NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F092179

Metagenome Family F092179

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092179
Family Type Metagenome
Number of Sequences 107
Average Sequence Length 53 residues
Representative Sequence MVRYSKLPMIVRYKVGSIKGKPSEEEYLALTSMGVSTVLLSVSLARSRISATYFD
Number of Associated Samples 25
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 68.22 %
% of genes near scaffold ends (potentially truncated) 23.36 %
% of genes from short scaffolds (< 2000 bps) 29.91 %
Associated GOLD sequencing projects 25
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (96.262 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza
(51.402 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(88.785 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 51.81%    β-sheet: 0.00%    Coil/Unstructured: 48.19%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF07727RVT_2 60.75
PF13976gag_pre-integrs 6.54
PF14244Retrotran_gag_3 3.74
PF01852START 1.87
PF00005ABC_tran 1.87
PF00190Cupin_1 0.93
PF00665rve 0.93
PF13410GST_C_2 0.93
PF01425Amidase 0.93
PF03145Sina 0.93
PF02798GST_N 0.93
PF02992Transposase_21 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.93
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.93
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.93
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.93
COG4584TransposaseMobilome: prophages, transposons [X] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006353|Ga0075370_10729835All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus603Open in IMG/M
3300028786|Ga0307517_10006933All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta16653Open in IMG/M
3300028786|Ga0307517_10009705All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus13605Open in IMG/M
3300028786|Ga0307517_10014282All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida10683Open in IMG/M
3300028786|Ga0307517_10015796All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida9992Open in IMG/M
3300028786|Ga0307517_10019719All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa8632Open in IMG/M
3300028794|Ga0307515_10014135All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera14841Open in IMG/M
3300028794|Ga0307515_10031531All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae8832Open in IMG/M
3300028794|Ga0307515_10039255All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus7538Open in IMG/M
3300028794|Ga0307515_10044574All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera6847Open in IMG/M
3300028794|Ga0307515_10047434All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta6529Open in IMG/M
3300028794|Ga0307515_10058752All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta5530Open in IMG/M
3300030521|Ga0307511_10040214All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3976Open in IMG/M
3300030521|Ga0307511_10095537All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1985Open in IMG/M
3300030521|Ga0307511_10154820All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1304Open in IMG/M
3300030522|Ga0307512_10206253All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1054Open in IMG/M
3300030522|Ga0307512_10272782All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta817Open in IMG/M
3300030522|Ga0307512_10276448All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta807Open in IMG/M
3300030522|Ga0307512_10291169All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta770Open in IMG/M
3300031456|Ga0307513_10002510All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta25395Open in IMG/M
