NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092130

Metagenome / Metatranscriptome Family F092130

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092130
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 44 residues
Representative Sequence IRRALPDFHLDVLDHTGHFLMLEAPARFNPLLLQDLQAITQRAAH
Number of Associated Samples 97
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.93 %
% of genes near scaffold ends (potentially truncated) 99.07 %
% of genes from short scaffolds (< 2000 bps) 92.52 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.262 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(39.252 % of family members)
Environment Ontology (ENVO) Unclassified
(38.318 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.533 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.66%    β-sheet: 0.00%    Coil/Unstructured: 75.34%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF06206CpeT 49.53
PF02551Acyl_CoA_thio 12.15
PF136224HBT_3 9.35
PF01799Fer2_2 1.87
PF05188MutS_II 0.93
PF00127Copper-bind 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG1946Acyl-CoA thioesteraseLipid transport and metabolism [I] 12.15
COG0249DNA mismatch repair ATPase MutSReplication, recombination and repair [L] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.26 %
UnclassifiedrootN/A3.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005436|Ga0070713_100883764All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium859Open in IMG/M
3300005526|Ga0073909_10222335All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium827Open in IMG/M
3300005538|Ga0070731_10598492All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300005541|Ga0070733_10388027All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium929Open in IMG/M
3300005545|Ga0070695_100746818All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium780Open in IMG/M
3300005552|Ga0066701_10338831All Organisms → cellular organisms → Bacteria932Open in IMG/M
3300005591|Ga0070761_10428049All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium810Open in IMG/M
3300005610|Ga0070763_10104611All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1432Open in IMG/M
3300005764|Ga0066903_106735528All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium597Open in IMG/M
3300005764|Ga0066903_107275430All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium572Open in IMG/M
3300005921|Ga0070766_10261812All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1100Open in IMG/M
3300006358|Ga0068871_101987139All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium553Open in IMG/M
3300006605|Ga0074057_10296046All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium597Open in IMG/M
3300006606|Ga0074062_12266158All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium744Open in IMG/M
3300009826|Ga0123355_10438443All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1656Open in IMG/M
3300009826|Ga0123355_11526044Not Available650Open in IMG/M
3300010303|Ga0134082_10181921All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300010320|Ga0134109_10180023All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium773Open in IMG/M
3300010359|Ga0126376_10752917All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium945Open in IMG/M
3300010361|Ga0126378_10994720All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium943Open in IMG/M
3300010362|Ga0126377_12150754All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium634Open in IMG/M
3300010376|Ga0126381_105014178All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium508Open in IMG/M
