| Basic Information | |
|---|---|
| Family ID | F092246 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MLASASALEFEKLVEEDLGSVSASVGDLIAADSRDMAIKSWDFGPSSITEEAV |
| Number of Associated Samples | 62 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 98.00 % |
| % of genes near scaffold ends (potentially truncated) | 87.85 % |
| % of genes from short scaffolds (< 2000 bps) | 93.46 % |
| Associated GOLD sequencing projects | 62 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (98.131 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (95.327 % of family members) |
| Environment Ontology (ENVO) | Unclassified (95.327 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (95.327 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.68% β-sheet: 0.00% Coil/Unstructured: 54.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF04195 | Transposase_28 | 1.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 98.13 % |
| All Organisms | root | All Organisms | 1.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 95.33% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017689 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0068869_1012543221 | 3300005334 | Miscanthus Rhizosphere | MLASASTLELEKLLEEDLGSVSVSVGDLIATDSGDMAIKSWDFGPSSITEE |
| Ga0097621_1012659181 | 3300006237 | Miscanthus Rhizosphere | MLASASALELEKLVEEDLGCVSASIGDLVAADSGDMVIKSWDFGPSSITEEAI |
| Ga0105244_104070491 | 3300009036 | Miscanthus Rhizosphere | MLASASALEFEKLVEEDLGSISAFVGDLITVDSRDMAIKYWDF |
| Ga0157374_121996881 | 3300013296 | Miscanthus Rhizosphere | MLASASSLELEKLVEEDLGSVSASIGDLVAVDSGDMAIKSWDFSSSSITEEAITEMLKESCF |
| Ga0182154_10472071 | 3300015268 | Miscanthus Phyllosphere | MLASASVLELEKLVEEDLGSVSASIGDLIAVDPGDMAIKSWDFGPSSITEDAI |
| Ga0182154_10604091 | 3300015268 | Miscanthus Phyllosphere | MVASASALEFEKLVEEDLGSVSVSVDDLVAADSGDMAIKSWDFGPSSITEE |
| Ga0182113_10278811 | 3300015269 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSASVGDLIAADSRDMAI |
| Ga0182113_10796301 | 3300015269 | Miscanthus Phyllosphere | MLASASAFEFEKLVEEDLGSVSTSVGDLIAVDSRDMAIKSWDFDPSSIT |
| Ga0182188_10606251 | 3300015274 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSTSVGAQIAADSRDMAIKSWDFSPSSIT |
| Ga0182172_10635251 | 3300015275 | Miscanthus Phyllosphere | MLASASALEFEKLLEEDLGSVSASVGDLIATDSGDMAIKSWDFGPSSII |
| Ga0182170_10154421 | 3300015276 | Miscanthus Phyllosphere | MLASASTLEFEKLVEEDLGSVSASVGDLIAADSRD |
| Ga0182128_10072461 | 3300015277 | Miscanthus Phyllosphere | MLASASVLEFEKLVEEDLGSVSASVGDLIAADSRDMAIKSWD |
| Ga0182174_10310521 | 3300015279 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSAFVGDLIAADSRDMAIKSWDFGPSSITEEAVAEM |
