NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092166

Metagenome / Metatranscriptome Family F092166

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092166
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 39 residues
Representative Sequence FYGRMVPFKTSLKGEIEAPKAAYPFLSTLAKWAQQASK
Number of Associated Samples 100
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.07 %
% of genes from short scaffolds (< 2000 bps) 90.65 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.897 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(8.411 % of family members)
Environment Ontology (ENVO) Unclassified
(22.430 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.991 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.24%    β-sheet: 0.00%    Coil/Unstructured: 75.76%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF03279Lip_A_acyltrans 78.50
PF04613LpxD 2.80
PF00581Rhodanese 1.87
PF07883Cupin_2 0.93
PF02449Glyco_hydro_42 0.93
PF00202Aminotran_3 0.93
PF0563523S_rRNA_IVP 0.93
PF13442Cytochrome_CBB3 0.93
PF14602Hexapep_2 0.93
PF12867DinB_2 0.93
PF05299Peptidase_M61 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG1560Palmitoleoyl-ACP: Kdo2-lipid-IV acyltransferase (lipid A biosynthesis)Lipid transport and metabolism [I] 78.50
COG4261Predicted acyltransferase, LPLAT superfamilyGeneral function prediction only [R] 78.50
COG1044UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferaseCell wall/membrane/envelope biogenesis [M] 2.80
COG0308Aminopeptidase N, contains DUF3458 domainAmino acid transport and metabolism [E] 0.93
COG1874Beta-galactosidase GanACarbohydrate transport and metabolism [G] 0.93
COG3975Predicted metalloprotease, contains C-terminal PDZ domainGeneral function prediction only [R] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.90 %
UnclassifiedrootN/A27.10 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002558|JGI25385J37094_10054655All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1325Open in IMG/M
3300004152|Ga0062386_100377145All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1139Open in IMG/M
3300005435|Ga0070714_100200899All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1823Open in IMG/M
3300005543|Ga0070672_100503034All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1048Open in IMG/M
3300005602|Ga0070762_10522288All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter780Open in IMG/M
3300005888|Ga0075289_1042706All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae698Open in IMG/M
3300005921|Ga0070766_10453233Not Available847Open in IMG/M
3300006059|Ga0075017_100247707Not Available1302Open in IMG/M
3300006059|Ga0075017_100455149All Organisms → cellular organisms → Bacteria966Open in IMG/M
3300006162|Ga0075030_100690608All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium TAA 166808Open in IMG/M
3300006354|Ga0075021_10821257All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae601Open in IMG/M
3300009012|Ga0066710_101997410All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300009038|Ga0099829_10441459All Organisms → cellular organisms → Bacteria → Acidobacteria1078Open in IMG/M
3300009623|Ga0116133_1175199Not Available569Open in IMG/M
3300009638|Ga0116113_1018697All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1515Open in IMG/M
3300009638|Ga0116113_1203107Not Available513Open in IMG/M
3300009639|Ga0116122_1140965All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300009660|Ga0105854_1101596Not Available898Open in IMG/M
3300009672|Ga0116215_1453500All Organisms → cellular organisms → Bacteria → Acidobacteria555Open in IMG/M
3300010320|Ga0134109_10412641Not Available542Open in IMG/M
