| Basic Information | |
|---|---|
| Family ID | F092178 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MQAQERDLPGTEAAIAGESLFRSAVSTLTAKSLAIVGASERARWPS |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 91.35 % |
| % of genes near scaffold ends (potentially truncated) | 94.39 % |
| % of genes from short scaffolds (< 2000 bps) | 85.98 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.654 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.037 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.449 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.860 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.65% β-sheet: 0.00% Coil/Unstructured: 51.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF07331 | TctB | 66.36 |
| PF01970 | TctA | 7.48 |
| PF06155 | GBBH-like_N | 2.80 |
| PF12307 | DUF3631 | 1.87 |
| PF13607 | Succ_CoA_lig | 1.87 |
| PF11150 | DUF2927 | 0.93 |
| PF03459 | TOBE | 0.93 |
| PF13643 | DUF4145 | 0.93 |
| PF00589 | Phage_integrase | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG1784 | TctA family transporter | General function prediction only [R] | 7.48 |
| COG3333 | TctA family transporter | General function prediction only [R] | 7.48 |
| COG3536 | Uncharacterized conserved protein, DUF971 family | Function unknown [S] | 2.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.65 % |
| Unclassified | root | N/A | 9.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10014028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2202 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1101728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10127258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300000890|JGI11643J12802_10939677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300000953|JGI11615J12901_10694440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300002074|JGI24748J21848_1036255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300004156|Ga0062589_101534650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300005171|Ga0066677_10446652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 740 | Open in IMG/M |
| 3300005332|Ga0066388_104222290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 732 | Open in IMG/M |
| 3300005334|Ga0068869_100012740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5561 | Open in IMG/M |
| 3300005341|Ga0070691_10040843 | Not Available | 2192 | Open in IMG/M |
| 3300005436|Ga0070713_100071455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2932 | Open in IMG/M |
| 3300005549|Ga0070704_100766510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 860 | Open in IMG/M |
| 3300005557|Ga0066704_10265453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1165 | Open in IMG/M |
| 3300005557|Ga0066704_10382912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 938 | Open in IMG/M |
| 3300005558|Ga0066698_10567664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 769 | Open in IMG/M |
| 3300005764|Ga0066903_100071997 | All Organisms → cellular organisms → Bacteria | 4432 | Open in IMG/M |
| 3300005764|Ga0066903_100423384 | Not Available | 2206 | Open in IMG/M |
| 3300005764|Ga0066903_102781251 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300005764|Ga0066903_108556324 | Not Available | 521 | Open in IMG/M |
| 3300006031|Ga0066651_10473324 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300006046|Ga0066652_100167088 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1862 | Open in IMG/M |
| 3300006058|Ga0075432_10498487 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 542 | Open in IMG/M |
| 3300006353|Ga0075370_10753337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300006573|Ga0074055_11787672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300006854|Ga0075425_100971357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 970 | Open in IMG/M |