3300012971|Ga0126369_11258250All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium830Open in IMG/M
3300012977|Ga0134087_10046823All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1693Open in IMG/M
3300012984|Ga0164309_10007774All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria5155Open in IMG/M
3300013100|Ga0157373_11312876All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium548Open in IMG/M
3300014322|Ga0075355_1105506All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales705Open in IMG/M
3300015372|Ga0132256_100607344All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1208Open in IMG/M
3300016270|Ga0182036_10680334All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium831Open in IMG/M
3300016319|Ga0182033_10386950All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1179Open in IMG/M
3300016341|Ga0182035_10466407All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1073Open in IMG/M
3300016404|Ga0182037_10391602All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1142Open in IMG/M
3300016445|Ga0182038_10448097All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1092Open in IMG/M
3300017959|Ga0187779_10526443All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium784Open in IMG/M
3300017961|Ga0187778_10049026Not Available2580Open in IMG/M
3300017970|Ga0187783_10016916All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria5384Open in IMG/M
3300017974|Ga0187777_10408690All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium940Open in IMG/M
3300017975|Ga0187782_10274168All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1270Open in IMG/M
3300018060|Ga0187765_10664859All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium680Open in IMG/M
3300018085|Ga0187772_10859708All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium657Open in IMG/M
3300020581|Ga0210399_10822174All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium758Open in IMG/M
3300020582|Ga0210395_10390100All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1047Open in IMG/M
3300021088|Ga0210404_10861339Not Available518Open in IMG/M
3300021168|Ga0210406_10698738All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium782Open in IMG/M
3300021178|Ga0210408_10068183All Organisms → cellular organisms → Bacteria → Proteobacteria2779Open in IMG/M
3300021362|Ga0213882_10270220All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium707Open in IMG/M
3300021377|Ga0213874_10146573All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium821Open in IMG/M
3300021401|Ga0210393_11552080All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300021403|Ga0210397_11274868All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300021406|Ga0210386_10127138All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2113Open in IMG/M
3300021444|Ga0213878_10146509All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium978Open in IMG/M
3300021474|Ga0210390_11324145All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300021474|Ga0210390_11460854Not Available542Open in IMG/M
3300021560|Ga0126371_10382289All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1547Open in IMG/M
3300021560|Ga0126371_11729644All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium748Open in IMG/M
3300022557|Ga0212123_10574046All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium717Open in IMG/M
3300024330|Ga0137417_1183801All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1217Open in IMG/M
3300025928|Ga0207700_10960144All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium765Open in IMG/M
