| Basic Information | |
|---|---|
| Family ID | F092244 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 50 residues |
| Representative Sequence | IVSVVAGESAPLKAALQGRYQYEVLGEIATPAPSQKPPTKPANNINPR |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.13 % |
| % of genes from short scaffolds (< 2000 bps) | 96.26 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.439 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.280 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.664 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (63.551 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.89% β-sheet: 2.63% Coil/Unstructured: 89.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF01209 | Ubie_methyltran | 92.52 |
| PF00528 | BPD_transp_1 | 2.80 |
| PF12911 | OppC_N | 1.87 |
| PF01135 | PCMT | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 93.46 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 92.52 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.93 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.44 % |
| Unclassified | root | N/A | 20.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c0882769 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 2228664021|ICCgaii200_c0883337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300000531|CNBas_1000630 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300000891|JGI10214J12806_10814565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300005290|Ga0065712_10383987 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300005293|Ga0065715_10016236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium | 1876 | Open in IMG/M |
| 3300005293|Ga0065715_11089477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300005294|Ga0065705_11003854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300005295|Ga0065707_10779682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300005328|Ga0070676_11150960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300005331|Ga0070670_100078512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 2836 | Open in IMG/M |
| 3300005343|Ga0070687_100713865 | Not Available | 702 | Open in IMG/M |
| 3300005364|Ga0070673_101282635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300005365|Ga0070688_100226715 | All Organisms → cellular organisms → Bacteria | 1320 | Open in IMG/M |
| 3300005438|Ga0070701_11272208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300005440|Ga0070705_100382162 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300005466|Ga0070685_10296861 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300005545|Ga0070695_100055299 | All Organisms → cellular organisms → Bacteria | 2557 | Open in IMG/M |
| 3300005549|Ga0070704_100504242 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300005549|Ga0070704_100701267 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300005577|Ga0068857_102457243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300005578|Ga0068854_101470368 | Not Available | 618 | Open in IMG/M |
| 3300005578|Ga0068854_101926522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300005616|Ga0068852_101620141 | Not Available | 670 | Open in IMG/M |