3300031456|Ga0307513_10019190All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta8145Open in IMG/M
3300031456|Ga0307513_10025165All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta6904Open in IMG/M
3300031456|Ga0307513_10047053All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta4695Open in IMG/M
3300031456|Ga0307513_10082817All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera3301Open in IMG/M
3300031456|Ga0307513_10332586All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1273Open in IMG/M
3300031456|Ga0307513_10490828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta946Open in IMG/M
3300031507|Ga0307509_10024255All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta6795Open in IMG/M
3300031507|Ga0307509_10093719All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta3063Open in IMG/M
3300031507|Ga0307509_10199577All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1839Open in IMG/M
3300031507|Ga0307509_10593001All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta781Open in IMG/M
3300031507|Ga0307509_10654229All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus719Open in IMG/M
3300031507|Ga0307509_10980720All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus511Open in IMG/M
3300031616|Ga0307508_10106789All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2398Open in IMG/M
3300031616|Ga0307508_10400041All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta964Open in IMG/M
3300031616|Ga0307508_10438452All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta898Open in IMG/M
3300031616|Ga0307508_10581947All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus719Open in IMG/M
3300031649|Ga0307514_10042998All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida3550Open in IMG/M
3300031649|Ga0307514_10071716All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2596Open in IMG/M
3300031730|Ga0307516_10037097All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta4874Open in IMG/M
3300031730|Ga0307516_10045071All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4358Open in IMG/M
3300031730|Ga0307516_10059134All Organisms → Viruses → Predicted Viral3728Open in IMG/M
3300031730|Ga0307516_10193042All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1761Open in IMG/M
3300031730|Ga0307516_10318319All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1227Open in IMG/M
3300031730|Ga0307516_10783181All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta614Open in IMG/M
3300031730|Ga0307516_10958301All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus525Open in IMG/M
3300031838|Ga0307518_10004469All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus10022Open in IMG/M
3300031838|Ga0307518_10029249All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera3985Open in IMG/M
3300031838|Ga0307518_10100168All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2075Open in IMG/M
3300031838|Ga0307518_10234316All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1184Open in IMG/M
3300031838|Ga0307518_10291478All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1000Open in IMG/M
3300031838|Ga0307518_10605788All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus521Open in IMG/M
3300032354|Ga0325403_1000401All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus29386Open in IMG/M
3300032354|Ga0325403_1001166All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera21336Open in IMG/M
3300032354|Ga0325403_1005387All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus12060Open in IMG/M