3300026332|Ga0209803_1160250All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300027590|Ga0209116_1104460All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium622Open in IMG/M
3300027855|Ga0209693_10101137All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1427Open in IMG/M
3300027889|Ga0209380_10124112All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1503Open in IMG/M
3300028906|Ga0308309_10595238All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium960Open in IMG/M
3300031057|Ga0170834_104442347All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter enzymogenes741Open in IMG/M
3300031544|Ga0318534_10819824All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium522Open in IMG/M
3300031640|Ga0318555_10347823All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium803Open in IMG/M
3300031668|Ga0318542_10614085All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium567Open in IMG/M
3300031679|Ga0318561_10730902All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium544Open in IMG/M
3300031682|Ga0318560_10067318All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1800Open in IMG/M
3300031682|Ga0318560_10658761All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium566Open in IMG/M
3300031713|Ga0318496_10086490All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1669Open in IMG/M
3300031744|Ga0306918_10567851All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium889Open in IMG/M
3300031753|Ga0307477_10094137All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2080Open in IMG/M
3300031754|Ga0307475_10420439All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1074Open in IMG/M
3300031792|Ga0318529_10066611All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1581Open in IMG/M
3300031792|Ga0318529_10149565All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1074Open in IMG/M
3300031793|Ga0318548_10097337All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1405Open in IMG/M
3300031796|Ga0318576_10256608All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium825Open in IMG/M
3300031797|Ga0318550_10552673All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium554Open in IMG/M
3300031805|Ga0318497_10749008All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium548Open in IMG/M
3300031820|Ga0307473_11515581All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium509Open in IMG/M
3300031823|Ga0307478_10359649All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1200Open in IMG/M
3300031832|Ga0318499_10168627All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium854Open in IMG/M
3300031894|Ga0318522_10248182All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium675Open in IMG/M
3300031896|Ga0318551_10177571All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1171Open in IMG/M
3300031896|Ga0318551_10564613All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium655Open in IMG/M
3300031941|Ga0310912_10770773All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium744Open in IMG/M
3300031981|Ga0318531_10143466All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1067Open in IMG/M
3300032001|Ga0306922_11272218All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium745Open in IMG/M
3300032008|Ga0318562_10232388All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1070Open in IMG/M
3300032008|Ga0318562_10650952All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium607Open in IMG/M
3300032010|Ga0318569_10064673All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1609Open in IMG/M
3300032025|Ga0318507_10236204All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium792Open in IMG/M