| Ga0182160_10019732 | 3300015281 | Miscanthus Phyllosphere | MLASASALDFENLLEEDLGSVSASVGDLIAADSGDMAIKSWDFGPSSITE* |
| Ga0182124_10155871 | 3300015282 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSASVGDLIAADSRDMAIKS* |
| Ga0182124_10237981 | 3300015282 | Miscanthus Phyllosphere | MLASASALEFEKLLEEDLGSVSASVGDLIAVDSRVMAIKSW |
| Ga0182124_10245641 | 3300015282 | Miscanthus Phyllosphere | MLASASALDLEKLVEEDLGSVSASVEDLIAADSRDMAIKSWDFGPSS |
| Ga0182156_10499222 | 3300015283 | Miscanthus Phyllosphere | MLASASALELEKLLEEDLGSVSASVRDLIAVDSGDMAIKSWDFGPSAITEDS |
| Ga0182186_10643761 | 3300015285 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSTSIGDLIAADSRAMAIKSWDL |
| Ga0182171_10563721 | 3300015287 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSASVGDLIVVDSGDMAIRSWDFGPFSITDEAVTELL* |
| Ga0182138_10217382 | 3300015289 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSVSVGDLIIVDSGVMAI |
| Ga0182125_10046601 | 3300015291 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSTSVGDLIAADSIDMAIKSWDSGPSSITEEAIAE |
| Ga0182125_10696731 | 3300015291 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSASVGDLIAADSRDMAIKSWDFGPSSITEEAV |
| Ga0182141_10249961 | 3300015292 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSASIGDLIATDSGDMAIKSWDFGPSSITEE |
| Ga0182126_10086681 | 3300015294 | Miscanthus Phyllosphere | MLASASALDFENLLEEDLGSVSASVGDLIAADSGDMAIKSWDFGPSSIT |
| Ga0182126_10569641 | 3300015294 | Miscanthus Phyllosphere | MLASASALELEKLVEEDLGSVSASIGDLIVVDSEDMAIKSWDFGPSSITEEAIAEMLKE |
| Ga0182175_10895561 | 3300015295 | Miscanthus Phyllosphere | MLASASALELEKLVEEDLGSVSASIGDLIVVDSGDMAIK |
| Ga0182157_10103891 | 3300015296 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSASIRDLITADSRDMAVKSWDFGPSSITEEAIAE |
| Ga0182157_10264131 | 3300015296 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSASVGDLIGADSRDMAIKSW |
| Ga0182106_10714422 | 3300015298 | Miscanthus Phyllosphere | MLASASALEFEKLLEEDLGSVSASVGDLITVDSGVMAIKSWDFGPSSITEEAVAEMLKE |
| Ga0182107_10163041 | 3300015299 | Miscanthus Phyllosphere | MVASASALEFEKLVEEDLGSVSASVGDLIATDPRDMPTKSWD |
| Ga0182108_10721251 | 3300015300 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSASVRDLIAADSRDMAIKSWDFGPSSITEEAVAEMLKES |
| Ga0182143_11028141 | 3300015302 | Miscanthus Phyllosphere | MVASTSALEFEKLVEEDLGSVSASVGDLVAVDSGDMAIKSWDFGPSAITEDSVTEMLKES |
| Ga0182123_10117141 | 3300015303 | Miscanthus Phyllosphere | MLASASALDFENLLEEDLGSVSTSVGDLIAADSGDMAIKSWDFGPSSITEEVVAEMSKES |
| Ga0182123_10924781 | 3300015303 | Miscanthus Phyllosphere | MLASASALELEKLVEEDLGSVSASIGDLVAADFGDMAIKSWDFGPSSI |
| Ga0182158_10302311 | 3300015305 | Miscanthus Phyllosphere | MVASASTLEFEKLVEEDLGSVSASIGDLIAADPGDMA |
| Ga0182158_10459511 | 3300015305 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSASVGDLIAMDSRDMAIKSWDFG |