| 3300005719|Ga0068861_100209128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium | 1642 | Open in IMG/M |
| 3300005840|Ga0068870_10119978 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
| 3300006237|Ga0097621_101432269 | Not Available | 655 | Open in IMG/M |
| 3300006755|Ga0079222_10094746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1550 | Open in IMG/M |
| 3300006755|Ga0079222_10318790 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300006903|Ga0075426_10387135 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300006918|Ga0079216_11347674 | Not Available | 586 | Open in IMG/M |
| 3300009092|Ga0105250_10463309 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300009093|Ga0105240_12539532 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300009094|Ga0111539_12041331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300009098|Ga0105245_12797299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300009101|Ga0105247_11142496 | Not Available | 617 | Open in IMG/M |
| 3300009101|Ga0105247_11869774 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300009174|Ga0105241_10697529 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300009545|Ga0105237_11549520 | Not Available | 669 | Open in IMG/M |
| 3300009551|Ga0105238_12363846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300009840|Ga0126313_11256064 | Not Available | 611 | Open in IMG/M |
| 3300010041|Ga0126312_11200686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300010042|Ga0126314_10470919 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300010046|Ga0126384_11175733 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300010046|Ga0126384_11767395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300010047|Ga0126382_10545862 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300010047|Ga0126382_11993436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300010397|Ga0134124_12830486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300010399|Ga0134127_11373393 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300011119|Ga0105246_11308933 | Not Available | 672 | Open in IMG/M |
| 3300011332|Ga0126317_10434935 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300012896|Ga0157303_10091176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300012958|Ga0164299_10600865 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300012958|Ga0164299_11098725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300012961|Ga0164302_10273098 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300012961|Ga0164302_11122518 | Not Available | 622 | Open in IMG/M |
| 3300013100|Ga0157373_10369330 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300013297|Ga0157378_10627498 | All Organisms → cellular organisms → Bacteria | 1088 | Open in IMG/M |
| 3300014326|Ga0157380_11143963 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300014326|Ga0157380_13326219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300014745|Ga0157377_11048706 | Not Available | 621 | Open in IMG/M |