| 3300006854|Ga0075425_101630943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300007076|Ga0075435_100329011 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1308 | Open in IMG/M |
| 3300007076|Ga0075435_101574255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300009038|Ga0099829_10120991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2061 | Open in IMG/M |
| 3300010043|Ga0126380_11593394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300010046|Ga0126384_10932257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 786 | Open in IMG/M |
| 3300010046|Ga0126384_11606139 | Not Available | 612 | Open in IMG/M |
| 3300010366|Ga0126379_10218152 | All Organisms → cellular organisms → Bacteria | 1850 | Open in IMG/M |
| 3300010400|Ga0134122_12764467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300011269|Ga0137392_10652564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 872 | Open in IMG/M |
| 3300012199|Ga0137383_11067273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300012355|Ga0137369_11112907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300012363|Ga0137390_11036567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300012915|Ga0157302_10156282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 780 | Open in IMG/M |
| 3300012948|Ga0126375_11254279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300015373|Ga0132257_100670906 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1286 | Open in IMG/M |
| 3300015373|Ga0132257_102360893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 690 | Open in IMG/M |
| 3300016294|Ga0182041_11024451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 747 | Open in IMG/M |
| 3300016357|Ga0182032_10061026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2499 | Open in IMG/M |
| 3300016357|Ga0182032_10686475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 858 | Open in IMG/M |
| 3300016371|Ga0182034_10801374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 806 | Open in IMG/M |
| 3300016371|Ga0182034_10904988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 759 | Open in IMG/M |
| 3300016445|Ga0182038_10710777 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300018027|Ga0184605_10353207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 664 | Open in IMG/M |
| 3300018031|Ga0184634_10478232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300018066|Ga0184617_1103290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 799 | Open in IMG/M |
| 3300018433|Ga0066667_10867720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 774 | Open in IMG/M |
| 3300018433|Ga0066667_10867721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 774 | Open in IMG/M |
| 3300019867|Ga0193704_1016380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1504 | Open in IMG/M |
| 3300021444|Ga0213878_10021992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2355 | Open in IMG/M |
| 3300021560|Ga0126371_10552738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1300 | Open in IMG/M |
| 3300021560|Ga0126371_13097198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300025893|Ga0207682_10142347 | Not Available | 1077 | Open in IMG/M |
| 3300025928|Ga0207700_10073041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2648 | Open in IMG/M |
| 3300026377|Ga0257171_1032576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 892 | Open in IMG/M |
| 3300026446|Ga0257178_1041262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300026542|Ga0209805_1437191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300027633|Ga0208988_1038820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → unclassified Chromatiales → Chromatiales bacterium | 1224 | Open in IMG/M |