3300032354|Ga0325403_1009272All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus9396Open in IMG/M
3300032354|Ga0325403_1016153All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera6933Open in IMG/M
3300032354|Ga0325403_1016401All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera6869Open in IMG/M
3300032354|Ga0325403_1018718All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta6349Open in IMG/M
3300032354|Ga0325403_1019749All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera6127Open in IMG/M
3300032354|Ga0325403_1023420All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus5474Open in IMG/M
3300032354|Ga0325403_1025836All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera5098Open in IMG/M
3300032354|Ga0325403_1028968All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta4694Open in IMG/M
3300032354|Ga0325403_1032036All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera4353Open in IMG/M
3300032354|Ga0325403_1036224All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3933Open in IMG/M
3300032354|Ga0325403_1036469All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3911Open in IMG/M
3300032354|Ga0325403_1045848All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3194Open in IMG/M
3300032354|Ga0325403_1126009All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta831Open in IMG/M
3300032355|Ga0325401_1007360All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa10687Open in IMG/M
3300032355|Ga0325401_1015278All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus7314Open in IMG/M
3300032355|Ga0325401_1021283All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta6030Open in IMG/M
3300032355|Ga0325401_1027033All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta5138Open in IMG/M
3300032355|Ga0325401_1037391All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta4063Open in IMG/M
3300032355|Ga0325401_1044908All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3509Open in IMG/M
3300032355|Ga0325401_1086895All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1855Open in IMG/M
3300032355|Ga0325401_1145624All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera973Open in IMG/M
3300032374|Ga0325400_1296265All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus582Open in IMG/M
3300032389|Ga0325405_1002959All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida17543Open in IMG/M
3300032389|Ga0325405_1004374All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta14454Open in IMG/M
3300032389|Ga0325405_1008061All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa10516Open in IMG/M
3300032389|Ga0325405_1012747All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera7972Open in IMG/M
3300032389|Ga0325405_1018175All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta6291Open in IMG/M
3300032389|Ga0325405_1026698All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus4674Open in IMG/M
3300032389|Ga0325405_1033311All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3861Open in IMG/M
3300032389|Ga0325405_1051510All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2434Open in IMG/M
3300032389|Ga0325405_1055330All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida2230Open in IMG/M
3300032389|Ga0325405_1062760All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1868Open in IMG/M
3300032389|Ga0325405_1076866All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1346Open in IMG/M
3300032390|Ga0325404_1008045All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus10910Open in IMG/M