3300010360|Ga0126372_10033073Not Available3280Open in IMG/M
3300010366|Ga0126379_12972699All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300010376|Ga0126381_101238665Not Available1078Open in IMG/M
3300010376|Ga0126381_103885526All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium583Open in IMG/M
3300010379|Ga0136449_101721089Not Available943Open in IMG/M
3300010379|Ga0136449_102796908All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium689Open in IMG/M
3300010396|Ga0134126_10064766All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4546Open in IMG/M
3300011119|Ga0105246_10289647All Organisms → cellular organisms → Bacteria1317Open in IMG/M
3300011270|Ga0137391_10899691All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300012210|Ga0137378_11643485All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300012363|Ga0137390_11650391All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium577Open in IMG/M
3300012917|Ga0137395_10509561Not Available867Open in IMG/M
3300012923|Ga0137359_11490736All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300012925|Ga0137419_10750089All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300012929|Ga0137404_10097081All Organisms → cellular organisms → Bacteria2369Open in IMG/M
3300012929|Ga0137404_11437983Not Available637Open in IMG/M
3300012989|Ga0164305_11617011All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300013296|Ga0157374_10564872All Organisms → cellular organisms → Bacteria1146Open in IMG/M
3300013297|Ga0157378_10628528All Organisms → cellular organisms → Bacteria1088Open in IMG/M
3300014151|Ga0181539_1068859All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1579Open in IMG/M
3300014155|Ga0181524_10263511Not Available803Open in IMG/M
3300014158|Ga0181521_10284669All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300014165|Ga0181523_10398185All Organisms → cellular organisms → Bacteria → Acidobacteria767Open in IMG/M
3300014167|Ga0181528_10346476Not Available806Open in IMG/M
3300014200|Ga0181526_10296483All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1030Open in IMG/M
3300015372|Ga0132256_100231305All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1909Open in IMG/M
3300017929|Ga0187849_1352374All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300017930|Ga0187825_10169029All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300017935|Ga0187848_10479225All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300017943|Ga0187819_10428940All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300017973|Ga0187780_11339053All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8527Open in IMG/M
3300017995|Ga0187816_10415958All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300018012|Ga0187810_10205321Not Available802Open in IMG/M
3300018057|Ga0187858_10710284All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium599Open in IMG/M
3300018090|Ga0187770_11162716Not Available623Open in IMG/M
3300019284|Ga0187797_1854242All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300020579|Ga0210407_10654876Not Available816Open in IMG/M
3300020582|Ga0210395_11288873All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300021171|Ga0210405_10372989All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300021406|Ga0210386_10014780All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis6094Open in IMG/M
3300021420|Ga0210394_10915719All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300024227|Ga0228598_1051290All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium818Open in IMG/M
