NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092138

Metagenome / Metatranscriptome Family F092138

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092138
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 44 residues
Representative Sequence MGNRRLDAKAFGLIAALLVLTGAVVLWVRRRNWTDHDVSDPGVTL
Number of Associated Samples 90
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 49.53 %
% of genes near scaffold ends (potentially truncated) 40.19 %
% of genes from short scaffolds (< 2000 bps) 83.18 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (65.421 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(27.103 % of family members)
Environment Ontology (ENVO) Unclassified
(24.299 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.121 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 49.32%    β-sheet: 0.00%    Coil/Unstructured: 50.68%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF12802MarR_2 7.48
PF03640Lipoprotein_15 2.80
PF01120Alpha_L_fucos 2.80
PF01266DAO 2.80
PF12680SnoaL_2 1.87
PF00571CBS 1.87
PF01565FAD_binding_4 1.87
PF08031BBE 1.87
PF13551HTH_29 0.93
PF00561Abhydrolase_1 0.93
PF02517Rce1-like 0.93
PF03633Glyco_hydro_65C 0.93
PF00079Serpin 0.93
PF13649Methyltransf_25 0.93
PF11716MDMPI_N 0.93
PF00069Pkinase 0.93
PF09924LPG_synthase_C 0.93
PF10009DUF2252 0.93
PF00884Sulfatase 0.93
PF04402SIMPL 0.93
PF04545Sigma70_r4 0.93
PF03098An_peroxidase 0.93
PF01595CNNM 0.93
PF00211Guanylate_cyc 0.93
PF01609DDE_Tnp_1 0.93
PF13302Acetyltransf_3 0.93
PF13701DDE_Tnp_1_4 0.93
PF08922DUF1905 0.93
PF01451LMWPc 0.93
PF13412HTH_24 0.93
PF13474SnoaL_3 0.93
PF09903DUF2130 0.93
PF00122E1-E2_ATPase 0.93
PF01152Bac_globin 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.74
COG4315Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown)Function unknown [S] 2.80
COG3669Alpha-L-fucosidaseCarbohydrate transport and metabolism [G] 2.80
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 1.87
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.93
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.93
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.93
COG5421TransposaseMobilome: prophages, transposons [X] 0.93
COG4826Serine protease inhibitorPosttranslational modification, protein turnover, chaperones [O] 0.93
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.93
COG3471Predicted secreted (periplasmic) proteinFunction unknown [S] 0.93
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.93
COG3293TransposaseMobilome: prophages, transposons [X] 0.93
COG2968Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domainFunction unknown [S] 0.93
COG2859Outer membrane channel-forming protein BP26/OMP28, SIMPL familyCell wall/membrane/envelope biogenesis [M] 0.93
COG2346Truncated hemoglobin YjbIInorganic ion transport and metabolism [P] 0.93
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.93
COG2216K+ transport ATPase, ATPase subunit KdpBInorganic ion transport and metabolism [P] 0.93
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.93
COG1554Phosphatase/phosphodiesterase/kojibiose phosphorylase YcjT/PafA/Npp1, AlkP superfamilyCarbohydrate transport and metabolism [G] 0.93
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.93
COG0474Magnesium-transporting ATPase (P-type)Inorganic ion transport and metabolism [P] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms65.42 %