| 3300014968|Ga0157379_10955356 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300014968|Ga0157379_11020454 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300015372|Ga0132256_101600141 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300015373|Ga0132257_103860278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300015374|Ga0132255_103882383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300015374|Ga0132255_104009570 | Not Available | 625 | Open in IMG/M |
| 3300018466|Ga0190268_11900867 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300018466|Ga0190268_12017491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300019377|Ga0190264_12158005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300020002|Ga0193730_1113778 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300020610|Ga0154015_1067916 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300021445|Ga0182009_10452127 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300025315|Ga0207697_10050785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1713 | Open in IMG/M |
| 3300025907|Ga0207645_10897333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300025907|Ga0207645_10947720 | Not Available | 584 | Open in IMG/M |
| 3300025913|Ga0207695_10694906 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300025918|Ga0207662_10602838 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300025918|Ga0207662_10689230 | Not Available | 715 | Open in IMG/M |
| 3300025924|Ga0207694_10885531 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300025931|Ga0207644_11168864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300025945|Ga0207679_10263605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1471 | Open in IMG/M |
| 3300025945|Ga0207679_11405834 | Not Available | 640 | Open in IMG/M |
| 3300025986|Ga0207658_10434672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1160 | Open in IMG/M |
| 3300026095|Ga0207676_10886019 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300026118|Ga0207675_101285533 | Not Available | 752 | Open in IMG/M |
| 3300026118|Ga0207675_102628093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300027775|Ga0209177_10038614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1296 | Open in IMG/M |
| 3300027775|Ga0209177_10085817 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300027787|Ga0209074_10513110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300027886|Ga0209486_10069382 | All Organisms → cellular organisms → Bacteria | 1808 | Open in IMG/M |
| 3300028381|Ga0268264_11109212 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300030510|Ga0268243_1022281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1260 | Open in IMG/M |
| 3300030511|Ga0268241_10058018 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300030511|Ga0268241_10154261 | Not Available | 563 | Open in IMG/M |
| 3300031562|Ga0310886_11119915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300031731|Ga0307405_10947221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 731 | Open in IMG/M |
| 3300031852|Ga0307410_11837344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300031858|Ga0310892_11230236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300031903|Ga0307407_11016910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300032002|Ga0307416_101961100 | Not Available | 688 | Open in IMG/M |