3300024271|Ga0224564_1116167All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300025812|Ga0208457_1095457All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300025909|Ga0207705_10071709All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2511Open in IMG/M
3300025922|Ga0207646_10300679Not Available1450Open in IMG/M
3300025923|Ga0207681_11389681All Organisms → cellular organisms → Bacteria → Acidobacteria589Open in IMG/M
3300025944|Ga0207661_10341592Not Available1349Open in IMG/M
3300025945|Ga0207679_11047733Not Available748Open in IMG/M
3300025986|Ga0207658_10697765Not Available917Open in IMG/M
3300025986|Ga0207658_12124090All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300026088|Ga0207641_10636337All Organisms → cellular organisms → Bacteria1047Open in IMG/M
3300026142|Ga0207698_11760250All Organisms → cellular organisms → Bacteria → Acidobacteria635Open in IMG/M
3300026294|Ga0209839_10179888All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300026514|Ga0257168_1096856All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300026538|Ga0209056_10029111All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5240Open in IMG/M
3300027432|Ga0209421_1058911Not Available769Open in IMG/M
3300027497|Ga0208199_1027946All Organisms → cellular organisms → Bacteria1241Open in IMG/M
3300027610|Ga0209528_1130348All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300027635|Ga0209625_1072271All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300027729|Ga0209248_10067903Not Available1084Open in IMG/M
3300027803|Ga0209910_10052738All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300027825|Ga0209039_10301758All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium630Open in IMG/M
3300027894|Ga0209068_10636025All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300027898|Ga0209067_10261845Not Available943Open in IMG/M
3300028665|Ga0302160_10021338All Organisms → cellular organisms → Bacteria1192Open in IMG/M
3300028678|Ga0302165_10031843Not Available1413Open in IMG/M
3300028747|Ga0302219_10268673All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300028788|Ga0302189_10411088All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300028873|Ga0302197_10411662All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300029918|Ga0302143_1186542All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300029954|Ga0311331_10082678All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4212Open in IMG/M
3300029954|Ga0311331_10311758Not Available1666Open in IMG/M
3300030019|Ga0311348_10388070All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300030058|Ga0302179_10034191All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2354Open in IMG/M
3300030494|Ga0310037_10263894All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300031234|Ga0302325_12114608All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium689Open in IMG/M
3300031247|Ga0265340_10224669Not Available841Open in IMG/M
3300031249|Ga0265339_10052750All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2214Open in IMG/M
3300031708|Ga0310686_109533643All Organisms → cellular organisms → Bacteria1913Open in IMG/M
3300031718|Ga0307474_10642148All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis837Open in IMG/M
3300031820|Ga0307473_10213248Not Available1156Open in IMG/M
3300032174|Ga0307470_10438471Not Available936Open in IMG/M
3300032828|Ga0335080_10001830All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae21188Open in IMG/M
3300032892|Ga0335081_11114103Not Available908Open in IMG/M