UnclassifiedrootN/A34.58 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_100605636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. 7K5341437Open in IMG/M
3300001431|F14TB_100768119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales591Open in IMG/M
3300004463|Ga0063356_102349057All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300004479|Ga0062595_102203396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia540Open in IMG/M
3300005354|Ga0070675_101642848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermacoccaceae → Flexivirga → Flexivirga oryzae593Open in IMG/M
3300005365|Ga0070688_101820308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales500Open in IMG/M
3300005440|Ga0070705_101940467Not Available502Open in IMG/M
3300005466|Ga0070685_10036696All Organisms → cellular organisms → Bacteria2772Open in IMG/M
3300005764|Ga0066903_100468574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2116Open in IMG/M
3300005764|Ga0066903_103962785Not Available794Open in IMG/M
3300005842|Ga0068858_100028848All Organisms → cellular organisms → Bacteria5153Open in IMG/M
3300006358|Ga0068871_100964923Not Available792Open in IMG/M
3300006579|Ga0074054_10970599Not Available585Open in IMG/M
3300006881|Ga0068865_100087316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2254Open in IMG/M
3300009012|Ga0066710_100752777All Organisms → cellular organisms → Bacteria1490Open in IMG/M
3300009101|Ga0105247_10532449Not Available861Open in IMG/M
3300009545|Ga0105237_11491911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia683Open in IMG/M
3300009789|Ga0126307_11384783Not Available570Open in IMG/M
3300009840|Ga0126313_10592426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria893Open in IMG/M
3300009840|Ga0126313_10951464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia702Open in IMG/M
3300009840|Ga0126313_11589143All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia544Open in IMG/M
3300010036|Ga0126305_10907412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia602Open in IMG/M
3300010037|Ga0126304_10396531All Organisms → cellular organisms → Bacteria → Terrabacteria group921Open in IMG/M
3300010037|Ga0126304_10820546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria631Open in IMG/M
3300010038|Ga0126315_10773216Not Available631Open in IMG/M
3300010042|Ga0126314_10892678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales657Open in IMG/M
3300010145|Ga0126321_1468646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia577Open in IMG/M
3300010166|Ga0126306_10004037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8621Open in IMG/M
3300010166|Ga0126306_10419748All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300010373|Ga0134128_11866381Not Available661Open in IMG/M
3300010403|Ga0134123_10315683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermacoccaceae → Flexivirga → Flexivirga oryzae1393Open in IMG/M
3300012004|Ga0120134_1058617All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300012019|Ga0120139_1094772Not Available745Open in IMG/M
3300012204|Ga0137374_10828559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria684Open in IMG/M
3300012204|Ga0137374_11163748Not Available543Open in IMG/M
3300012206|Ga0137380_10018748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6346Open in IMG/M
3300012206|Ga0137380_11761323Not Available503Open in IMG/M
3300012349|Ga0137387_10098194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium2037Open in IMG/M