| 3300028713|Ga0307303_10100197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300028814|Ga0307302_10138004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1177 | Open in IMG/M |
| 3300028824|Ga0307310_10071861 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1488 | Open in IMG/M |
| 3300028885|Ga0307304_10388208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 629 | Open in IMG/M |
| 3300031152|Ga0307501_10111665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 703 | Open in IMG/M |
| 3300031170|Ga0307498_10015782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1626 | Open in IMG/M |
| 3300031184|Ga0307499_10280224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300031543|Ga0318516_10038631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2555 | Open in IMG/M |
| 3300031549|Ga0318571_10037476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1386 | Open in IMG/M |
| 3300031549|Ga0318571_10265257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300031564|Ga0318573_10466357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 679 | Open in IMG/M |
| 3300031572|Ga0318515_10001176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9002 | Open in IMG/M |
| 3300031572|Ga0318515_10167547 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1173 | Open in IMG/M |
| 3300031640|Ga0318555_10410782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 733 | Open in IMG/M |
| 3300031719|Ga0306917_10132724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1828 | Open in IMG/M |
| 3300031747|Ga0318502_10870403 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300031763|Ga0318537_10126202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 951 | Open in IMG/M |
| 3300031764|Ga0318535_10037555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1973 | Open in IMG/M |
| 3300031770|Ga0318521_10192684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1174 | Open in IMG/M |
| 3300031781|Ga0318547_10205146 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1178 | Open in IMG/M |
| 3300031798|Ga0318523_10575081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300031805|Ga0318497_10371156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 799 | Open in IMG/M |
| 3300031820|Ga0307473_10600660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 760 | Open in IMG/M |
| 3300031831|Ga0318564_10050126 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1816 | Open in IMG/M |
| 3300031833|Ga0310917_10245314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1204 | Open in IMG/M |
| 3300031845|Ga0318511_10105854 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1200 | Open in IMG/M |
| 3300031879|Ga0306919_11019477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 632 | Open in IMG/M |
| 3300031897|Ga0318520_10103344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1601 | Open in IMG/M |
| 3300031910|Ga0306923_11658917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300031912|Ga0306921_10557154 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1329 | Open in IMG/M |
| 3300031912|Ga0306921_10893069 | Not Available | 1009 | Open in IMG/M |
| 3300031942|Ga0310916_10461930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1081 | Open in IMG/M |
| 3300031959|Ga0318530_10093856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1186 | Open in IMG/M |
| 3300032013|Ga0310906_10998205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300032035|Ga0310911_10576734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300032035|Ga0310911_10856567 | Not Available | 525 | Open in IMG/M |
| 3300032039|Ga0318559_10345236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300032090|Ga0318518_10087837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1538 | Open in IMG/M |