3300032041|Ga0318549_10408672All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium611Open in IMG/M
3300032052|Ga0318506_10109947All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1184Open in IMG/M
3300032055|Ga0318575_10561054All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium579Open in IMG/M
3300032059|Ga0318533_10215816All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1378Open in IMG/M
3300032065|Ga0318513_10564157All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium557Open in IMG/M
3300032066|Ga0318514_10029803All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2549Open in IMG/M
3300032066|Ga0318514_10586504All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium593Open in IMG/M
3300032076|Ga0306924_10156099All Organisms → cellular organisms → Bacteria → Proteobacteria2614Open in IMG/M
3300032076|Ga0306924_12178125All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium566Open in IMG/M
3300032089|Ga0318525_10058837All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1918Open in IMG/M
3300032091|Ga0318577_10434919All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium626Open in IMG/M
3300032205|Ga0307472_102033137All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium576Open in IMG/M
3300032954|Ga0335083_11040518All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria642Open in IMG/M
3300033829|Ga0334854_060640All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium903Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil39.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.41%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.54%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland6.54%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.80%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.87%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut1.87%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.93%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.93%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.93%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.93%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.93%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.93%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.93%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014322Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027590Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033829Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070713_10088376423300005436Corn, Switchgrass And Miscanthus RhizosphereLPTDAARIRRSLPDFHLDVLNHTGHFLMLEDPPRFNALLLQDIGLITQRAAH*
Ga0073909_1022233523300005526Surface SoilSDLLPTDAARIRRSLPDFHLDVLNHTGHFLMLEDPPRFNALLLQDIGLITQRAAH*
Ga0070731_1059849223300005538Surface SoilSLPDFTLDVLPHSGHFLMLETPERFNPLLLKDVGALAARAAH*
Ga0070733_1038802713300005541Surface SoilLPDFSLDVLDHSGHFLMMEDPARFNPLLLKDLAAIATRAAH*
Ga0070695_10074681823300005545Corn, Switchgrass And Miscanthus RhizospherePDFHLDVLNHTGHFLMLEDPPRFNALLLQDIGLITQRAAH*
Ga0066701_1033883113300005552SoilDAARIRRSLPDFTLDVLDHTGHFLMLEAPARFNPLLLKDIEALSARAGR*
Ga0070761_1042804923300005591SoilLPTDAARIRKSLPNFTLDVLDHSGHFLMLETPARFNPLLLKDLALLAAQPSH*
Ga0070763_1010461113300005610SoilDVLPHSGHFLMMEDPARFNPLLLKDITAITQHAAH*
Ga0066903_10673552823300005764Tropical Forest SoilDATRIRRALPDFHLDVLDHSGHFLMLEAPERFNPLLLQDLQAITQRATAH*
Ga0066903_10727543013300005764Tropical Forest SoilPDFHLDVLDHSGHFLMLEAPERFNPLLLQDLQAITQRATAH*
Ga0070766_1026181223300005921SoilDLLPTDAARIRKSIPNFTLDVLDHSGHFLMLEAPARFNPLLLKDLAALAAQPSH*