3300012350|Ga0137372_11199906Not Available512Open in IMG/M
3300012360|Ga0137375_11305970Not Available547Open in IMG/M
3300012469|Ga0150984_101140612Not Available1239Open in IMG/M
3300012469|Ga0150984_102378207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Microlunatus → Microlunatus panaciterrae1053Open in IMG/M
3300012469|Ga0150984_122134601Not Available546Open in IMG/M
3300012478|Ga0157328_1021272Not Available550Open in IMG/M
3300012481|Ga0157320_1003010Not Available995Open in IMG/M
3300012494|Ga0157341_1009268Not Available817Open in IMG/M
3300012507|Ga0157342_1002401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales1517Open in IMG/M
3300012939|Ga0162650_100077576Not Available572Open in IMG/M
3300012955|Ga0164298_10012662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3351Open in IMG/M
3300012958|Ga0164299_11476837Not Available529Open in IMG/M
3300012987|Ga0164307_11699907Not Available535Open in IMG/M
3300012989|Ga0164305_10070551Not Available2134Open in IMG/M
3300012989|Ga0164305_11753900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300013102|Ga0157371_11335656Not Available555Open in IMG/M
3300013297|Ga0157378_11274920Not Available775Open in IMG/M
3300015077|Ga0173483_10421580Not Available691Open in IMG/M
3300015371|Ga0132258_10733220All Organisms → cellular organisms → Bacteria → Terrabacteria group2489Open in IMG/M
3300015371|Ga0132258_10946360Not Available2176Open in IMG/M
3300015372|Ga0132256_100079820All Organisms → cellular organisms → Bacteria → Terrabacteria group3127Open in IMG/M
3300015374|Ga0132255_101979882Not Available887Open in IMG/M
3300017965|Ga0190266_10653756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium647Open in IMG/M
3300017997|Ga0184610_1292206Not Available537Open in IMG/M
3300018000|Ga0184604_10340714Not Available533Open in IMG/M
3300018028|Ga0184608_10156289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter985Open in IMG/M
3300018028|Ga0184608_10362111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia635Open in IMG/M
3300018061|Ga0184619_10170422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter997Open in IMG/M
3300018072|Ga0184635_10046290Not Available1672Open in IMG/M
3300018073|Ga0184624_10146568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1036Open in IMG/M
3300018073|Ga0184624_10222520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia844Open in IMG/M
3300018076|Ga0184609_10483633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia566Open in IMG/M
3300018078|Ga0184612_10081804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1686Open in IMG/M
3300018081|Ga0184625_10262775All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300018432|Ga0190275_12579869Not Available585Open in IMG/M
3300018466|Ga0190268_11100838Not Available646Open in IMG/M
3300019377|Ga0190264_10237751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1044Open in IMG/M
3300019767|Ga0190267_10235136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia892Open in IMG/M
3300019869|Ga0193705_1076583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter651Open in IMG/M
3300021078|Ga0210381_10115298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter885Open in IMG/M
3300022534|Ga0224452_1070806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1051Open in IMG/M