3300032390|Ga0325404_1047788All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2604Open in IMG/M
3300032390|Ga0325404_1049329All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2502Open in IMG/M
3300032735|Ga0325410_1000091All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae85221Open in IMG/M
3300032741|Ga0325414_1045025All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3139Open in IMG/M
3300032741|Ga0325414_1069341All Organisms → Viruses → Predicted Viral1769Open in IMG/M
3300033160|Ga0325402_1002884All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida15294Open in IMG/M
3300033160|Ga0325402_1071198All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus1916Open in IMG/M
3300033179|Ga0307507_10032264All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera5473Open in IMG/M
3300033179|Ga0307507_10074566All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3042Open in IMG/M
3300033179|Ga0307507_10076314All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2989Open in IMG/M
3300033180|Ga0307510_10015861All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa8904Open in IMG/M
3300033180|Ga0307510_10072300All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera3427Open in IMG/M
3300034389|Ga0325419_012707All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta8476Open in IMG/M
3300034389|Ga0325419_023100All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta5446Open in IMG/M
3300034688|Ga0325420_048247All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis2676Open in IMG/M
3300034688|Ga0325420_058395All Organisms → Viruses → Predicted Viral2188Open in IMG/M
3300034689|Ga0325421_073027All Organisms → Viruses → Predicted Viral1491Open in IMG/M
3300034899|Ga0325407_043511All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus2975Open in IMG/M
3300034899|Ga0325407_052152All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis2416Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza51.40%
XylemHost-Associated → Plants → Wood → Unclassified → Unclassified → Xylem41.12%
LeafHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf6.54%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006353Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5Host-AssociatedOpen in IMG/M
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300028794Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EMHost-AssociatedOpen in IMG/M
3300030521Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EMHost-AssociatedOpen in IMG/M
3300030522Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EMHost-AssociatedOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031649Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EMHost-AssociatedOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031838Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EMHost-AssociatedOpen in IMG/M
3300032354Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4Host-AssociatedOpen in IMG/M
3300032355Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2Host-AssociatedOpen in IMG/M
3300032374Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1Host-AssociatedOpen in IMG/M
3300032389Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2Host-AssociatedOpen in IMG/M
3300032390Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1Host-AssociatedOpen in IMG/M
3300032735Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3Host-AssociatedOpen in IMG/M
3300032741Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033160Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033179Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EMHost-AssociatedOpen in IMG/M