| 3300032003|Ga0310897_10723177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300032144|Ga0315910_11153137 | Not Available | 605 | Open in IMG/M |
| 3300032174|Ga0307470_11521091 | Not Available | 557 | Open in IMG/M |
| 3300033412|Ga0310810_10420611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1369 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.28% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 6.54% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 5.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.74% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.74% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.87% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.87% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_08827692 | 2228664021 | Soil | AGESAALKAALQGRFQYEVLGEIAAPAPSQKPPTKPANNINPR |
| ICCgaii200_08833372 | 2228664021 | Soil | VAGESAALKAALQGRFQYEVLGEIAAPAPSQKPPTKPANNINPR |
| CNBas_10006301 | 3300000531 | Quercus Rhizosphere | GESAPLKTALQGRVQYEVLGEIAAPAPSPKPPAKPASSGNPR* |
| JGI10214J12806_108145652 | 3300000891 | Soil | VANRLFNKTIVSVVAGETAPLKAALQGRYQYEVLGEVTAPAPAPKPPAKPAGNINPG* |
| Ga0065712_103839872 | 3300005290 | Miscanthus Rhizosphere | LLRAVTPADIQRVAQRLFNKTVVSVVAGESAPLKAALQGRYQYEVLGEIATPAPSQKPPTKPANPR* |
| Ga0065715_100162361 | 3300005293 | Miscanthus Rhizosphere | LFNKTIVSVVAGESAPLKGALQGRYQYEVLGEIATPAPSQKPPTKPANNINPR* |
| Ga0065715_110894771 | 3300005293 | Miscanthus Rhizosphere | AVIASEVQRVANRLFNKTFVSIAAGETASLKAALQGHFQYEVLGEIATPAPTPKPPAKPSGRDNPR* |
| Ga0065705_110038541 | 3300005294 | Switchgrass Rhizosphere | GESAPLKAALQGRYQYEVLGEIAAPAPSQKPPTKPANKPASNDNPR* |
| Ga0065707_107796822 | 3300005295 | Switchgrass Rhizosphere | RVANRLFNKTIVSVVAGETAPLKAALQGHYQYEVLGEIPAPAPAKPPTKPASNDNPR* |
| Ga0070676_111509602 | 3300005328 | Miscanthus Rhizosphere | ATAAEVQRVANRLFNKSIVSVVAGESAALKAALQGRFQYEVLGEIAAPLAPSKKPPTKPATNDNPR* |
| Ga0070670_1000785121 | 3300005331 | Switchgrass Rhizosphere | NRLFNKTIVSVVAGESAPLKAALQGRYQYEVLGEIAAPAPSQKPPTKPANKPASNDNPR* |
| Ga0070687_1007138652 | 3300005343 | Switchgrass Rhizosphere | TIVSVVAGESAPLKAALQGRYQYEVLGEIAAPPPSQKPPIKPANNNNPG* |
| Ga0070687_1015004621 | 3300005343 | Switchgrass Rhizosphere | SVILGETAPLKAALQGRFQYEVMGEIATPTPSPKPPATPGTKDGPG* |
| Ga0070675_1012500882 | 3300005354 | Miscanthus Rhizosphere | TAPLKAALQGRFQYEVMGEIATPTPSPKPPATPGTKDGPG* |
| Ga0070673_1012826352 | 3300005364 | Switchgrass Rhizosphere | RLFNKTIVSVVAGETAPLKAALQGRYQYEVLGEIATPAPSPKPPGKPAGNVNPR* |
| Ga0070688_1002267153 | 3300005365 | Switchgrass Rhizosphere | APELQRVANRLFNKTVVSLVAGETAPLKAALQGRFQYEVLGEVATPAPTPKPPAKPAGSVNPR* |
| Ga0070701_112722081 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | QRVANRLFNKTIVSVVAGESAPLKAALQGRYQYEVLGEIATPAPSQKPPTKPANNINPR* |
| Ga0070705_1003821621 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | IVSVVAGESVPLKAALQGRYQFEVLGEIAAPVPSQKPPTKPANNNNPR* |
| Ga0070685_102968611 | 3300005466 | Switchgrass Rhizosphere | LRAVTAADVQRVANRLFNKTIVSVVGGETAPLKAALQGHYQYEVLGEIPAPAPAKPPTKPASNDNPR* |
| Ga0070695_1000552991 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | TGSEVQRVANRLFNKSIVSLAAGEIAPLKAALQGHFQYEVLGEIATPAPTPKPPAKPSGSVNPR* |