3300022694|Ga0222623_10150509All Organisms → cellular organisms → Bacteria → Terrabacteria group906Open in IMG/M
3300025926|Ga0207659_10576302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria958Open in IMG/M
3300025929|Ga0207664_10092664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2480Open in IMG/M
3300025931|Ga0207644_11807251Not Available511Open in IMG/M
3300025932|Ga0207690_10146621Not Available1746Open in IMG/M
3300028718|Ga0307307_10005924All Organisms → cellular organisms → Bacteria3143Open in IMG/M
3300028719|Ga0307301_10219668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia618Open in IMG/M
3300028722|Ga0307319_10066176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales1142Open in IMG/M
3300028744|Ga0307318_10029148Not Available1793Open in IMG/M
3300028744|Ga0307318_10047242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1422Open in IMG/M
3300028744|Ga0307318_10101312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter974Open in IMG/M
3300028744|Ga0307318_10161654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia770Open in IMG/M
3300028754|Ga0307297_10198497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter700Open in IMG/M
3300028771|Ga0307320_10026645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2098Open in IMG/M
3300028782|Ga0307306_10199537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter572Open in IMG/M
3300028784|Ga0307282_10015318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3149Open in IMG/M
3300028796|Ga0307287_10066894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Modestobacter1336Open in IMG/M
3300028814|Ga0307302_10091172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae1450Open in IMG/M
3300030006|Ga0299907_10207346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae1617Open in IMG/M
3300030006|Ga0299907_10462841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1008Open in IMG/M
3300030496|Ga0268240_10014179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1417Open in IMG/M
3300031092|Ga0308204_10010996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1653Open in IMG/M
3300031545|Ga0318541_10817561Not Available520Open in IMG/M
3300031548|Ga0307408_102288978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia523Open in IMG/M
3300031720|Ga0307469_10051485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2591Open in IMG/M
3300031764|Ga0318535_10345589Not Available665Open in IMG/M
3300031901|Ga0307406_10033043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales3163Open in IMG/M
3300032080|Ga0326721_10647690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales648Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil27.10%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment10.28%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil10.28%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.54%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere3.74%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.80%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere2.80%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.87%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.87%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.87%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.87%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.87%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.93%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.93%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.93%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012004Permafrost microbial communities from Nunavut, Canada - A30_5cm_6MEnvironmentalOpen in IMG/M