| 3300032091|Ga0318577_10178040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1015 | Open in IMG/M |
| 3300032094|Ga0318540_10134218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1180 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.04% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.54% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.67% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.87% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.93% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Host-Associated | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_100140281 | 3300000597 | Forest Soil | MQARERDGAGTAAPSLEQSFFRSAVTTLQAKSLAIVGASERARWPSEIFRNLR |
| AF_2010_repII_A100DRAFT_11017282 | 3300000655 | Forest Soil | MQARERDGAGTAAPSLEQSLFRSAVTTLQAKSLAIVGASER |
| AF_2010_repII_A001DRAFT_101272582 | 3300000793 | Forest Soil | MQARERDGAGTAAPSLEQSFFRSAVTTLQAKSLAIVGASERARWPSEIFRN |
| JGI11643J12802_109396773 | 3300000890 | Soil | MQAWERNVRGTGVARAEQSLFRSAVSTLQAKSLAIVGA |
| JGI11615J12901_106944402 | 3300000953 | Soil | MQAWERNVRGTGVARAEQSLFRSAVSTLQAKSLAIVGASERARWPSEIFKNLH |
| JGI24748J21848_10362551 | 3300002074 | Corn, Switchgrass And Miscanthus Rhizosphere | MQAWERDVPGSGAAKADQSLFRSAVSTLQAKSLAIVGASERARWPSEIFKNL |
| Ga0062589_1015346501 | 3300004156 | Soil | MQAWERNVRGTGVARAEQSLFRSAVSTLQAKSLAIVGASERARWPSEIFKNL |
| Ga0066677_104466522 | 3300005171 | Soil | MQGQERNVPVTETATATASLFRSAVSTLTAKSLAIIGASERARWP |
| Ga0066388_1042222902 | 3300005332 | Tropical Forest Soil | MQAQERDVPVTRTAAATESLFRSAVSTLTANSLAIVGASERARWPSEIFKN |
| Ga0068869_1000127404 | 3300005334 | Miscanthus Rhizosphere | MQAWERDVPGSGAAKADQSLFRSAVSTLQAKSLAIVGASERAR |
| Ga0070691_100408431 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MQAWERDVPGSGAAKADQSLFRSAVSTLQAKSLAIVGASERA |
| Ga0070713_1000714552 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MQAWERDVPGSDAAKADQSLFRSAVSTLQAKSLAIVGASERARWPSEIFKNLR* |
| Ga0070704_1007665102 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MQAQERDVPGTGAATASESLFRSAVSTLQAKSIAIVGASERARWPSEIFK |
| Ga0066704_102654532 | 3300005557 | Soil | MQGQERNVPVTETATATASLFRSAVSTLTAKSLAIIGASERARWPSGIFKNLREFGYP |
| Ga0066704_103829121 | 3300005557 | Soil | MQARERDVASTQATSASLFRSVATTLAGKSLAIVGASERARWPSEIF |
| Ga0066698_105676641 | 3300005558 | Soil | MQGQERNAPVTETPTATASLFRSAVSTLTAKSLAI |
| Ga0066903_1000719971 | 3300005764 | Tropical Forest Soil | MQGQERNVPVTETPTATESLFRSAVSTLTAKSLAI |
| Ga0066903_1004233841 | 3300005764 | Tropical Forest Soil | MQAQERDLSGTEAATATESLFRSAVSTLTAKSLAI |
| Ga0066903_1027812511 | 3300005764 | Tropical Forest Soil | MQAQERNVPVTETASATESLFRSAVSTLTAKSLAIVGASERARWPSEIFKNL |
| Ga0066903_1085563241 | 3300005764 | Tropical Forest Soil | MQAQERDVPVTGIATATESLFRSAVSTLTAKSLAI |
| Ga0066651_104733241 | 3300006031 | Soil | MHSLELDGSVAGAPKAPDLFRSAVSTLQARSLAIVGASERARW |
| Ga0066652_1001670882 | 3300006046 | Soil | MQGQERNAPVTETPTATASLFRSAVSTLTAKSLAIIGASERARWPSEIF |
| Ga0075432_104984871 | 3300006058 | Populus Rhizosphere | MQGQERNAPVTETPTATASLFRSAVSTLTAKSLAIIGASERARWPSEIFKNLREFGYP |
| Ga0075370_107533372 | 3300006353 | Populus Endosphere | MQAWERDVPGSGVAKAEQSLFRSAVSTLQAKSLAIVGASER |
| Ga0074055_117876722 | 3300006573 | Soil | MQAWERDVPGSGAAKADQSLFRSAVSTLQAKSLAIVGASERARWPSE |
| Ga0075425_1009713571 | 3300006854 | Populus Rhizosphere | MQARERDVAGTQAASVSGSLFRSVATTLAAKSLAIVGASER |
| Ga0075425_1016309431 | 3300006854 | Populus Rhizosphere | MQGQERNVPVRETPTATASLFRSAVSTLTAKSLAIIGASERA |
| Ga0075435_1003290112 | 3300007076 | Populus Rhizosphere | MQGQERNVPVTETATATASLFRSAVSTLTAKSLAIIGASERARWPSEIFKNLR |
| Ga0075435_1015742552 | 3300007076 | Populus Rhizosphere | MQGQERNAPVTETPTATASLFRSAVSTLTAKSLAIIGASERARWPSEIFKNLR |