| Ga0070704_1005042421 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | QRVANRLFNKTVVSVVAGESAPLKGALQGRYQYEVLGEIATPAPSQKPPTKPANNINPR* |
| Ga0070704_1007012671 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | TAPEVQRVANRIFNKTIVSVVAGETAPLKAALQGRYQYEVLGEIATPAPSPKPPAKPANNNNPR* |
| Ga0068857_1024572432 | 3300005577 | Corn Rhizosphere | LQRVANRLFNKTIVSIVAGETAPLKAALQGRFQYEVLGEVATPAPTPKPPAKPAGSVNPR |
| Ga0068854_1014703681 | 3300005578 | Corn Rhizosphere | VAGETAPIKAALQGRYQYEVLGEMAAPVPSQKPPTKPANNHNPG* |
| Ga0068854_1019265222 | 3300005578 | Corn Rhizosphere | FNKTVVSVVAGETAPLKAALQGRFQYEVLGEIATPAPTPKPPVKPSGSVNPR* |
| Ga0068852_1016201411 | 3300005616 | Corn Rhizosphere | LFNKTIVSVVAGESAPLKAALQGRYQYEVLGEIAAPPPSQKPPTKPANIRNPG* |
| Ga0068861_1002091283 | 3300005719 | Switchgrass Rhizosphere | ADVQRVANRLFNKTIVSVVAGESAPLKAALQGRYQYEVLGEIAAPAPSQKPPTKPANNINPR* |
| Ga0068870_101199783 | 3300005840 | Miscanthus Rhizosphere | LFNKTIVSVVAGESAALKAALQGRFQYEVLGEIAAPAPSQKPPTKPAAKPATNDNPR* |
| Ga0097621_1014322691 | 3300006237 | Miscanthus Rhizosphere | QRVAQRLFNKTIVSVVAGESAPLKAALQGRYQFEVLGEIAAPVPSQKPPTKPANNNNPR* |
| Ga0079222_100947461 | 3300006755 | Agricultural Soil | QRVANRLFNKTIVSVVAGESAPLKAALQGRYQYEVLGEIPAPTPSQKPPTKPANNRNPG* |
| Ga0079222_103187904 | 3300006755 | Agricultural Soil | PLKAALQGRYQFEVLGEIATPVTPAPPVTKPPAKPASNINPR* |
| Ga0075426_103871352 | 3300006903 | Populus Rhizosphere | VASRLFKTHAIASVAAGETAPLKAALEGRVQYEVLGEIATPAPSPKPPAKPAGNINPR* |
| Ga0079216_113476741 | 3300006918 | Agricultural Soil | PALEGRLQYEVLGEIAIPAPTPKPPAKPASNNNPM* |
| Ga0105250_104633091 | 3300009092 | Switchgrass Rhizosphere | AALQGRFQYEVLGEIATPAPTPKPPVKPSGSVNPR* |
| Ga0105240_125395321 | 3300009093 | Corn Rhizosphere | LFNKTIVSVVAGETAPIKAALQGRYQYEVLGEMAAPVPSQKPPTKPANNHNPG* |
| Ga0111539_120413312 | 3300009094 | Populus Rhizosphere | KAALQGRFQYEVLGEVATPAPTPKPPAKPAGSVNPR* |
| Ga0105245_127972991 | 3300009098 | Miscanthus Rhizosphere | NKTCVSGVAGETAPLKAALQGRYQYEVLGAVAAPAPAPKPPAKPAGNVNPG* |
| Ga0105247_111424961 | 3300009101 | Switchgrass Rhizosphere | RLFNKTIVSVVAGESAPLKAALQGRYQYEVLGEIAAPVPSQKPPTKPANNNNPG* |
| Ga0105247_118697742 | 3300009101 | Switchgrass Rhizosphere | IASEVQRVANRLFNKTIVSIAAGETASLKAALQGHFQYEVLGEIATPAPTPKPPAKPSGRDNPR* |
| Ga0105241_106975292 | 3300009174 | Corn Rhizosphere | LFNKTIVSVVAGESAPLKAALQGRYQYEVLGEIATPAPSQKPPTKPANNINPR* |
| Ga0105237_115495201 | 3300009545 | Corn Rhizosphere | RVANRLFNKTTVSVVAGESAPLKAALQGRFQYEVLGEIAAPAPSQKPPTKPANNNNPR* |
| Ga0105238_123638461 | 3300009551 | Corn Rhizosphere | RVANRLFNKTIVSVVAGETAPIKAALQGRYQYEVLGEMAAPVPSQKPPTKPANNHNPG* |
| Ga0126313_112560642 | 3300009840 | Serpentine Soil | LFNKTIVSVVAGESAPLKAALQGRYQYEVLDEIATPAPSQKPPTKPANKPASNDNPR* |
| Ga0126312_112006862 | 3300010041 | Serpentine Soil | EIQRVANRLFNKNMASVVAGESAALKAALQGRFQYEVLGEIATPAVPSQKPPTKPATKPATNDNPR* |
| Ga0126314_104709191 | 3300010042 | Serpentine Soil | LAAGETASLKAALQGRLQYEVLGEIASPAPTPKPTPKPSGSDNPG* |
| Ga0126384_111757331 | 3300010046 | Tropical Forest Soil | RLFNKTIVSVVAGESAPLKAALQGRYQFEVLGEIAPPAPSQKPPTKPANNNNPR* |
| Ga0126384_117673952 | 3300010046 | Tropical Forest Soil | FNKTIVSVVAGESAALKAALQGRFQYEVLGEIAAPAPSQKPPTKPATNDNPR* |