3300033433|Ga0326726_12118900All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300034090|Ga0326723_0104568All Organisms → cellular organisms → Bacteria1226Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.41%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog5.61%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds5.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.67%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.67%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog4.67%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.74%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.74%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.80%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.80%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.80%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.80%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.80%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.87%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.87%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.87%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.87%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.87%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.93%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.93%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.93%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.93%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cmEnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005888Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009660Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025812Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027610Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027803Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712S3SEnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028665Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3EnvironmentalOpen in IMG/M
3300028678Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_2EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2EnvironmentalOpen in IMG/M
3300028873Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1EnvironmentalOpen in IMG/M
3300029918Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1EnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25385J37094_1005465523300002558Grasslands SoilIKQDKDSTREFYNRMVPFKTALTGTIDAPANAYPLLSTLAKWAKTASEK*
Ga0062386_10037714523300004152Bog Forest SoilEFYGRMVPFKTSLQGEIEAPKAAYSFLSSLAKWAQEAAK*
Ga0070714_10020089933300005435Agricultural SoilTSTREFYGRMVPFRTSLTGEIQSPEGGRPLLVSLSKFATEAAK*
Ga0070672_10050303413300005543Miscanthus RhizosphereSTREFYARMVPFKTALTGTIPAPDSAYPFLNTLSKWATKAASK*
Ga0070762_1052228823300005602SoilRDFYGRMVPFKTSLKGEVEAPKASYPFLSTLAKWAQVAAK*
Ga0075289_104270633300005888Rice Paddy SoilSSTREFYGRMVPFKTALKAQIAAPDEAFPFLNALAKWAVVAAQG*
Ga0070766_1045323323300005921SoilGRMVPFKTSLKGTIDPPANAFPFLNTLAKWAKTAAASK*
Ga0075017_10024770723300006059WatershedsGRMVPFKTSLKGEVEAPKSAYPFLSPLAKWAQVASK*
Ga0075017_10045514933300006059WatershedsSTREFYGRMVPFKTALKGDIEAPKAAYPFLSTLAKWAQQASK*
Ga0075030_10069060823300006162WatershedsKDSTREFYGRMVPFRTALKGEIETPKAAYPFLSTLAKWAQQASK*
Ga0075021_1082125723300006354WatershedsFYNRMVPFKTSLTGTIEPPPNAYPFLSTLAKWAKTAATK*
Ga0066710_10199741013300009012Grasslands SoilTREFYNRMVPFKTSLTGTIDAPQGAYPFLNVLAKWAKTAAAK
Ga0099829_1044145943300009038Vadose Zone SoilREFYGRMVPFKTSLTGEIETPKAAYPFLSTLAKWAQQASK*
Ga0116133_117519913300009623PeatlandYGRMVPFKTSLTGEIDAPKGAYPFLSTLAKWAQIASR*
Ga0116113_101869723300009638PeatlandRMVPFKTSLKGEVDAPKDAYPFLSSLAKWAVEAAK*
Ga0116113_120310723300009638PeatlandDSTREFYGRMVPFKTSLTGEIDAPKGAYPFLSTLAKWAQIASR*
Ga0116122_114096513300009639PeatlandMVPFKTSLKGDIEAPQAAYPFLSTLAKWAQEAAK*
Ga0105854_110159613300009660Permafrost SoilMVPFKTSLKGTIPPPPDANVFLTTLAKWAQVAAK*
