQGNNGEGE*
Ga0182177_12103771	3300015347	Miscanthus Phyllosphere	LLEEANHAIELVDLHMTVGLELLDETAGQENNKEEE*
Ga0182161_12002611	3300015351	Miscanthus Phyllosphere	KKMILLEEANHVIELVDLHMTVGLELLDETVGQENNKEEE*
Ga0182161_12160761	3300015351	Miscanthus Phyllosphere	MILLEKANHAIELVDLHMAVGVEIMDETAGQGNNREGG*
Ga0182161_12613032	3300015351	Miscanthus Phyllosphere	MILLEKANHAIELVDLHMAVGLEILDETAGQGNNGEGE*
Ga0182145_10725101	3300015361	Miscanthus Phyllosphere	LEMKKMILLEKDNHAIGLDDLHMTVGLEILDETAGPENNRGG*
Ga0182145_11635501	3300015361	Miscanthus Phyllosphere	MSSRDEEMILLEEANHAIGLVDLHMAVDLEIMDETAGQGNNGEGE*
Ga0182220_10034203	3300017407	Miscanthus Phyllosphere	MKKMILLEEANHVIELVDLHMTVGLELLDETAGQENNKEEE
Ga0182204_10024353	3300017409	Miscanthus Phyllosphere	MKKMILLEKANHAIELVDLHMAVGLEILDETAGQENNKEEE
Ga0182207_10044141	3300017410	Miscanthus Phyllosphere	MKKMILLEEANHVIELVDLHMTVGLELLDETVGQENNKEEE
Ga0182207_10865551	3300017410	Miscanthus Phyllosphere	MILLEKDNHAIGLVDLHMTVGLEILDETAGQENNREGG
Ga0182207_11577491	3300017410	Miscanthus Phyllosphere	MSSREKKMILLEEANHAIKLVDQHVTVSLEILDGTAGQRNNREG
Ga0182208_10095911	3300017411	Miscanthus Phyllosphere	MKKMILLEKANHAIELVDLHMAVGLEILDETMSQGNNGEGE
Ga0182208_10196071	3300017411	Miscanthus Phyllosphere	MKKMILLEEANHAIELVGLHMAVGLEIMDETAGQGNNGEGK
Ga0182222_10246471	3300017413	Miscanthus Phyllosphere	MSFKGEEMILLEEANHAIRLVDLHMAVGLEILDETAGQENNGEGE
Ga0182222_10306871	3300017413	Miscanthus Phyllosphere	MKKMILLEKDNHAIGLDDLHMTVGLEIQDETAGPENNREGG
Ga0182202_10071541	3300017415	Miscanthus Phyllosphere	MKKIILLEEANHVIELVDLHMTVGLELLDETAGQENNKEEE
Ga0182230_10713531	3300017417	Miscanthus Phyllosphere	LEEANHAIELVDLHMTVGLEFLDETAGQKNNREGG
Ga0182228_10181573	3300017420	Miscanthus Phyllosphere	MKKMILLEEANHAIELVDLHMTVGLELLDETASQENKKKNEGILTG
Ga0182228_10336281	3300017420	Miscanthus Phyllosphere	MKKMILLEEANHAIGLVDLHMTVGLEILDETAGPENNRGG
Ga0182228_10739142	3300017420	Miscanthus Phyllosphere	MKKMILLEKDNHAIGLVDLHMAVDLEILDETAGQENNREGG
Ga0182190_10048341	3300017427	Miscanthus Phyllosphere	MKKTILLEEANHAIELVDLHMTVGLELLDETASQENKKKNEGILTG
Ga0182192_10945192	3300017430	Miscanthus Phyllosphere	MKKMILLEEANHAIELVDLHMVVGLEILDETTGQENNREGG
Ga0182206_11567571	3300017433	Miscanthus Phyllosphere	MILLEKANHAIELVDLHMAVGLEIMDETAGQGNKGEGE
Ga0182209_11385841	3300017436	Miscanthus Phyllosphere	MILLEKANHAIELVELDMAVGLEIMDETAGQGNNGEGK
Ga0182191_11024592	3300017438	Miscanthus Phyllosphere	MILLEKANHAIELVDLHMAVGVEIMDETAGQENNREGG
Ga0182193_10798941	3300017443	Miscanthus Phyllosphere	MKKMILLEKDNHAIGLDDLHMIVGLEILDETAGPENNRGG
Ga0182193_10827681	3300017443	Miscanthus Phyllosphere	FKXALEMKKMILLEEANHAIELADLHMTVGLELLDETASQENKKKNEGILTC
Ga0182193_10938512	3300017443	Miscanthus Phyllosphere	LLEKANHAIELVDLHMAVGVEIMDETAGQENNREGG
Ga0182233_10252821	3300017680	Miscanthus Phyllosphere	MKKMILLDEANHTNELVDLHMTVGLELLDETAGQENNKEEE
Ga0182233_10519252	3300017680	Miscanthus Phyllosphere	MKKMILLEEANHAIELVDLHMVVGLEILDETVGQENNREGG
Ga0182218_10448451	3300017683	Miscanthus Phyllosphere	ILLEKDNHAIGLDDLHMTVGLEILDETAGPENNREGG
Ga0182225_11352872	3300017684	Miscanthus Phyllosphere	MKKMILLEEANHAIELVDLHMTVGLEILDEIVGQENNKEEE
Ga0182227_10863851	3300017685	Miscanthus Phyllosphere	MKKMILLEKDNHAIGLVDLHMTVGLEILDETAGQENNREGG
Ga0182205_11471741	3300017686	Miscanthus Phyllosphere	LEMKKMILLEEANHAIELVDLHMTVGLELLDETAGQENNKEEE
Ga0182223_10030091	3300017690	Miscanthus Phyllosphere	MKKMILLEEANHAIELVDLHMTVGLELLDETTGQENNKEEE
Ga0182232_10394821	3300021060	Phyllosphere	ALEMKKMILLEEANHVIELVDLHMTVGLELLDETAGQENNKEEE
Ga0182232_10484033	3300021060	Phyllosphere	MKKMILLEEANHAIELVDLHMTVGLELLDETASQENNKEEE
Ga0182232_10558761	3300021060	Phyllosphere	MKKMILLEEANHAIELADLHMTVGLELLDETASQENKKKNEGILTC
Ga0207643_100428632	3300025908	Miscanthus Rhizosphere	MKKMILLEKDNHAIGLDDLHMTVGLEILDETAGPENNRGG
Ga0207709_112172391	3300025935	Miscanthus Rhizosphere	MKKMILLEEANHAIELVDLHMTVGLEILDETAGQENNREGG
Ga0207704_105259021	3300025938	Miscanthus Rhizosphere	MKKMILLEEANHAIELVDLHMTVGLELLDETVGQENNREG
Ga0207648_103358581	3300026089	Miscanthus Rhizosphere	MKKMILLEKDNHAIGLDDLHMTVGLEILDETTGQENNREGG
Ga0207648_104112163	3300026089	Miscanthus Rhizosphere	KMILLEEANHAIELVDLHMTVGLELLDETASQENNKEEE