| Ga0182144_10182361 | 3300015307 | Miscanthus Phyllosphere | SAFALEFEKPLEEDLRSVSAFVGDLIAADSGDMAIKSWDFGPSSITEEAIAEM* |
| Ga0182142_10200201 | 3300015308 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSVSVGDLIVVDSRD |
| Ga0182127_10896231 | 3300015321 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSASVGDLIAAESRDMAIKSWDFGPSSITEEAIAEMLKE |
| Ga0182110_10178371 | 3300015322 | Miscanthus Phyllosphere | MLASASALELEKLVEEDLGSVSASIGDLIAADFGDMAIKSWDFGPSSITEEAIAEM |
| Ga0182129_10234471 | 3300015323 | Miscanthus Phyllosphere | MVASASALEFEKLVEEDLGSVSASVGDLVAADFGDMAIKSWDFGPSSITEEAV |
| Ga0182187_10556651 | 3300015341 | Miscanthus Phyllosphere | MLVSASTLEFEKLVEEDLGSVSASVEDLIAVDSGVM |
| Ga0182187_10771551 | 3300015341 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSASIGDLIAADSRDMAIKSWDFGPSSITEEAVAEMV |
| Ga0182187_11918051 | 3300015341 | Miscanthus Phyllosphere | MLASASALEFEKLLEEDLGSVSASVGDLIAVDSRV |
| Ga0182109_10822671 | 3300015342 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSASIGDLFAMDSRDMAIKSWDFGPSSITEEAVMEM |
| Ga0182109_11488502 | 3300015342 | Miscanthus Phyllosphere | MLASASAMEFEKLVEEDLGSVSASVGDLIAADSRDMAIKSWDFG |
| Ga0182155_10639751 | 3300015343 | Miscanthus Phyllosphere | MLASTSALDFENLLEEDLGSVSASVGDLIAADSGDMAIKSWDFGPSSITKEAV |
| Ga0182155_12236211 | 3300015343 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSASIGDLIAVDSRDMAIKSWDFSPS |
| Ga0182189_11591921 | 3300015344 | Miscanthus Phyllosphere | MLASASALELEKLVEEDLGSVSASIGDLVAVDSGDMAIKSWDFGPSSITDEAITEMLKE |
| Ga0182111_11727831 | 3300015345 | Miscanthus Phyllosphere | MLASASALEFENLVEEDLGSVSASVGDLITADSRDMAIKSWD |
| Ga0182111_12317631 | 3300015345 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSASVGDLIAADSRDM |
| Ga0182139_10539751 | 3300015346 | Miscanthus Phyllosphere | MLASASALDFENLLEEDLGSVSASVGDLIAADSGDMAIKSWDFGPSSITEEAV |
| Ga0182139_11774821 | 3300015346 | Miscanthus Phyllosphere | MIASASALEFEKLVEEDLGSVSASVGDLVAADSGDMAIKSWDFRPSSITEEAV |
| Ga0182139_12269281 | 3300015346 | Miscanthus Phyllosphere | MLASASALEFERLLEEDLGSVSASVGDLITADSRDMAIKSWDFGPSSIIKGAVVEMLK |
| Ga0182177_10520961 | 3300015347 | Miscanthus Phyllosphere | MLASASALEFEKLLEEDLGSVSASIGDLIAADSGDMAIK |
| Ga0182177_10557112 | 3300015347 | Miscanthus Phyllosphere | VRFEECMVASASALEFEKLAEEDLGSVSVSVGDLIAADPRDMAIKSWDFGPSS |
| Ga0182177_12441981 | 3300015347 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSESVGDLIATDSRDMVIKSWDFGPSSITEDAI |
| Ga0182161_11324951 | 3300015351 | Miscanthus Phyllosphere | MLASASALEFEKLMEEDLGSVFASIGDLIAADSRDMVIKSWDFG |
| Ga0182161_11783661 | 3300015351 | Miscanthus Phyllosphere | MLASASALELEKLLEEDLGSVSASVRDLIAVDSGDMAIKSWDFGPSTITEVSVVEMLKESYFPS |