| Ga0126382_105458621 | 3300010047 | Tropical Forest Soil | QRVANRLFNKTIVSLAAGETASLKAALQGRFQYEVLGEIATPAPTPKPPVKPSGSVNPR* |
| Ga0126382_119934362 | 3300010047 | Tropical Forest Soil | VSIVAGETAPLKAALQGRYPFEVLGEIATPVQSQKPPTKPASNDNPR* |
| Ga0134124_128304861 | 3300010397 | Terrestrial Soil | LAAVETAPLKAALQGRFQYEVLGEIATPAPTPKPSAKPSGSVNPR* |
| Ga0134127_113733932 | 3300010399 | Terrestrial Soil | APELQRVANRLFNKSVVSVVAGETAPLKAALQGRFQYEVLGEIATPAPTPKPPVKPSGSVNPR* |
| Ga0105246_113089332 | 3300011119 | Miscanthus Rhizosphere | SVVAGESAPLKAALQGRYQYEVLGEIAVPAPSQKPPTKPANNINPR* |
| Ga0126317_104349351 | 3300011332 | Soil | LKAALQGRYQYEVLGEIAAPAPSQKPPTKPANIINPR* |
| Ga0157303_100911761 | 3300012896 | Soil | PELQRVANRLFNKTVVTLVAGETAPLKAALQGRFQYEVLGEVATPAPTPKPPVKPSGSVNPR* |
| Ga0164299_106008651 | 3300012958 | Soil | ALQGRYQYEVLGEIATPAPTPKPPAKPAGNINPR* |
| Ga0164299_110987251 | 3300012958 | Soil | VVAGETAPIKAALQGRYQFEVLGEIAAPPPSQKPPTKPANNNNPG* |
| Ga0164302_102730982 | 3300012961 | Soil | VAGESAPLKAALQGRYQYEVLGEIAAPAPSQKPPTTPANNRNPG* |
| Ga0164302_111225181 | 3300012961 | Soil | AAGETAPLKAALQGRFQYEVLGEIASPAPTPKPPAKPSGSDNPR* |
| Ga0157373_103693301 | 3300013100 | Corn Rhizosphere | ESASLKAALQGRYQYEVLGEIATPAPSQKPPTKPANNINPG* |
| Ga0157378_106274981 | 3300013297 | Miscanthus Rhizosphere | KNVASVVAGESAPLKAALQGRYQYEVLGEIAAPPPSQKPPTKPANIRNPG* |
| Ga0157380_111439632 | 3300014326 | Switchgrass Rhizosphere | NKTIVSVVAGESAALKAALQGRFQYEVLGEIAAPAPSQKPPTKPATNDNPR* |
| Ga0157380_133262191 | 3300014326 | Switchgrass Rhizosphere | KGALQGRYQYEVLGEIAAPPPSQKPPTKPANIRNPG* |
| Ga0157377_110487061 | 3300014745 | Miscanthus Rhizosphere | NRLFNKTIVSVVAGETAPIKAALQGRYQFEVLGEIAAPSPSQKPPTKPANIRNPG* |
| Ga0157379_109553561 | 3300014968 | Switchgrass Rhizosphere | PIKAALQGRYQFEVLGEIAAPPPSQKPPTKPANNNNPG* |
| Ga0157379_110204541 | 3300014968 | Switchgrass Rhizosphere | LKAALQGRFQYEVLGEIASPAPTPKPPAKPSGSANPR* |
| Ga0132256_1016001412 | 3300015372 | Arabidopsis Rhizosphere | APLKAALQGRYQYEVLGEIATPAPPVTKPPAKPAGNINPR* |
| Ga0132257_1038602782 | 3300015373 | Arabidopsis Rhizosphere | LFNKTVVSVVAGESAPLKAALQGRYPYEVLGEIATPAPSQKPPTKPANNINPR* |
| Ga0132255_1038823832 | 3300015374 | Arabidopsis Rhizosphere | GETAPLKAALQGRYQYEVLGEIATPAPAPKTAPKTPAKPAGNINPR* |
| Ga0132255_1040095702 | 3300015374 | Arabidopsis Rhizosphere | PLKAALQGRYQYEVLGEIAAPAPPKQPTKPASNDNPG* |
| Ga0190268_119008671 | 3300018466 | Soil | AVATVVAGETLQLKPALEGRLQYEVLGEIATPAPTPKPPAKPASNNNPM |
| Ga0190268_120174911 | 3300018466 | Soil | PADIQRVANRIFNKTVVSVVAGESAPLKAALQGRYQFEVLGEIAAPAPSQKPPTKPANNNNPG |
| Ga0190264_121580052 | 3300019377 | Soil | VVAGETIQLKPALEGRVQYEVLGEFATPAPTPKPPAKPASNNNPM |
| Ga0193730_11137781 | 3300020002 | Soil | LKTALQGRQQFEVMGEIAAPSPSPKPQNKPVGNINPR |
| Ga0154015_10679161 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | TIVSVVAGETAPLKAALQGRYQYEVLGEIATPAPSQKPPTKPANNINPR |
| Ga0182009_104521271 | 3300021445 | Soil | SEQLKAALQGRVQYEVLGEIATPAPSPKPPAKPSTNSNPR |
| Ga0207697_100507851 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | SAPLKAALQGRYQFEVLGEIAAPVPSQKPPTKPANNNNPR |
| Ga0207645_108973331 | 3300025907 | Miscanthus Rhizosphere | KAALQGRYQYEVLGEMAAPVPSQKPPTKPANNHNPG |