Ga0068871_10198713913300006358Miscanthus RhizosphereDAARIRRSLPDFHLDVLDHTGHFLMLEDPVRFNARLLQDLAVITQRAAH*
Ga0074057_1029604623300006605SoilFTLDVLDHSGHFLMLEAPTRFNPLLLKDLAALAAPPAH*
Ga0074062_1226615813300006606SoilFTLDVLDHSGHFLMLEAPARFNPLLLKDLAALAAPPAH*
Ga0123355_1043844343300009826Termite GutALPDFHLDVLEHTGHFLMLETPARLNPLLLADVAALAHGAPH*
Ga0123355_1152604423300009826Termite GutLAPTDAARIRQALPDFHLDVLEHTGHFLMLEAPERFNPLLLADIAALAQGAPH*
Ga0134082_1018192123300010303Grasslands SoilDFTLDVLDHTGHFLMLEAPARFNPLLLKDIEALSARAGR*
Ga0134109_1018002313300010320Grasslands SoilRKSLPDFTLDVLEHSGHFLMLEAPERFNPLLLKDLDALSARAAH*
Ga0126376_1075291713300010359Tropical Forest SoilPDFHLDVLDHSGHFLMLEAPERFNPLLLQDLQAITQRAAH*
Ga0126378_1099472013300010361Tropical Forest SoilRIRRALPDFHLDVLDHTGHFLMLEAPARFNPLLLQDLQAITQRASAH*
Ga0126377_1215075413300010362Tropical Forest SoilTRIRPALPDFHLDVLDHSGHFLMLEAPERFNPLLLQDLQAITQRAAH*
Ga0126381_10501417823300010376Tropical Forest SoilPTDAARIRRALPDFHLDVLEHTGHFLMLEAPERFNPLLLQDLQAITQRAAH*
Ga0126369_1125825013300012971Tropical Forest SoilTTVDVLEHSDHFLMLEDPARFNPLLLKDLAALAARTDAH*
Ga0134087_1004682333300012977Grasslands SoilKSLPDFTLDVLDHSGHFLMLEAPARFNPLLLKDLDALSARAAH*
Ga0164309_1000777413300012984SoilLLPTDAARIRKALPDFTLDVLDHSGHFLMLEAPARFNPLLLKDLAALAAPPAH*
Ga0157373_1131287623300013100Corn RhizosphereRIRKALPDFTLDVLDHSGHFLMLEAPARFNPLLLKDLAALAAPPAH*
Ga0075355_110550623300014322Natural And Restored WetlandsDLAPTDAARIRKSLPDFTLDLMPHTGDFLMLEDPARFNALLLKDLEAISTRPAR*
Ga0132256_10060734413300015372Arabidopsis RhizosphereDVLNHTGHFLMLEDPPRFNALLLQDITVITQRAAH*
Ga0182036_1068033413300016270SoilPDFHLDVLDHTGHFLMLEAPARFNPLLLQDLQAITQRATH
Ga0182033_1038695013300016319SoilAARIRRALPDFHLDVLDHTGHFLMLEAPARFNPLLLQDLQAITQRAAH
Ga0182035_1046640713300016341SoilLPTDAARIRRSLPDFHLDVLDHTGHFLMLEAPARFNPLLLQDLEAITQHAAH
Ga0182037_1039160223300016404SoilLLPTDAARIRRALPDFHLDVLDHTGHFLMLEAPARFNPLLLQDLQAITQRATH
Ga0182038_1044809713300016445SoilIRRSLPDFHLDVLDHTGHFLMLEDPARFNALLLQDLAAISQRAAH
Ga0187779_1052644313300017959Tropical PeatlandAARIRRSLPDFTLDVIDHSGTFLMLEAPQRFNPLLLKDIAAIAQRAPH
Ga0187778_1004902643300017961Tropical PeatlandRRSISDFTLDVLPHSGNFLMLEAPARFDPLLLKDVAALAARAAH
Ga0187783_1001691613300017970Tropical PeatlandARIRKSLPDFTLDVLDHSGHFLMLEAPQRFNPLLLKDVAAIVQRAPH
Ga0187777_1040869023300017974Tropical PeatlandRRALPDFHLDVLDHTGHFLMLEAPERFNPLLLQDLQAITQRATH
Ga0187782_1027416833300017975Tropical PeatlandSLPDFTLDVLDHSGHFLMLEAPARFNPLLLRDLKAIAQRAAH
Ga0187765_1066485913300018060Tropical PeatlandEVLAHSDHFLMLEDPARFNPLLLQAVGALAATAAH
Ga0187772_1085970813300018085Tropical PeatlandRKSLPDFHLDVLDHTGHFLMLEAPARFNPLLLRDVAAIAQRTSH
Ga0210399_1082217413300020581SoilLPGLSLEVLDHSGHFLMLEAPARFNPLLLKDIGALAAGAAH
Ga0210395_1039010013300020582SoilRIRKSLPDFTLDVLEHSGHFLMLEAPARFNPLLLKDLDALSARAAH
Ga0210404_1086133913300021088SoilPQFTLQVLPHTGHFLMMEAPARFNPLLLQDLDALAQQAAH
Ga0210406_1069873813300021168SoilEVLDHSGHFLMLEAPARFNPLLLKDIGALAAGAAH
Ga0210408_1006818353300021178SoilAARIAKSLPQFTLQVLPHTGHFLMMEAPARFNPLLLQDLDALAQQAAH
Ga0213882_1027022013300021362Exposed RockDVLHHSSHFPMLEAPARFNPLLLKDVASIVQRAAH
Ga0213874_1014657313300021377Plant RootsRLVPDFHVDVIPHSSHFLMMDDAARFNPLLLKDIALLQQRAGSQR
Ga0210393_1155208023300021401SoilRSLPQFTLDVLPHTGHFLMMEAPARFNPLLLKDLEALAPHGA
Ga0210397_1127486823300021403SoilTDGDRIRKSLPGFTLDVLPHSGHFLMLEAPERFNPLLTRDIDALAARAGH
Ga0210386_1012713813300021406SoilIRRSLPDFHLDVLNHTGHFLMLEDPPRFNALLLQDLTAITQRAAH
Ga0213878_1014650913300021444Bulk SoilSDLLPTDAARIRRSLPDFHLDVLAHTGHFLMLEDPARFNALLLQDLSAITRHAAH
Ga0210390_1132414523300021474SoilLPTDGDRIRKSLPGFTLDVLPHSGHFLMLEAPERFNPLLTREIDALATRAGH