| Ga0182161_12132511 | 3300015351 | Miscanthus Phyllosphere | MLASTSALEFEKLVEEDLGSVSASVGDLIAADSRDMAIKSWDFGPSSITEEAI |
| Ga0182161_12195541 | 3300015351 | Miscanthus Phyllosphere | MLASASALELEKLVEEDLGSVSASIGDLVTADSGDMAIKSWDFCPSSITEEAIMEMLK |
| Ga0182161_12399571 | 3300015351 | Miscanthus Phyllosphere | MLASASALEFENLVEEDLGSVSASVGDLITADSRDMAIKSWDFGPSSIT |
| Ga0182159_12254171 | 3300015355 | Miscanthus Phyllosphere | MRASASVLEFEKLVEEDLGSVSAFVGDLVAVDSGVMA |
| Ga0182159_12400261 | 3300015355 | Miscanthus Phyllosphere | MLASVSALEFERLVEEDLGSVSTSVEDLITADSRHMAIKSWDLGPSSITKEAIAEMLK |
| Ga0182159_12480181 | 3300015355 | Miscanthus Phyllosphere | MVASASALEFEKLVEEDLGSVSASIGDLIAADPGDMAIKSWDFGPSSI |
| Ga0182159_12627551 | 3300015355 | Miscanthus Phyllosphere | MLASASALEFEKLVDEDLGSVSASVGDLITVDSRDMAIKSWDFGPSSITEEAV |
| Ga0182159_13410001 | 3300015355 | Miscanthus Phyllosphere | MLASASALELEKVVEEDLGSVSASIGDLIAADPGEMAIKSWDFGPSS |
| Ga0182145_11237691 | 3300015361 | Miscanthus Phyllosphere | MLASTSALELEKLVEEDLGSVSASVGDLVAADSIDMAIKSWEFGPSSITEE |
| Ga0182203_10037931 | 3300017404 | Miscanthus Phyllosphere | MLASASALDFENLLEEDLGSVSASVGDLIAVDSGDMAIKSWDFGPSSITEEAVTEMSK |
| Ga0182203_10364701 | 3300017404 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGGGSASVGYLITVDSRDMAIKSGDFGPSSITE |
| Ga0182207_10229601 | 3300017410 | Miscanthus Phyllosphere | MLASASTLEFEKLVEEDLGSVSASVGDLIAMDSRVMAIKSWDFGLSSIVAEAVAEM |
| Ga0182207_10909751 | 3300017410 | Miscanthus Phyllosphere | MLASASALELEKLVEEDLGSVSASIGDLIVVDSGDMAIKFWD |
| Ga0182207_10923991 | 3300017410 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSTFVGDLIAADSRD |
| Ga0182222_10961821 | 3300017413 | Miscanthus Phyllosphere | MLASASALELEKLVEEDLGSVSASIGDLIVADSGDMAIKSW |
| Ga0182222_11046801 | 3300017413 | Miscanthus Phyllosphere | MLASASPLVFEKPVEEDLGSVSASVGDLITADSRDMAIKSWDFGPSSITEEAVAE |
| Ga0182202_10514152 | 3300017415 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSASIGDLIATDSRDMAIKSWDFGPSSITEEAIAEMLKE |
| Ga0182202_10949162 | 3300017415 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSASVGDLIAVDSRDMAIKSWDFGPSSITEESITEMLK |
| Ga0182202_11219151 | 3300017415 | Miscanthus Phyllosphere | MLASASALEFEKLLEEDLGSVSASVGDLIAVDSRVMAIKSWDFGPSSITEEAVV |
| Ga0182219_10755341 | 3300017424 | Miscanthus Phyllosphere | MLASASALEFEKLLEEDLGSVSVSVGDLIAVDSRVM |
| Ga0182219_11082781 | 3300017424 | Miscanthus Phyllosphere | MVASASALEFEKLVEEDLGSVSASVGDLITVDSRDTAIKSWDFGPSSITKEAIV |
| Ga0182219_11359011 | 3300017424 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSASVGDLIAADSRDMAIKS |
| Ga0182224_11220282 | 3300017425 | Miscanthus Phyllosphere | LDFENLLEEDLGSVSASVGDLIAADSGDMAIKSWDFGPSSITEEAV |