| Ga0099829_101209911 | 3300009038 | Vadose Zone Soil | MQAWEREVPGPGGAKAKKTLFRSAVSTLQAKSLAIVGVSERARWPS* |
| Ga0126380_115933941 | 3300010043 | Tropical Forest Soil | MQARERDVAGTQAASVSGSLFRSVATTLAGKSLAIVGASERARW |
| Ga0126384_109322571 | 3300010046 | Tropical Forest Soil | MQAQERNVPVIETAIATETLFRSAVSTLTAKSLAIVGAS |
| Ga0126384_116061391 | 3300010046 | Tropical Forest Soil | MQAQERDLPGTEAAIAGESLFRSAVSTLTAKSLAIVGA |
| Ga0126379_102181525 | 3300010366 | Tropical Forest Soil | MQAQERDVLVTGTATATESLFRSAVSTLTAKSLAIV |
| Ga0134122_127644672 | 3300010400 | Terrestrial Soil | MTTDDKGLFRSAVSTLQPKSLAIVGASERAKWPSEIYKNLR |
| Ga0137392_106525641 | 3300011269 | Vadose Zone Soil | VPGAGAATADNNTLFRQAASTLQAKSLAIVGASERARWPSEIYRNLR |
| Ga0137383_110672731 | 3300012199 | Vadose Zone Soil | MQARERDVAGTQATSASLFRSVATTLAGKSLAIVGASERARWPSEIFRNLRE |
| Ga0137369_111129071 | 3300012355 | Vadose Zone Soil | MQARERDLSGTEAASAAKSLFRSAVSTLQAKSLAI |
| Ga0137390_109857131 | 3300012363 | Vadose Zone Soil | MTALVKTRDSLFRSAVSTLQAKSLAIVGASERARWPSEIFKNLR |
| Ga0137390_110365672 | 3300012363 | Vadose Zone Soil | VPGAGAATADNNTLFRQAASTLQAKSLAIVGASERARWPSEIYR |
| Ga0157302_101562821 | 3300012915 | Soil | MQAWERDVPGSGAAKADHSLFRSAVSTLQAKSLAIVGASERARWPSE |
| Ga0126375_112542792 | 3300012948 | Tropical Forest Soil | MERDASGTGAAKAETNLFRSAVSTLQAKSVAIVGASERARWPSDIY |
| Ga0132257_1006709061 | 3300015373 | Arabidopsis Rhizosphere | MQAQERNVPVTEIATATESLFRSAVSTLTAKSLAI |
| Ga0132257_1023608932 | 3300015373 | Arabidopsis Rhizosphere | MHSGELEASEAGVVKTGEGLFRSVVSTLQAKSLAIVGASERARWPS |
| Ga0182041_110244512 | 3300016294 | Soil | MQARERDVPVTGTATATESLFRSAVSTLTAKSLAIVGASERARWPSEIF |
| Ga0182032_100610264 | 3300016357 | Soil | MQAQERDVLVTGTATATESLFRSAVSTLTAKSLAIVGASER |
| Ga0182032_106864752 | 3300016357 | Soil | MQARERDVPVTGTATATESLFRSAVSTLTAKSLAIVGASERARWP |
| Ga0182034_108013742 | 3300016371 | Soil | MQAQERDLPGTEAAITGKSLFRSAVSTLTAKSLAIVGASERARWPS |
| Ga0182034_109049882 | 3300016371 | Soil | MQAQERDLPGTEAAIAGENLFRSAASTLTAKSLAIVGASERARWPSEIF |
| Ga0182038_107107771 | 3300016445 | Soil | MQAQKRDVLVTGTATATESLFRSAVSTLTAKSLAIVGASERARWP |
| Ga0184605_103532071 | 3300018027 | Groundwater Sediment | MQAWERDVPGMSAAKAEQSLFRSAVSTLQARSLAIVGASERARWPS |
| Ga0184634_104782322 | 3300018031 | Groundwater Sediment | MQAWERDVPGMSAAKAEQGLFRSAVSTLQAKSLAIVGASERARWPSEIFKNL |
| Ga0184617_11032901 | 3300018066 | Groundwater Sediment | MQAWERDVLGSGAAKADQSLFRSAVSTLQAKSLAIVGASERARWPSEIFKNL |
| Ga0066667_108677202 | 3300018433 | Grasslands Soil | MQARERDVASTQATSASLFRSVATTLAGKSLAIVGASERARWPSEIFRNL |
| Ga0066667_108677212 | 3300018433 | Grasslands Soil | MQARERDVAGTQATSASLFRSVATTLAGKSLAIVGASERARWPSEIFRNL |
| Ga0193704_10163801 | 3300019867 | Soil | MQAWERDVPGMSAAKTEQSLFRSAVSTLQAKSLAIVGASER |
| Ga0213878_100219922 | 3300021444 | Bulk Soil | MQGQERNVPVTETTAATESLFRSAVSTLTAKSLAIVGASERARWPSEIF |
| Ga0126371_105527382 | 3300021560 | Tropical Forest Soil | MQAQERDLPGTEAAVAGKSLFRSAVSTLTAKSLAIV |
| Ga0126371_130971982 | 3300021560 | Tropical Forest Soil | MQAQERDLPGTETAIAGESLFRSAVSTLTAKSLAIVGASERARWPS |
| Ga0207682_101423472 | 3300025893 | Miscanthus Rhizosphere | MQVWERDVPGSGAAKADHSLFRSAVSTLQATSLAIV |
| Ga0207700_100730413 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MQAWERDVPGSDAAKADQSLFRSAVSTLQAKSLAIVGASERARWPSEIFKNLR |
| Ga0257171_10325761 | 3300026377 | Soil | MQARERDVAGTQAASASQGLFRSVATTLAAKSLAIVGASERARW |
| Ga0257178_10412621 | 3300026446 | Soil | MQGQERNVPVTETATATESLFRSAVSTLTAKSLAIIGASERARWPSEIFK |
| Ga0209805_14371912 | 3300026542 | Soil | MQAWERDGAQTGAAKADPNLFRSAVSTLRPASLAIVGASERARWPSEIFSNL |
| Ga0208988_10388202 | 3300027633 | Forest Soil | VSGKSATIENNLFRSAVSALQAKSIAIVGASERAR |
| Ga0307303_101001971 | 3300028713 | Soil | MQAWERDVPGMSAAKAEQSLFRSAVSTLQAKSLAIVGASERA |