3300012019Permafrost microbial communities from Nunavut, Canada - A7_5cm_12MEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012478Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610Host-AssociatedOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012494Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610Host-AssociatedOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300012939Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028754Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10060563633300000956SoilMRNRPLDAKAFGLLVATSIVLTGAVVVWMFRRWTNHDVSDPGVTL*
F14TB_10076811923300001431SoilLDAKAFGLMAVLLLLAGVVLLWIRRRTWTDHNVSDPGVTL*
Ga0063356_10234905723300004463Arabidopsis Thaliana RhizosphereMGNRRLDAKAFGLIAALLVLTGAVLLWVRRRTWTDHNVSDPGITL*
Ga0062595_10220339613300004479SoilMGNRRLDVKAFGLAAVSLLLTGAVVVWMLRRWTNHDVSDPGVTL*
Ga0070675_10164284813300005354Miscanthus RhizosphereMGNRRLDVKAFGLAAILLLLTGAVVVWMLRRWTNHDVSDPGVTL*
Ga0070688_10182030813300005365Switchgrass RhizosphereVGNRRLDVKAFGLAAILLLLTGAVVVWMLRRWTNHDVSDPGVTL*
Ga0070705_10194046713300005440Corn, Switchgrass And Miscanthus RhizosphereMGNRRLDVKAFGLAAVSLLLTGAVVVWMVRRWTNHDVSDPGVTL*
Ga0070685_1003669653300005466Switchgrass RhizosphereGNRRLDVKAFGLAAVSLLLTGAVVVWMVRRWTNHDVSDPGVTL*
Ga0066903_10046857453300005764Tropical Forest SoilMGNQRIPGKAFGLGVAALLLTGAVVVWLLRRWTNHDVSDPGVTL*
Ga0066903_10396278523300005764Tropical Forest SoilMGNRPLDVKAFGLLAVSLVLTGAAVVWMYRRWTNHDVSDPGVTL*
Ga0068858_10002884863300005842Switchgrass RhizosphereMGNRRLDVKAFGLAAVSLLLTGAVVVWMVRRWTNHDVSDPGVSL*
Ga0068871_10096492333300006358Miscanthus RhizosphereGNRRLDVKAFGLAAVSLLLTGAVVVCMVRRWTNHDVSDPGVTL*
Ga0074054_1097059923300006579SoilMGNRRLDVKAFGLAAVSLLLTGAVVVWSLRRWTNHDVSDPGVTL*
Ga0068865_10008731613300006881Miscanthus RhizosphereNRRLDVKAFGLAAILLLLTGAVVVWMLRRWTNHDVSDPGVTL*
Ga0066710_10075277723300009012Grasslands SoilMGNRRLDAKAFGLLATSLVLTGAVVVWMFRRAWTDHDVSDPGVTL
Ga0105247_1053244923300009101Switchgrass RhizosphereMGNRRLDVKAFGLAAVSLLLTGAVVVWMVRRWTNHDVS
Ga0105237_1149191113300009545Corn RhizosphereRRPMGNRRLDVKAFGLAAVSLLLTGAVVVWMVRRWINHDVSDPGVTL*
Ga0126307_1138478323300009789Serpentine SoilMGNRRLDAKAFGLMAALLLLSGAMLLWIRRKRWTDHNVSDPGVTL*
Ga0126313_1059242623300009840Serpentine SoilMGNQRSDAKAFGLMAASLVITGAVLVWIFRRAWTNHDVSDPGVAL*
Ga0126313_1095146413300009840Serpentine SoilLDAKAFGLIAALLVLTGAVLVWVRRRTWTDHNVSDPGITL*
Ga0126313_1158914323300009840Serpentine SoilAKTLGLIAASLVLTGAMVLWARRKWTDHDVSDPGVV*
Ga0126305_1090741223300010036Serpentine SoilTLGLIAASVVLTGAVVLWARRKWTDHDVSDPGIT*
Ga0126304_1039653123300010037Serpentine SoilGLMAALLVLTAVVFLWVRRRTSTDHDVSDPGVTL*
Ga0126304_1082054623300010037Serpentine SoilMGNRRLDAKAFGLIAALLVLTGAVVLWVRRRNWTDHDVSDPGVTL*
Ga0126315_1077321623300010038Serpentine SoilMGNRRSGAKAFGLIAGLLAVSGAAFFLIRRKRWTDHNVSDPGVTL*
Ga0126314_1089267823300010042Serpentine SoilMGNRRLDAKAFGLIAALLVLTAAVLVWVRRRTWTDHNVSDPGITL*
Ga0126321_146864623300010145SoilMGNRRSGAKAFGLIAALLAVGGVVFLLIRRRWTDHNVSDPGVTL*
Ga0126306_1000403733300010166Serpentine SoilMGNRRLDAKAFGLMAALLVLIAAAFMWVRRRTSTDHDVSDPGVTL*
Ga0126306_1041974813300010166Serpentine SoilMGNRRTDAKAFGLIAALLVLAGAVLVWIRRRTSTDHNVSDPGVTL*
Ga0134128_1186638113300010373Terrestrial SoilLTSAMGNRRLDVKAFGLAAVSLLLTGAVVVCMVRRWTNHDVSDPGVTL*