Ga0116215_145350013300009672Peatlands SoilNGAVIKQDEASTREFYGSMVPFKTSLKGEIDPPKPSLPFLDTLAKWAKNAG*
Ga0134109_1041264113300010320Grasslands SoilVPFKTALTGTIDAPANAYPLLSTLARWAKTASEK*
Ga0126372_1003307343300010360Tropical Forest SoilMVPFKTSLQGNIEAPKNAYPFLNTLAKWAQEAAKK*
Ga0126379_1297269913300010366Tropical Forest SoilMVPFKTSLTGEIEPPQGAYPFLSVLAKWAKVAADK*
Ga0126381_10123866513300010376Tropical Forest SoilSTREFYGRMVPFKTSLSGEIEAPGTAYPFLSTLAKWAKTAANK*
Ga0126381_10388552613300010376Tropical Forest SoilSTREFYGRMVPFKTSLSGEIEAPGTAYPFLSTLAKWAKTAADK*
Ga0136449_10172108913300010379Peatlands SoilESTREFYGRMVPFPTSLKGEIEAPKDAYPFLSTLAKWALQAAK*
Ga0136449_10279690823300010379Peatlands SoilEFYGRMVPFKTSLKGEIDAPKDAYPFLSTLAKWALQAAK*
Ga0134126_1006476673300010396Terrestrial SoilFYGRMVPFRTSLKGTIDAPPNAYPFLNTLAKWAKTAATK*
Ga0105246_1028964713300011119Miscanthus RhizosphereKDSTREFYGRLVPFKTSLTGSIDAPANAYPFLNTLAKWAKTAATK*
Ga0137391_1089969123300011270Vadose Zone SoilRMVPFKTSLTGEVDPPAGANTFLTALAKWAQEASK*
Ga0137378_1164348523300012210Vadose Zone SoilYGRMVPFKTSLTGTIDAPAGAYPFLSVLAKWAKTASEK*
Ga0137390_1165039123300012363Vadose Zone SoilFYGRMVPFKTSLKGEIEAPKAAYPFLSTLAKWAQQASK*
Ga0137395_1050956123300012917Vadose Zone SoilIVPFKTSLTGTIGPPSNAYPFLNTLAKWAKTAAAAK*
Ga0137359_1149073623300012923Vadose Zone SoilRDFYGRMVPFKTSLEGNIEAPQAAFPFLNTLAKWAKAAEGK*
Ga0137419_1075008923300012925Vadose Zone SoilFYGRMVPFKTSLTGTIDPPPNAYPLLNTLAKWAKTAATAK*
Ga0137404_1009708143300012929Vadose Zone SoilYGRMVPFRTSLTGKVEAPQGAYPFLNTLAKWAKKAADK*
Ga0137404_1143798323300012929Vadose Zone SoilMVPFKTSLQGTIDAPDTAYPFLSTLAKWAKAAASK*
Ga0164305_1161701123300012989SoilKDATREFYERMVPFKTSLTGNVEAPAAANSFLTTLAHWAQSAAKK*
Ga0157374_1056487213300013296Miscanthus RhizosphereFYGRMVPFKTSLSGTIDAPENARPLLETIAKWAKTSADK*
Ga0157378_1062852823300013297Miscanthus RhizosphereRMVPFKTSLQGTIPAPDAAYPFLSTLAKWAKEAAKK*
Ga0181539_106885933300014151BogFYGHMVPSKTALKGEIEAPKAAYPFLNTLAKWAQQAAK*
Ga0181524_1026351123300014155BogYGHMVPSKTALKGEIEAPKAAYPFLNTLAKWAQQAAK*
Ga0181521_1028466913300014158BogTREFYGRMVPFKTSLKGEVEAPKAAYPFLSTLAKWAQQAAK*
Ga0181523_1039818513300014165BogGRMVPFKTSLVGEIDPPAGANAFLSSLAKWAQEAAK*
Ga0181528_1034647613300014167BogRDFYGRMVPFKTSLTGAVEAPKNAYPFLSSLAKWAQQASK*
Ga0181526_1029648313300014200BogDFYGRMVPFKTSLKGEVEAPKAAYPFLSTLAKWAQQASK*
Ga0132256_10023130513300015372Arabidopsis RhizosphereARMVPFKTALTGTIPAPDSAYPFLNTLSKWATKAASK*
Ga0187849_135237413300017929PeatlandGSTREFYGRMVPFKTSLKGEIEAPKAAYPFLSTLAKWAQQAAK
Ga0187825_1016902923300017930Freshwater SedimentYGRMVPFKTSLTGEIDAPAGANAFLTTLAKWAQEASK
Ga0187848_1047922523300017935PeatlandFYGRMVPFKTSLKVEVEAPKAAYPFLSTLAKWAQQASK
Ga0187819_1042894023300017943Freshwater SedimentSTREFYGSMVPFKTSLKGEIDPPKPSMPFLDTLAKWAKNAG
Ga0187780_1133905313300017973Tropical PeatlandRDFYGRMVPFKTSLKGDIEAPKDAYPFLNTRAKWAQIASK
Ga0187816_1041595823300017995Freshwater SedimentDFYGRMVPFKTSLKGEIEAPKSAYPFLSTLAKWAQAASK
Ga0187810_1020532113300018012Freshwater SedimentSTRDFYGRMVPFKTSLTGEIDAPKSAYPFLSTLAKWAQQASK
Ga0187858_1071028423300018057PeatlandFYGRMVPFKTSLKGDIEAPKDAYPFLSTLAKWAQEAAK
Ga0187770_1116271613300018090Tropical PeatlandKNATRDFYGHMVLSKTSLQGQIEAPKEAYPFLETLAKWAKAAAGK
Ga0187797_185424213300019284PeatlandFYGRMVPFKTSLKGDIEAPNSAYPFLSSLAKWAQIAAK
Ga0210407_1065487613300020579SoilEFFGRMVPFKTSLKGEIEAPKAAYPFLSTLAKWAQQASK
Ga0210395_1128887313300020582SoilRMVPFRTSLIGEIDPPAGANAFLTSLAKWAQDAAK
Ga0210405_1037298923300021171SoilYGRMVPFRTSLVGEIEPPPGANAFLTALAQWAQEAAK
Ga0210386_1001478073300021406SoilMVPFKTSLTGEVEAPAGAFPFLNSLAKWAKSASSK
Ga0210394_1091571913300021420SoilQDKDSTREFYGHMVPFDTALHGTIEAPKSAFPFLDTLAKWAKAAG
Ga0228598_105129023300024227RhizosphereRMVPFRTSLTGEIDPPAGANAFLRTLAQWAQDAAK