| Ga0307302_101380042 | 3300028814 | Soil | MQAWERDVPGMSAAKAEQSLFRSAVSTLQAESLAIV |
| Ga0307310_100718612 | 3300028824 | Soil | MQAWERDVPGMSAAKAEQSLFRSAVSTLQAKSLAIV |
| Ga0307304_103882081 | 3300028885 | Soil | MQAWERDVPGSGEAKADQSLFRSVVSTLQAKSLAIVGASERARWP |
| Ga0307501_101116652 | 3300031152 | Soil | MQAWERDVPGMSAAKAEQSLFRSAVSTLQAKSLAIVGASERARWPSEIFKNLR |
| Ga0307498_100157822 | 3300031170 | Soil | MQAWERDVPGMSAAKAEQGLFRSAISTLQAKSLAIVGASERARWPSE |
| Ga0307499_102802241 | 3300031184 | Soil | MQAWERDVPGMSAAKAEQSLFRSAVSTLQAKSLAIVGASERARWPS |
| Ga0318516_100386311 | 3300031543 | Soil | MQAQERDLPGTEAAIAGESLFRSAVSTLTAKSLAIVG |
| Ga0318571_100374761 | 3300031549 | Soil | MQAQERDLPGTEAAITGKSLFRSAVSTLTAKSLAIVGASE |
| Ga0318571_102652571 | 3300031549 | Soil | MHAWEREGAQSGPAKADANLFRSAVSTLKPASLAIVGASERARWPCEIFS |
| Ga0318573_104663572 | 3300031564 | Soil | MQAQERDLPGTEAAITGKSLFRSAVSTLTAKSLAIVGASERARW |
| Ga0318515_100011761 | 3300031572 | Soil | MQAQERDLPGTEAAIAGESLFRSAVSTLTAKSLAIV |
| Ga0318515_101675472 | 3300031572 | Soil | MQAQERDLPGTEAAIAGESLFRSAVSTLTAKSLAIVGASERARWPS |
| Ga0318555_104107821 | 3300031640 | Soil | MQAQERDLPGTEAAIAGESLFRSAVSTLTAKSLAI |
| Ga0306917_101327241 | 3300031719 | Soil | MQAQERDLPGTEAAIAGENLFRSAASTLTAKSLAIVGASERARWPS |
| Ga0318502_108704031 | 3300031747 | Soil | MQAQKRDVLVTGTATATESLFRSAVSTLTAKSLAIVGASERARWPS |
| Ga0318537_101262022 | 3300031763 | Soil | MQAQERDVLVTGTATATESLFRSAVSTLTAKSLAIVGA |
| Ga0318535_100375552 | 3300031764 | Soil | MQAQERDLPGTEAAITGKSLFRSAVSTLTAQSLAIIGASERARWPSEIFKNLREFGY |
| Ga0318554_102925601 | 3300031765 | Soil | VGVTDVVKAGENLFRSAVSTLQPASLAIVGASERARWPSEIF |
| Ga0318521_101926841 | 3300031770 | Soil | MQGQERNVPVTETAAATESLFRSAVSTLTAKSLAIIGASERA |
| Ga0318547_102051462 | 3300031781 | Soil | MQAQERDLLGTEAAIAGENLFRSAASTLTAKSLAIVGASER |
| Ga0318523_105750811 | 3300031798 | Soil | MHAWEREGAQSGPAKADANLFRSAVSTLKPASLAIVGASERARWPCEIFSNLREF |
| Ga0318497_103711561 | 3300031805 | Soil | MQAQERDVLVTGTATATESLFRSAVSTLTAKSLAIVG |
| Ga0307473_106006601 | 3300031820 | Hardwood Forest Soil | MQGQERNVPVTETPTATESLFRSAVSTLTAKSLAIIGASE |
| Ga0318564_100501261 | 3300031831 | Soil | MQAQERDLPGTEAAIAGESLFRSAVSTLTAKSLAIVGASERARW |
| Ga0310917_102453141 | 3300031833 | Soil | MQAQERDLPGTEAAIAGESLFRSAVSTLTAKSLAIVGASE |
| Ga0318511_101058542 | 3300031845 | Soil | MQAQERDLPGTEAAIAGENLFRSAASTLTAKSLAIVGASERARWPSEIFK |
| Ga0306919_110194771 | 3300031879 | Soil | MQAQERDLPGTEAAIAGENLFRSAASTLTAKSLAIVGASERARWPSEIFKN |
| Ga0318520_101033442 | 3300031897 | Soil | MQAQERDLPGTEAAITGKSLFRSAVSTLTAQSLAIIGASERARW |
| Ga0306923_116589171 | 3300031910 | Soil | MQAQERDLPGTEAAVAGQNLFRSAVSTLTAKSLAIV |
| Ga0306921_105571541 | 3300031912 | Soil | MQAQKRDVLVTGTATATESLFRSAVSTLTAKSLAIVG |
| Ga0306921_108930691 | 3300031912 | Soil | MQARERDVPVTGTATATESLFRSAVSTLTAKSLAI |
| Ga0310916_104619302 | 3300031942 | Soil | MQARERDVPVTGTATATESLFRSAVSTLTAKSLAIVGASERARWPSEIFKN |
| Ga0318530_100938562 | 3300031959 | Soil | MQAQERDLLGTEAAIAGENLFRSAASTLTAKSLAIVGASERARW |
| Ga0310906_109982052 | 3300032013 | Soil | MQAWERDVPGSGAAKADQSLFRSAVSTLQAKSLAIVGASERARW |
| Ga0310911_105767341 | 3300032035 | Soil | MHAWEREGAQSGPAKADANLFRSAVSTLKPASLAIVGASER |
| Ga0310911_108565672 | 3300032035 | Soil | MQAQERDVLVTGTATATESLFRSAVSTLTAKSLAI |
| Ga0318559_103452362 | 3300032039 | Soil | MQAQERDLSGTEAATATESLFRSAVSTLTAKSLAIVGA |
| Ga0318504_105524902 | 3300032063 | Soil | MDVGVTDVVKAGDNLFRSAVSTLQPASLAIVGASERARWPS |
| Ga0318518_100878372 | 3300032090 | Soil | MQARERDGAGTAAPSLEQSLFRSAVTTLQAKSLAIVGASERARW |
| Ga0318577_101780401 | 3300032091 | Soil | MQAQERDLPGTEAAITGKSLFRSAVSTLTAKSLAIVGASERARWPSEI |
| Ga0318540_101342182 | 3300032094 | Soil | MQARERDGAGTAAPSLEQSLFRSAVTTLQAKSLAIVGASE |
| ⦗Top⦘ |