| Ga0182190_10332481 | 3300017427 | Miscanthus Phyllosphere | MIASASTLEFEKLVEEDLGSVSASVGDLVTADSGDMAIKSWDFG |
| Ga0182192_10911841 | 3300017430 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGNVSASVGDLIAADSRD |
| Ga0182192_11381781 | 3300017430 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSASVEDLIVVDSRDMAIKSWDFGP |
| Ga0182192_11420251 | 3300017430 | Miscanthus Phyllosphere | MLASASALEFEKLLEEDLGSVSASVGDLIAADPGAMAIKS |
| Ga0182206_10479611 | 3300017433 | Miscanthus Phyllosphere | MLASASTLELEKLLEEDLGSVSVSVGDLIATDSGDMAIKSWDFGPSSITEEAVAEMLKESYFP |
| Ga0182206_10651691 | 3300017433 | Miscanthus Phyllosphere | MLASASTLEFEKLVEEDLGSVSASIGDLIAADFGDMAIKSWDFGPSSITEEAIAEMLKESCFPS |
| Ga0182206_11220512 | 3300017433 | Miscanthus Phyllosphere | MLASASVLEFEKLVEEDLGSVSASVGDLIAVDSRDMAIKTWRLKRRS |
| Ga0182209_10463161 | 3300017436 | Miscanthus Phyllosphere | MLASASALEFERLVEEDLGSVSASVGDLIAADSRDMAIK |
| Ga0182209_11226901 | 3300017436 | Miscanthus Phyllosphere | MLASASALEFEKLLEEDLGSVSASVGDLIAVDSGDMAIKSWDFGPSAITKEAIV |
| Ga0182191_10848151 | 3300017438 | Miscanthus Phyllosphere | MLSSASALEFEKLVEEDLGSVSVSVGDLIAVDSRVMAIKSWDFG |
| Ga0182191_10867901 | 3300017438 | Miscanthus Phyllosphere | MLASASVLDFENLLEEDLGSVSASVGDLITADSGDMAIKSWDFGPSSITKEAVT |
| Ga0182191_11409551 | 3300017438 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSVSVGDLIAADSRDMVIKSWDFGPSSIT |
| Ga0182221_10277731 | 3300017442 | Miscanthus Phyllosphere | MLASASVLDFENLLEEDLGSVSASVEDLIAADSGDMVIKSWDFGPSSITEE |
| Ga0182221_11538351 | 3300017442 | Miscanthus Phyllosphere | MLASASALELEKLVEEDLGSVSTSIGDLVAADSGDMVIKSWDFGPSSITEEA |
| Ga0182193_10787102 | 3300017443 | Miscanthus Phyllosphere | MLASASALEFEKLMEEDLGSVFASIGDLIAADSRDMVIKSWD |
| Ga0182193_10845892 | 3300017443 | Miscanthus Phyllosphere | MLASASALEFEKLLEEDLGSVSASVRDLIAVDSRDMAIKSWDFGPSSITEEAVAEMLKESYFP |
| Ga0182193_11927251 | 3300017443 | Miscanthus Phyllosphere | MLASASVLEFEKLVEEDLGSVSVSVGDLIAADSRDMAIK |
| Ga0182233_11107861 | 3300017680 | Miscanthus Phyllosphere | MLASASTLEFEKLVEDLGSVSASIGDLIAADSRDMVIKSWDFGPSSITEE |
| Ga0182218_10927571 | 3300017683 | Miscanthus Phyllosphere | MLASASVLELEKLVEEDLGSVSASIGDLIAADPGEMAIKSWDFGPS |
| Ga0182227_10718111 | 3300017685 | Miscanthus Phyllosphere | MLAYASALEFEKLVEEDLGSISASVGDLIAVDSRDMAIKS |
| Ga0182227_11153441 | 3300017685 | Miscanthus Phyllosphere | MLASASALEFEKLVEEDLGSVSASVGDLIAADSRDMAIKSWDFG |
| Ga0182231_10433741 | 3300017689 | Miscanthus Phyllosphere | MLASASALDFENLLEEDLGSVSASVGDLITVDSGDMAIKSWDFGPSSITEEAVVE |
| Ga0182223_10240191 | 3300017690 | Miscanthus Phyllosphere | MLASASALELEKVVEEDLGSVSASIGDLIAADPGEMA |
| Ga0207642_103486651 | 3300025899 | Miscanthus Rhizosphere | MLASVSALDFENLLEEDLGCVSASVGDLIAADSGDMAIKSWDFGPSSI |
| ⦗Top⦘ |