Ga0134123_1031568333300010403Terrestrial SoilMGNRRLDVKAFGLAAILLLLTGAVVVWMLRRWTNHDVSEPGVTL*
Ga0120134_105861713300012004PermafrostGDGSAAYCRPMGSRRLDAKALGMLAASLALTGAVAVWLFRRAWTDHDVSDPGVTL*
Ga0120139_109477223300012019PermafrostMGSRRLDAKALGMLAASLALTGAVVVWMFRRAWTDHDVSDPG
Ga0137374_1082855933300012204Vadose Zone SoilLGLMGTSLLLTGAVVMWMFRRWTDHNVSDPGVTL*
Ga0137374_1116374813300012204Vadose Zone SoilMGNRQLNAKAFGLLATSLVLTGAVLVWMFRRAWTDHNVSDPGVT*
Ga0137380_1001874823300012206Vadose Zone SoilMGNRRLGAKAFGLLASLVLTGAVVVWMFRRGWTDHDVGDPGVTL*
Ga0137380_1176132313300012206Vadose Zone SoilMGNRRFDAKAFGLLATSLVLTGAVVVWMFRRAWTDHDVSDPGITL*
Ga0137387_1009819413300012349Vadose Zone SoilAFGLLASLVLTGAVVVWMFRRGWTDHDVGDPGVTL*
Ga0137372_1119990613300012350Vadose Zone SoilMGNRRLDAKAFGLLATSLLLTGAVVMWMFRRWTDHNVSDPGVTL*
Ga0137375_1130597023300012360Vadose Zone SoilMGNRQLNAKAFGLLATSLVLTGAVLVWMFRRAWTDHNVSDPGVTL*
Ga0150984_10114061213300012469Avena Fatua RhizosphereAKAFGLIAALLAVSGAVFLLIRRRAWTDHNVSDPGVTL*
Ga0150984_10237820713300012469Avena Fatua RhizosphereMGNRRFDAKAFGLVAALILVSRAVLFWIRRRRWTDHDVSDPGVTL*
Ga0150984_12213460133300012469Avena Fatua RhizosphereAKAFGLVAGLLAVSGAVFLLIRRRRWTDHNVSDPGVTL*
Ga0157328_102127213300012478Arabidopsis RhizosphereMGNRQFDAKVFAVIAALVAVSGALFLLIRRRRWTDHNVSDPGVTL*
Ga0157320_100301023300012481Arabidopsis RhizosphereMGNRRFDAKVFAVIAALVAVSGALFLLIRRRRWTDHNVSDPGVTL*
Ga0157341_100926813300012494Arabidopsis RhizosphereDAKVFAIIAASVAVSGALFLLIRRRRWTDHNVSDPGVTL*
Ga0157342_100240133300012507Arabidopsis RhizosphereMGNRRFDAKVFAIIAASVAVSGALFLLIRRRRWTDHNVSDPGVTL*
Ga0162650_10007757623300012939SoilMGNRRVNAKAFGLMAALLVLSGAALLWIRRRSWTDHNVSDPGVTL*
Ga0164298_1001266223300012955SoilMGNRRLDVKAFGLAAVSLLLTGAVVVWMVRRWTNHDVIAPRVTL*
Ga0164299_1147683723300012958SoilRPMGNRRLDVKAFGLAAVSLLLTGAVVVWMVRRWTNHDVSDPGVTL*
Ga0164307_1169990723300012987SoilRRPMGNRRLDVKAFGLAVSLLLTGAVVVWMVRRWTNHDVSDPGVTP*
Ga0164305_1007055133300012989SoilMGNRRLDVKAFGLAAVSLLLTGAVVLWMVRRWTNHDVSDPGVTL*
Ga0164305_1175390033300012989SoilMGNRRLDVKAFGLVAILLLLTGAVVVWMLRRWTNHDVSD
Ga0157371_1133565613300013102Corn RhizosphereRRPVGNRRLDVKAFGLAAILLLLTGAVVVWMLRRWTNHDVSDPGVTL*
Ga0157378_1127492013300013297Miscanthus RhizosphereMGNRRLDVKAFGLAAVSLLLTGAVVVWMVRRWTNHD
Ga0173483_1042158013300015077SoilMGNRRLDAKAFGLMAALLVLTGAVLLWIRRRTWTDDNVSDPGVTL*
Ga0132258_1073322013300015371Arabidopsis RhizosphereAIIAATVAVSGALFLLIRRRRWTDHNVSDPGVTL*
Ga0132258_1094636033300015371Arabidopsis RhizosphereMGNRRLAGKAFGLSAVSLLLTGAVLVWMFRRWTDHDVSDPGVTL*
Ga0132256_10007982053300015372Arabidopsis RhizosphereMGNRRFDAKVFAIIAATVAVSGALFLLIRRRRWTDHNVSDPGVTL*
Ga0132255_10197988223300015374Arabidopsis RhizosphereMGNRRFDAKVFGIIAALVAVSGALFLLIRRRRWTDHNVSDPGVTL*
Ga0190266_1065375613300017965SoilAKAFGLMAALLVLTGAVLLWIRRRAWTDHDVSDPGVTL
Ga0184610_129220613300017997Groundwater SedimentMDPAAYRRFMGNRRLDAKAFGLIAASLLVLTGAVLLWIRRRPWTDHNVSDPGITL
Ga0184604_1034071413300018000Groundwater SedimentMDPAAYRRFMGNRRLDAKAFGLIAALLLVLTGAVLLWIRRRTWTDHNVSDPGITL
Ga0184608_1015628923300018028Groundwater SedimentLDAKAFGLMAALLVLTGAVLLWIRRRTWTDHNVSDPGITL
Ga0184608_1036211123300018028Groundwater SedimentMDPAAYRRFMGNRRLDAKAFGLIAASLLVLTGAVLLWIRRRPWTDHNV
Ga0184619_1017042213300018061Groundwater SedimentMDPAAYRRFMGNRRLDAKAFGLIAALLVLTGAVLLWVRRRTWTDHNVSDPGITL
Ga0184635_1004629013300018072Groundwater SedimentLDAKAFGLMAALLVLSGAVLLWIRRRRWTDHNVSDPGVTL