3300033180Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EMHost-AssociatedOpen in IMG/M
3300034389Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4Host-AssociatedOpen in IMG/M
3300034688Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R1Host-AssociatedOpen in IMG/M
3300034689Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdIQD-R2Host-AssociatedOpen in IMG/M
3300034899Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R4Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0075370_1072983523300006353Populus EndosphereYKVGSIKGKPSEEEYLALTSIGVSTALLSVSLARSRISATYFD*
Ga0307517_1000693363300028786EctomycorrhizaMVRYTKLPTVVRYKVEYIKGKPSEEEYLALTSIGVSTVLLSVSLARSRISATYFD
Ga0307517_1000970533300028786EctomycorrhizaMVTYSKLQTIVRYEVGFVKDKPLEEEYLVLTSMRVSTVLLSVSLARSRISATYFN
Ga0307517_1001428223300028786EctomycorrhizaMVRYTKLPIIVQYKVGSVKGKPLEEEYLALTSMGVCTVLLLVSLAHLRIFATYFD
Ga0307517_1001579623300028786EctomycorrhizaMVRYTKLPTIVQYKVGLVKGKPSKEEYLALTSMRVSTFLLSVSLARSKISATYFD
Ga0307517_1001971913300028786EctomycorrhizaMVRYIKLPTIVRYKVGSIKGKPLEEGYLALTSIGVSTVLLSVSLACSRISATYFD
Ga0307515_1001413533300028794EctomycorrhizaMVRYTNLPIIVRYKVASTKGKPSEEEYLVLTSIGVSTVLLSVSLARSRISTTYFD
Ga0307515_1003153183300028794EctomycorrhizaMVRYTKLPIIVQYKVGSVKGKPLEEEYLALTSMGVCTVLLLVSLAHLRIFATYFDXEKS
Ga0307515_1003925593300028794EctomycorrhizaMVRYTKLLIIVRYKVRSAKGIPSEEQYLVLTSIRVFIVLLSVSLARLRISATYFD
Ga0307515_1004457443300028794EctomycorrhizaMLRYTKLLTIVRYKVGSIKGKPSEEEYLALTSIGVSRILLLVSLARSRISATNFD
Ga0307515_1004743433300028794EctomycorrhizaMVRYTKLPIIVWYKVGSEKNKLLEEEYFALTSIGVSIILLSVSLARSRISATFF
Ga0307515_1005875283300028794EctomycorrhizaMVRYTKLPTIVQYKIGLVKGKPSKEEYLELTSMGVSTFLLSVSLARSKISATYFD
Ga0307511_1004021443300030521EctomycorrhizaMVRYTKLPTIVGYKIGSIKGKPSEEEYIALTSMGVSTILLSVSLTRLRIYAIYFD
Ga0307511_1009553713300030521EctomycorrhizaMERYTKLPIIVRYKVGSVKGKPLEKEYLMLTSMGVSTVLLSVSLIHSRISATYFDXERR
Ga0307511_1015482023300030521EctomycorrhizaYIKFPIIIRNKVEFVKGKPSEEEYLALTSIKEYTVLLLVSLARLRFSAIISIEKEDNL
Ga0307512_1020625323300030522EctomycorrhizaMVRYTKLPTIVQYKVGLVKGKPSKEEYLALTSMGVSTVLLSVSLACSKISATYFD
Ga0307512_1027278233300030522EctomycorrhizaVGYKIGSIKGKPSEEEYIALTSMGVSTILLSVSLTRLRIYAIYFD
Ga0307512_1027644813300030522EctomycorrhizaVMVRYTKLPTVVRYKVEYIKGKPSEEEYLALTSIGVSTVLLSVSLARSRISATYFD
Ga0307512_1029116913300030522EctomycorrhizaMRYTKLLTIVWYKVGSDKSKSSEEKYFVLTSMRVFIVLLSVSLAYSRISTI
Ga0307513_10002510153300031456EctomycorrhizaMVRYMKLSTIVWYKVGFIKGKSSKEEYLVLTSIRVSTVMLSISLVHSRIFATYFD
Ga0307513_10019190103300031456EctomycorrhizaMVRYTKLPTIARYKVGSVKGKPSEEEYLLLTSMGVSTVLLSVSLAC
Ga0307513_1002516563300031456EctomycorrhizaMRRYIKFPIIIRNKVEFVKGKPSEEEYLALTSIKEYTVLLLVSLARLRISAIISIEKEDN
Ga0307513_1004705333300031456EctomycorrhizaMVRYTKLPTIVRYKIGSIKGKPSEEEYIALTSMGVSTILLSVSLTRLRIYAIYFD
Ga0307513_1008281733300031456EctomycorrhizaMMRYTKLPTIVRYKVGTIKGKPSEEEYLALTSMGVSTVLLSVSLARSRISATYFD
Ga0307513_1033258633300031456EctomycorrhizaVMVRYTKLPTIVWYKVGSIKGKSSEEKYLALTSIGVSTVLLSVSLARSRISATYFD
Ga0307513_1049082823300031456EctomycorrhizaMWVKLSNNMVTSYTKLPTIVHYKIGYVKGKPSEEKYLVLTSMGVSIVLLSVNLARSRISTINFD
Ga0307509_1002425563300031507EctomycorrhizaMVRYTKLPTIVRYKVGSVKGKPLEEEYFALTSMRVSIVLLLVSLVRSRISATYFD
Ga0307509_1009371943300031507EctomycorrhizaMVRYTKLPTIVRYKVGSIKGKPSEEEYLALTLMRVSTVLLSTSLARSRIAATYFN
Ga0307509_1019957713300031507EctomycorrhizaMVRYSKLPTIVXYKVGSAKGKPLEEKYLALTSIGVSILLLSVSLASSRISATYFD
Ga0307509_1059300123300031507EctomycorrhizaMVRYTKLPTIVRYKVGSVKGKPSEKEYLALTSMRVSTVMLLVSLARSRISATYFD