Ga0224564_111616723300024271SoilDFYGRMVPFKTSLKGEVDAPKDAYPFLSSLAKWAQEAAK
Ga0208457_109545723300025812PeatlandDKESTYEFYGRMVPFKTSLRGEIEAPKAAYPFLSTLAKWAQQAAK
Ga0207705_1007170913300025909Corn RhizosphereREFYGRMVPFKTALTGTIPAPDSAYPFLNTLSKWATKAASK
Ga0207646_1030067933300025922Corn, Switchgrass And Miscanthus RhizosphereMVPFKTSLEGSIDAPQTAYPFLNTLAKWGKAAEKK
Ga0207681_1138968113300025923Switchgrass RhizosphereTREFYARMVPFKTALTGTIPAPDSAYPFLNTLSKWATKAASK
Ga0207661_1034159213300025944Corn RhizosphereREFYARMVPFKTALTGTIPAPDSAYPFLNTLSKWATKAASK
Ga0207679_1104773313300025945Corn RhizosphereMVPFKTSLTGSIDAPANAYPFLNTLAKWAKTAATK
Ga0207658_1069776523300025986Switchgrass RhizosphereGRMVPFKTSLQGTIDPPDTAYPFLSTLAKWAKEAASK
Ga0207658_1212409013300025986Switchgrass RhizosphereRMVPFKTSLTGTIEAPKNAYPFLNTLAKWAKNAASK
Ga0207641_1063633723300026088Switchgrass RhizosphereMVPFRTSLKGTIDAPPNAYPFLNTLAKWAKTAATK
Ga0207698_1176025023300026142Corn RhizosphereGRMVPFRTSLQGTVDAPAGAYPFLQTLSKWAKVAAK
Ga0209839_1017988823300026294SoilGHNVTFRNSLKGNIEAPKASYPFLDTLAKWAKAAS
Ga0257168_109685623300026514SoilTREFFGRMVPFKTSLKGEIEAPKAAYPFLSTLAKWAQQASK
Ga0209056_1002911163300026538SoilYGRMVPFRTALTGEIEPPAAANPFLSTLAKWAQEAAK
Ga0209421_105891113300027432Forest SoilSTREFYGRMVPFRTSLQETIEAPKAAYPFLSTLAKWAKTASQ
Ga0208199_102794623300027497Peatlands SoilREFYGRMVPFPTSLKGEIEAPKDAYPFLSTLAKWALQAAK
Ga0209528_113034823300027610Forest SoilREFYGRMVPFKTALTGEIDPPAGSNVFLMGLAQWAQAAAK
Ga0209625_107227113300027635Forest SoilYGRMVPFKTALTGEIDPPAGSNVFLMGLAQWAQAAAK
Ga0209248_1006790313300027729Bog Forest SoilYGRMVPFKTSLKGEVDAPKDAYPFLSSLAKWAQEAAK
Ga0209910_1005273813300027803Thawing PermafrostGRMVPFKTALKGEIDAPKDAYPFLSTLAKWAQQAAK
Ga0209039_1030175823300027825Bog Forest SoilGRMVPFKTSLKGDIETPKAAYPFLSTLAKWAQEAAK
Ga0209068_1063602523300027894WatershedsSQDKDATRQFYNRMVPFKTSLTGTIEPPPNAYPFLSTLAKWAKTAATK
Ga0209067_1026184523300027898WatershedsKDSTREFYGRMVPFKTALKGDIEAPKAAYPFLSTLAKWAQQAAK
Ga0302160_1002133813300028665FenRMVPFKTSLKGEVEAPKMAYPFLSSLAKWAQQAAK
Ga0302165_1003184313300028678FenRDFYSRMVPFRTSLQGNIDAPQAAYPFLSTLAKWAKSAESK
Ga0302219_1026867313300028747PalsaFYGHMVPFKTSLKGEIEAPQAAYPFLSTLAKWAQQASK
Ga0302189_1041108823300028788BogFYGRMVPFKTSLTGEIEAPPVANSFLTTLAKWAQEAAK
Ga0302197_1041166213300028873BogGRMVPFKTSLTGAVEAPKNAYPFLSSLAKWAQQASK
Ga0302143_118654213300029918BogYGRMVPFKTSLTGEIEAPPVANSFLTTLAKWAQEAAK
Ga0311331_1008267863300029954BogSTRDFYGRMVPFKTSLTGAVEAPKNAYPFLSSLAKWAQQASK
Ga0311331_1031175833300029954BogREFYGRMVPFRTSLVGEIDAPAGANAFLTSLAKWAQEAAK
Ga0311348_1038807013300030019FenFYGRMVPFKTSLKGEVEAPKMAYPFLSSLAKWAQQAAK
Ga0302179_1003419113300030058PalsaKQDKDSTREFYGHMVPFKTSLKGEIEAPQAAYPFLSTLAKWAQQASK
Ga0310037_1026389423300030494Peatlands SoilFYGRMVPFNTSLKGTIEAPKTAYPFLDTLAKWAKASS
Ga0302325_1211460813300031234PalsaEFYGHMVPFDTSLHSTIDTPKTAYPFLDTLAKWAKAVS
Ga0265340_1022466923300031247RhizosphereYEFYGHLVPFKTALKGQIEAPKAAYPFLGTLAKFAQHAAREKE
Ga0265339_1005275013300031249RhizosphereKDSTRDFYGHMVPFKTSLKGEVEAPKAAYPFLSTLAKWAQQAAK
Ga0310686_10953364333300031708SoilREFYGRMVPFKTSLKGEVDAPKTAYPFLSTLAKWAQVASK
Ga0307474_1064214823300031718Hardwood Forest SoilKQDKDSTREFYGHMVPFKTSLKGEIEAPQASYPFLSTLAKWAQQAAK
Ga0307473_1021324813300031820Hardwood Forest SoilGRMVPFKTSLEGNIEAPQAAYPFLNTLAKWAKAAEGK
Ga0307470_1043847123300032174Hardwood Forest SoilGRMVPFRTSLTGEIEAPAGAHEFLSSLAQWAQEAAK
Ga0335080_1000183013300032828SoilFYGRMVPFKTALTGTIDAPKEAYPLLDTLAKWAKAAAAK
Ga0335081_1111410323300032892SoilREFYGRMVPFKTSLQGDIEAPKSAYPFLSSLAKWAKAAEK
Ga0326726_1211890013300033433Peat SoilRMVPFKTSLTGTIDAPANAYPFLSTLAKWAKTAAEK
Ga0326723_0104568_1099_12063300034090Peat SoilMVPFKTSLTGTIDAPANAYPFLNTLAKWAKTAATK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.