Ga0184624_1014656813300018073Groundwater SedimentMDPAAYRRFMGNRRLDAKAFGLIAALLLVLTGAVLLWIRRRRWTDHNVSDPGVTL
Ga0184624_1022252023300018073Groundwater SedimentMDAKAFGLMAALLVLTGAVLLWIRRRTSTDHNVSDPGVTL
Ga0184609_1048363313300018076Groundwater SedimentMDPAAYRRFMGNRRLDAKAFGLIAASLLVLTGAVLLWIRRRTWTDHNVSDPGITL
Ga0184612_1008180413300018078Groundwater SedimentLDAKTFGLMTALQVLTAAVLLRIRRRSWTDHNVSDSGVT
Ga0184625_1026277523300018081Groundwater SedimentMGNRRLDAKAFGLMAALLVLTGAVLFWIRRRSSTDHNVSDPGVTL
Ga0190275_1257986913300018432SoilLDAKAFGLMAALLVLTGAVLLWIRRRSWTDHNVSDPGVTL
Ga0190268_1110083823300018466SoilLDAKAFGVIAALLLLIGAVLIWVRRRTWTDHDVSDPGITL
Ga0190264_1023775123300019377SoilMGNRRLNAKAFGLIATLLVLTGVVLLWIRRRTWRDHDVSDPGITL
Ga0190267_1023513623300019767SoilMGNRRFAKAFGLFAALLMVSGAVLLWIRRRTWTDHDVSDPGITL
Ga0193705_107658323300019869SoilAAYRRFMGNRRLDAKAFGLIAALLLVLTGAVLLWIRRRTWTDHNVSDPGITL
Ga0210381_1011529823300021078Groundwater SedimentLDAKAFGLIAALLLVLTGAVLLWIRRRTWTDHNVSDPGITL
Ga0224452_107080623300022534Groundwater SedimentMDPAAYRRFMGNRRLDAKAFGLIAGLLLVLTGAVLLWIRRRTWTDHNVSDPGITL
Ga0222623_1015050913300022694Groundwater SedimentLDAKAFGLMAAVLVLTGAVLLWMRRRSWTDHNVSDPGVTL
Ga0207659_1057630213300025926Miscanthus RhizosphereMGNRRLDVKAFGLAAILLLLTGAVVVWMLRRWTNH
Ga0207664_1009266443300025929Agricultural SoilVGNRRLDVKAFGLAAILLLLTGAVVVWMLRRWTNHDVSDPGVTL
Ga0207644_1180725113300025931Switchgrass RhizosphereRRPVGNRRLDVKAFGLAAILLLLTGAVVVWMLRRWTNHDVSDPGVTL
Ga0207690_1014662143300025932Corn RhizosphereWAIDGLDVKAFGLAAILLLLTGAVVVWMLRRWTNHDVSDPGVTL
Ga0307307_1000592413300028718SoilGLIAALLLVLTGAVLLWIRRRTWTDHNVSDPGITL
Ga0307301_1021966823300028719SoilMDPAAYRRFMGNRRLDAKAFGLIAALLLVLTGAVLLWIRRRTWTDH
Ga0307319_1006617623300028722SoilMGNRRLDAKAFGFIAALLVLTGAVLVWVRRRTWTDHNVSDPGITL
Ga0307318_1002914833300028744SoilMGNRRLDAKAFGFIATLLVLTGAVLVWVRRRTWTDHNVSDPGITL
Ga0307318_1004724233300028744SoilMGNRRLDAKAFGLIAALLVLTGAVLVWVRRRTWTDHNVSDPGITL
Ga0307318_1010131213300028744SoilAKAFGLIAALLLVLTGAVLLWIRRRTWTDHNVSDPGITL
Ga0307318_1016165423300028744SoilMGNRRFDAKAFGLMAALLMVSGAVLLWIRRRTWTDHDVSDPGITL
Ga0307297_1019849713300028754SoilAFGLIAALLLVLTGAVLLWIRRRTWTDHNVSDPGITL
Ga0307320_1002664533300028771SoilRFDAKAFGLMAALLMVSGAVLLWIRRRTWTDHDVSDPGITL
Ga0307306_1019953713300028782SoilTASAVDEMDPAAYRRFMGNRRLDAKAFGLIAALLLVLTGAVLLWIRRRTWTDHNVSDPGITL
Ga0307282_1001531853300028784SoilMGNRRLDAKAFGLMAALLVLTGAVLLWIRRRIWTDHNVSDPGITL
Ga0307287_1006689423300028796SoilTGSAVDEMDPAAYRRFMGNRRLDAKAFGLIAALLLVLTGAVLLWIRRRTWTDHNVSDPGITL
Ga0307302_1009117223300028814SoilLDAKAFGLMAALLVLSGAVLLWIRRRRWTDHKVSDPGVTL
Ga0299907_1020734613300030006SoilMGKRRSDAKAFGLMATSLVLTGAVLVWIFRRACTEHDVSDPGVTL
Ga0299907_1046284123300030006SoilMENRRSGAKVFGLMATSLLLAGAVLVWIFRRARAAHDVSDPGVTL
Ga0268240_1001417913300030496SoilMENRRSGAKAFGLIAALLAVSGAVFLLIRRRWTDHDVS
Ga0308204_1001099633300031092SoilMGNRRSGAKAFGVIAALLAVSGAVFFLIRRKRWTDHNVSDPGVTL
Ga0318541_1081756123300031545SoilPMGNQRIPGKAFGLGAAALLLTGAVVVWLLRRWTNHDVSDPGVTL
Ga0307408_10228897823300031548RhizosphereMGNRRSGAKAFGLIAGLLAVSGAAFFLIRRKTWTDHNVSDPGVTL
Ga0307469_1005148513300031720Hardwood Forest SoilMGNRRLDVKAFGLAAILLLLTGAVVVWMLRRWTNHDVSDPGVTL
Ga0318535_1034558913300031764SoilMGNQRIPGKAFGLGAAALLLTGAVVVWLLRRWTNHDVSDPGVTL
Ga0307406_1003304313300031901RhizosphereLDAKAFGLIAALLVLTGAVLVWVRRRTWTDHNVSDPGIT
Ga0326721_1064769013300032080SoilKSFGLWATSFALAGAFVVWMLRRAWTDHNVSDPGVTL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.