Ga0307509_1065422923300031507EctomycorrhizaVIVRYAKLPTIVWYKVGFVKGIPSKEEYFALTSMGVSTVLLSISLTR
Ga0307509_1098072013300031507EctomycorrhizaAISGRVMVRYTKLPTIVRYKVGSIKGKPSEEGYLALTLIGVSIVLLSVSLVCSRISATYF
Ga0307508_1010678933300031616EctomycorrhizaMVRYTKIPIIVQYKIGSIKGKPSEEEYLALTSIXVSIVLXSVNLARSRISTTYFD
Ga0307508_1040004113300031616EctomycorrhizaYKIGSIKGKPSEEEYIALTSMGVSTILLSVSLTRLRIYAIYFD
Ga0307508_1043845223300031616EctomycorrhizaMVRYTKLPIIVQYKVGSVKGKPLEEEYLALTSMRVCTVLLLVSLAHLRIFVTYFD
Ga0307508_1058194713300031616EctomycorrhizaMRYTKLPIIVQYKVESIKGKPSEEDTEEEYLALTLIGVSTILLSVSLARSRIS
Ga0307514_1004299853300031649EctomycorrhizaMVRYTKLPIIVWYKVGSEKNKLLEEEYFALTSIGVSIILLSVSLARSRISATFC
Ga0307514_1007171623300031649EctomycorrhizaMVRYTKLPIIVQYKVGSVKGKPLEEEYLALTSMRVCTVLLLVSLAHLRIFATYFD
Ga0307516_1003709743300031730EctomycorrhizaVRYTKLPTIVWYKVESIKGKPSEEEYLALTSIEVSIVLLSVSLARSRISATYFD
Ga0307516_1004507113300031730EctomycorrhizaTIIRYKVEYVKGKPSEEEYPALTSMGISTILLLVSLARSRISTTYFDWERR
Ga0307516_1005913443300031730EctomycorrhizaMRYTKLLTIVWYKVGSDKSKSSEEKYFVLTSMRVFIVLLSVSLAYSRISTIYFD
Ga0307516_1019304223300031730EctomycorrhizaMVTYSKLQTIVRYEVGFVKDKLLEEEYLALTSMGVSTVLLSVSLARSRISATYFN
Ga0307516_1031831923300031730EctomycorrhizaMVRYTKLPIIVQYKVGSVKGKPLEEEYLALTSMRVCTVLLLVSLAYLRIFATYFD
Ga0307516_1078318123300031730EctomycorrhizaMVRYTKLPIIVQYKVGSVKDKPLEEEYLALTSMGVCTVLLLVSLAHLRIFATYFD
Ga0307516_1095830113300031730EctomycorrhizaKGKPSEEGYLALTLIGVSTVLLSVSLVCSRISATYFD
Ga0307518_1000446953300031838EctomycorrhizaVTYSKLQTIVRYEVGFVKDKLLEEEYLALTSIGVSTVLLSVSLARSRISATYFN
Ga0307518_1002924953300031838EctomycorrhizaMVRYTKLPTIVQYKVGLVKGKPSKEEYLALTSMGVSTFLLSVSLARSKISATYFD
Ga0307518_1010016823300031838EctomycorrhizaMVRYINLPIIVWYKVGSVNGIPSEEEYLALTSTEVSIVLLSVSLARSRISATYFD
Ga0307518_1023431613300031838EctomycorrhizaRYKVGSIKGKPSEEEYLALTSIGVSRILLLVSLARSRISATYFD
Ga0307518_1029147813300031838EctomycorrhizaKLPTIVQYKAGPVKCKPSKEEYLALTSMRVSTILLSVSLARLRISIAYFV
Ga0307518_1060578813300031838EctomycorrhizaYKVESIKGKPSEEDIEEEYLALTLIGVSTILLSVSLARSRISATYFDWERR
Ga0325403_1000401103300032354XylemMMRYTKLPTIVWYKVGFIRGKPSEEEYLALTSIGVSTVLLSVSLARSRISAT
Ga0325403_100116633300032354XylemVRYTKLPTIVQYKIGYIKGKPSEEEYLALTSMEVSTILLSVSLARSRISATYFN
Ga0325403_1005387133300032354XylemMVRYTNLPTIVQYKVGFVKGKPSEEENLALTSMRVCIVLLLVSLARLRIFATYFD
Ga0325403_100927283300032354XylemMVRYIKLLTIVQYKVGSIKGKPSEEEYLALTSIRVSTVLLSVSLDRSKISTTYFD
Ga0325403_101615393300032354XylemMVRYAKLSTIGRYKVGSITGKPSEEEYLALTSIGVSTVLLSVSLAHSRISATYFD
Ga0325403_101640113300032354XylemMVRYIKLPIIIRYKVGSVKGKPSKEKYLALTSMGVSTVLLSVSLARSRISATYFD
Ga0325403_101871843300032354XylemMVRYTKLPTIVWYKVGSIKGKPSEEEYLALTSIGVSTVLLSVCLTRSRISATYFD
Ga0325403_101974973300032354XylemMVRYTKLSTIGRYKVGSITGKPSEEEYLALTSMGVFTVLLSVSLARLRISATYSTEKEDN
Ga0325403_102342013300032354XylemMVRYTKLPTIAGYKIGSIKGKPLEEEYTVLTSMGVSTILLSVSLTRLRIYAIYFD
Ga0325403_102583683300032354XylemMVRYTKLPTIAGYKIESIKGKPLEEEYTALTSMGVSTILLSVSLTRLRIYAIYFD
Ga0325403_102896843300032354XylemVRYIKFPTIVRYKIGYGKSKPSEEKYFALTSIGVSTVLLSVSLAHSRISVIYFDXEEDNL
Ga0325403_103203653300032354XylemMVRYTKLPIIVRYNVGSIKGKPSEEEYPALTLIGVSTVLLSVSLARSRISATYFD
Ga0325403_103622413300032354XylemMVRYSKLPMIVRYKVGSIKGKPSEEEYLALTSMGVSTVLLSVSLARSRISATYFD
Ga0325403_103646923300032354XylemMRYIKLPTIVRYKVGSDKGKLSEEEYFALTSIRVSTILLTVSLARLRISATYFD
Ga0325403_104584823300032354XylemMRYTKLPIIVRYKIGSIKGKPSEEEYLALTSMGVSTVLLSVNLAHSRISATYFD
Ga0325403_112600913300032354XylemVRYTKLPIKVWYKVRSDKGKSSEEEYFALTSIGVSTILLSVNLAHSKISATYFD
Ga0325401_100736013300032355XylemVGSDKGKPSKEEYLALTLIRVSTVCLSVSLTSSRISATYFN