| Ga0207645_109477201 | 3300025907 | Miscanthus Rhizosphere | VVAGETAPLKAALQGRYQYEVLGEIATPAPSQKPPTKPANNNNPR |
| Ga0207695_106949062 | 3300025913 | Corn Rhizosphere | VVAGESAPLKAALQGRYQYEVLGEIATPVPSQKPPTKPANNINPR |
| Ga0207662_106028381 | 3300025918 | Switchgrass Rhizosphere | AALQGRYQYEVLGEIATPAPSPKPPGKPAGNVNPR |
| Ga0207662_106892301 | 3300025918 | Switchgrass Rhizosphere | TIVSVVAGESAPLKAALQGRYQYEVLGEIAAPPPSQKPPIKPANNNNPG |
| Ga0207694_108855311 | 3300025924 | Corn Rhizosphere | AALQGRYQYEVLGEMAAPVPSQKPPTKPANNHNPG |
| Ga0207644_111688642 | 3300025931 | Switchgrass Rhizosphere | ETAPLKAALQGRYQYEVLGEIATPAPSPKPPAKPAGNVNPR |
| Ga0207679_102636051 | 3300025945 | Corn Rhizosphere | TAPLKAALQGHIQFEVLGEITAPAPAPKTPAKPGSVAKPR |
| Ga0207679_114058341 | 3300025945 | Corn Rhizosphere | LKAALQGRYQDEVLGEIAAPAPSQKPPTKPAKNINPG |
| Ga0207658_104346723 | 3300025986 | Switchgrass Rhizosphere | PLKAALQGRYQFEVLGEIATPAPSQKPPTKPANNNNPR |
| Ga0207676_108860192 | 3300026095 | Switchgrass Rhizosphere | TPLKTALQGRVPYEVLGEIATPTPPAKTPAKPASNVNPR |
| Ga0207675_1012855332 | 3300026118 | Switchgrass Rhizosphere | PADVQRVAQRLFNKTIVSVVAGESAPLKAALQGRYQYEVLGEIAAPAPSQKPPTKPANNNNPG |
| Ga0207675_1026280931 | 3300026118 | Switchgrass Rhizosphere | SVTAAEIQRVANRFFNKPIVSVVAGESAALKAALQGRFQFEVFGEIAAPAPSQKPPTKPASNINPG |
| Ga0209177_100386143 | 3300027775 | Agricultural Soil | QRVANRLFNKTIVSVVAGESAPLKAALQGRYQYEVLGEIPAPTPSQKPPTKPANNRNPG |
| Ga0209177_100858171 | 3300027775 | Agricultural Soil | ASEIQRVANRLFNKSIVSLVAGETAPLKAALQGRFQYEVLGEIATPAPTPKPPAKPSGSVNPR |
| Ga0209074_105131101 | 3300027787 | Agricultural Soil | PLKAALQGRYQFEVLGEIATPVTPAPPVTKPPAKPASNINPR |
| Ga0209486_100693821 | 3300027886 | Agricultural Soil | PLKAALQGRVQYEVLGEIAAPAPSPKPPAKPTGNANPR |
| Ga0268264_111092122 | 3300028381 | Switchgrass Rhizosphere | TIVSVVAGESAPLKAALQGRYQYEVLGEIAAPPPSQKPPTKPANIRNPG |
| Ga0268243_10222813 | 3300030510 | Soil | AALKAALQGRFQYEVLGEIAAPAPSQKPPTKPAPINNPG |
| Ga0268241_100580182 | 3300030511 | Soil | ADVQRVAQRLFNKTIVSVVAGESAPLKAALQGRYQYEVLGEIAAPAPSQKPPTKPANNHNPG |
| Ga0268241_101542611 | 3300030511 | Soil | VAGETAPLKAALQGRFQYEVLGEIATPAPTPKPPVKPSGSVNPR |
| Ga0310886_111199151 | 3300031562 | Soil | VQRVANRLFNKTIVSVVAGESAPLKGALQGRYQYEVLGEIATPAPSQKPPTKPANNINPR |
| Ga0307405_109472211 | 3300031731 | Rhizosphere | RLFNKSIVSVVAGESAALKAALQGRFQYEVLGEIAAPAPSQKPPTKPATNDNPR |
| Ga0307410_118373442 | 3300031852 | Rhizosphere | VAGEAIQLKPALEGRLQYEVLGEIAAPAPSPKSPAKPASNNNPM |
| Ga0310892_112302361 | 3300031858 | Soil | SVVAGESAPLKAALQGRYQYEVLGEIAAPPPSQKPPTKPANIRNPG |
| Ga0307407_110169102 | 3300031903 | Rhizosphere | NAALATVVAGEAIQLKPALEGRLQYEVLGEIAAPAPSPKSPAKPASNNNPM |
| Ga0307416_1019611002 | 3300032002 | Rhizosphere | LKAALQGRYQYEVLGEIATPAPSQKPPTKPANKPASNDNPR |
| Ga0310897_107231772 | 3300032003 | Soil | IVSVVAGESAPLKAALQGRYQYEVLGEIATPAPSQKPPTKPANNINPR |
| Ga0315910_111531371 | 3300032144 | Soil | VANRLFNKTVVSVVAGESAPLKAALQGRYQYEVLGEIATPAPSKKPPTKPANNINPR |
| Ga0307470_115210912 | 3300032174 | Hardwood Forest Soil | AGESAPLKAALQGRYPYEVLGEIATPAPSQKPPTKPANNINPR |
| Ga0310810_104206113 | 3300033412 | Soil | RVASRLFNKTIVSIAAGETASLKAALQGHFQYEVLGEIATPAPTPKPPAKPSGKENPR |
| ⦗Top⦘ |