Ga0325401_101527853300032355XylemMVRYTKLPIIVQYKVGLVKGKPSKEEYLALTSMRVSTFLLSVSLARSKISATYFD
Ga0325401_102128333300032355XylemMVRYTNLPAILQYKVGSIKVKPLEEEYLALTSIGVSIVLLLVSLVYSRISATYFD
Ga0325401_102703323300032355XylemMMSYTKLPTMVQYKVGYVKDKPSEKEYLALTSMGVSTVLLSVSLSRSRISATYFD
Ga0325401_103739123300032355XylemMRYTKLSIIVQYKVRSVKDKLSEEEYLVLTLMGVSTVLLLVSLARSRISTTYFN
Ga0325401_104490813300032355XylemMVRYTNLPTILQYKVGSIKVKPSEEEYLALTSIGVSIVLLLESLVYSRISATYFD
Ga0325401_108689513300032355XylemMRYTKLLIIVRYKVGSDKGKPSKEEYLALTLIRVSTVCLSVSLTSSRISATYFN
Ga0325401_114562413300032355XylemKGKPSEEEYLALTSIGVSTVLLSVNLARSRISATYFD
Ga0325400_129626523300032374XylemKVGSIKGKPSEEEYLALTSIGVSTVLLSVSLARSRISATYFD
Ga0325405_1002959103300032389XylemMVRYTKLPTIVRYKVGSIKGKPLEEEYLALTSIEVSTVLLSISQARLRISATYFD
Ga0325405_100437493300032389XylemMVRYTKLLTIVRYKVGSVKGKPPEEEYLALTLMTVSTVLLSVSLARSRISATYFD
Ga0325405_100806183300032389XylemVRYIKLPIKVWYKVGSDKGKSSEEEYFALTSIGVSTILLSVNLAHSKISATYFD
Ga0325405_101274773300032389XylemMVRYSKLPMIVRYKVGSIKGKPSEEEYLALTSMRVSTVLLSVSLARSRISATYFD
Ga0325405_101817513300032389XylemMRYTKLLTIVRYKAGSDKDKPSKEEYLALTSIRVSTVCLSVSLTSSRISATYFNSERR
Ga0325405_102669813300032389XylemMRYIKLPIIVRYKVGSIKGKPSEEEYIALTSMGGSTVLLSVNLAHLRISATYFD
Ga0325405_103331123300032389XylemMVRYKVGSDKGKPLKEEYFVLTSMRVSTILLLVTLAHSRIFAIYFN
Ga0325405_105151043300032389XylemMVRYTKLPTIVQYKVGSIKGKPSEEDYLALISIGVYTVLLSVSLARSRISATYFN
Ga0325405_105533033300032389XylemVRYTKLLTIVSYKIGFVKGKPSEEEYLAVTSMEVSIVLLSVSLAHSRISATYFD
Ga0325405_106276033300032389XylemMVRYTKIPTIAQYKVGSIKGEPSEEEYLALTSIGVSTVLLSVSLARLRISATYFD
Ga0325405_107686613300032389XylemMVRYTKLPTIVRYKVGSIKGKPSEEEYLALTSIGVSTVLLS
Ga0325404_100804583300032390XylemMMRYIKLPIIVRYKVGSIKGKPSEEEYIALTSMGGSTVLLSVNLAHLRISATYFD
Ga0325404_104778823300032390XylemMVMYIKLPIIVRYKVGSIKDKPSEEEYLALTSMGVSTILLLVSLVRSEISTASFD
Ga0325404_104932923300032390XylemMVIYIKLPIIVRYKAGSVKDKPSEEEYLVLTSMGVSTILLLVSLVRSEISTASFD
Ga0325410_1000091543300032735XylemMVRYTNLPTIVQYKVGFVKGKPSEEENLALTSMRVCIVLLLVSLARLKIFATYFD
Ga0325414_104502513300032741LeafMVRYTKLPIKVWYKVGSDKGKSSEEEYFALTSIGVSTILLSVNLAHSKISATYFNXEIR
Ga0325414_106934133300032741LeafMVRYTKLPTIVRYNVGSIKGKPSEEEYLALTLIGVSIVLLSVSLARLRISATYFD
Ga0325402_100288443300033160XylemMVRYSKLPMIVRYKVGSIKGKPSEEEYLALTSMGVSTVLLLVSLARSRISATYFD
Ga0325402_107119813300033160XylemEEGSIKGKPSEEEYLALTSMRVFTALLSVSLAHSRIPATYFN
Ga0307507_1003226413300033179EctomycorrhizaSGRVMVRYTKLSTIVQYKVGLVKGKPSKEEYLELTSMGVSTFLLSVSLARSKISATYFD
Ga0307507_1007456653300033179EctomycorrhizaMVRYTKLPTIVRYKVEYIKGKPSEEEYFALTSIGVSTVLLSVSLARSRISATYFD
Ga0307507_1007631413300033179EctomycorrhizaYAISGRVMVRYTKLPTIVRYKVGSIKGKPSEEEYLALTSIGVSRILLLVSLARSRISATNFD
Ga0307510_1001586123300033180EctomycorrhizaMVRYTKLPTIVWYKIGSIKGNLSEEEYLALTSIEVSIVLLAVSLARSRISATYFD
Ga0307510_1007230023300033180EctomycorrhizaMVRYTKLPTIVRYKVEYIKGKPLEEEYLALTSIGVSTVLLSVSLARSRISATYFD
Ga0325419_012707_913_10773300034389LeafMSYTKLPTIVQYKVGYVKDKPSEKEYLALTSMGVSTVLLSVSLSRSRISATYFD
Ga0325419_023100_3040_32223300034389LeafMRYIKFPTIVRYKIGYGKSKPSEEKYFALTSIGVSTVLLSVSLAHSRISVIYFDWEEDNL
Ga0325420_048247_2533_26763300034688LeafTIVRYKVGFVKGKSLEEEYLALTSIGVSTVLLSVSLAHLRISAIYFD
Ga0325420_058395_12_1763300034688LeafMRYTKLPTIVRYKVGYVKGKPSEEEYLVLTSMGVSTVLFLVSLACSRISATYFD
Ga0325421_073027_825_9923300034689LeafMVRYTKLPTIVRYNVGSIKGKPSEEEYLALTLIEVSIVLLSVSLARLRISATYFD
Ga0325407_043511_357_5243300034899XylemMVRYTKLPTIVWYKVGSINGKSSEEEYLALTSIGVSTVLLSVSLACSRISATYFD
Ga0325407_052152_1_1563300034899XylemINLPTIVRYKVGFVKGKSLEEEYLALTSIGVSTVLLSVSLAHLRISAIYFD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.