Ga0210390_1146085423300021474SoilRIRKSLPDFTLDVLPHTGHFLMLEAPGRFNPLLIKDIDALAARAPH
Ga0126371_1038228913300021560Tropical Forest SoilIRKSLPDFTLDVLDHSSHFLMLETPARFNPLLLKDIAAIVQRAPH
Ga0126371_1172964423300021560Tropical Forest SoilAVRIRKALPDFTLDVLDHTGHFLMLEDPARFNPLLLKDIAAITQRSTH
Ga0212123_1057404623300022557Iron-Sulfur Acid SpringSLDVLDHSGHFLMMEDPARFNPLLLKDLAAIATRAAH
Ga0137417_118380123300024330Vadose Zone SoilTDAARIRKSLPDFTLDVLEHSGHFLMLEAPARFNPLLLKDLDALSARAAH
Ga0207700_1096014423300025928Corn, Switchgrass And Miscanthus RhizosphereLDVLNHTGHFLMLEDPPRFNALLLQDIGLITQRAAH
Ga0209803_116025023300026332SoilIRRSLPDFTLDVLDHTGHFLMLEAPARFNPLLLKDIEALSARAGR
Ga0209116_110446023300027590Forest SoilLPDFSLDVLDHSGHFLMMEDPARFNPLLLKDVAAITARAAH
Ga0209693_1010113733300027855SoilDVLPHSGHFLMMEDPARFNPLLLKDITAITQHAAH
Ga0209380_1012411243300027889SoilQFTLDVLPHTGHFLMMEAPARFNPLLLKDLEALAPHGA
Ga0308309_1059523823300028906SoilRKSLPNFTLDVLSHSGHFLMLEDPARFNPLLLKDVAAIAATTGAH
Ga0170834_10444234713300031057Forest SoilTDAVRIKKSLPDFTLDVMAHTGDFPMLEDPARFNALLLKDLEAIGARSAR
Ga0318534_1081982413300031544SoilDVLDHTGHFLMLEDPARFNALLLQDLAAISQRAAH
Ga0318555_1034782323300031640SoilLLPTDAARIRRSLPDFHLDVLDHTGHFLMLEDPARFNALLLQDLAAISQRAAH
Ga0318542_1061408523300031668SoilDAARIRRSLPDFHLDVLNHTGHFLMLEDPPRFNALLLQDIGVISQRAAH
Ga0318561_1073090223300031679SoilAARIRKALPDFTLDVLDHTGHFLMLEDPARFNPLLLKDIDAITRRSTH
Ga0318560_1006731833300031682SoilDFHLDVLDHTGHFLMLEDPARFNTLLLQDLAAITQRAAH
Ga0318560_1065876123300031682SoilFHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH
Ga0318496_1008649033300031713SoilLPTDAARIRRSLPDFHLDVLDHTGHFLMLEDPARFNTLLLQDLAAITQRAAH
Ga0306918_1056785123300031744SoilIRRALPDFHLDVLDHTGHFLMLEAPARFNPLLLQDLQAITQRAAH
Ga0307477_1009413713300031753Hardwood Forest SoilIRKSLPDFTLDVLDHSGHFLMLEAPARFNPLLLKDLDALGARATH
Ga0307475_1042043913300031754Hardwood Forest SoilPTDGDRIRKSLPGFTLDVLPHSGHFLMLEAPERFNPLLTRDIDALAARAGH
Ga0318529_1006661113300031792SoilDAARIRRALPDFHLDVLDHTGHFLMLEAPARFNPLLLQDLQAITQRAAH
Ga0318529_1014956513300031792SoilYAINSDMLPTDAARIRRSLPDFHLDVLNHTGHFLMLEDPARFNALLLQDIGVISQRAAH
Ga0318548_1009733733300031793SoilTDAARIRRSLPDFHLDVLDHTGHFLMLEAPERFNAVLLQDLGAIVQHSAH
Ga0318576_1025660823300031796SoilARIRRALPDFHLDVLDHTGHFLMLEAPARFNPLLLQDLQAITQRAAH
Ga0318550_1055267323300031797SoilFHLDVLDHTGHFLMLEAPARFNPLLLQDIQAITQRAAH
Ga0318497_1074900813300031805SoilARIRRSLPDFHLDVLDHTGHFLMLEAPERFNAVLLQDLGAIAQRSAH
Ga0307473_1151558113300031820Hardwood Forest SoilSLPGFTLDVLPHSGHFLMLEAPERFNPLLTRDIDALAARAGH
Ga0307478_1035964913300031823Hardwood Forest SoilLPGFTLDVLPHSGHFLMLEAPERFNPLLTRDIDALAARAGH
Ga0318499_1016862723300031832SoilSGALPDFHLDVLDHTGHFLMLEAPARFNPLLLQDLQAITQRAAH
Ga0318522_1024818213300031894SoilLADFHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH
Ga0318551_1017757123300031896SoilRIRRSLADFHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH
Ga0318551_1056461323300031896SoilDVLDHTGHFLMLEAPARFNPLLLQDLQAITQRATH
Ga0310912_1077077313300031941SoilFHLDVLDHTGHFLMLEAPERFNAVLLQDLSAIAQRSAH
Ga0318531_1014346623300031981SoilHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH
Ga0306922_1127221813300032001SoilLPDFHLDVLNHTGHFLMLEDPARFNALLLQDIGVISQRAAH
Ga0318562_1023238813300032008SoilPDFHLDVLDHTGHFLMLEDPARFNALLLQDLAAISQRAAH
Ga0318562_1065095213300032008SoilADFHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH
Ga0318569_1006467333300032010SoilFHLDVLDHTGHFLMLEDPARFNTLLLQDLAAITQRAAH
Ga0318507_1023620413300032025SoilSLPDFHLDVLPHTGHFLMLEDPTRFNSLLLQDLAVITQRAAH
Ga0318549_1040867213300032041SoilDFHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH
Ga0318506_1010994713300032052SoilIRRSLPDFHLDVLDHTGHFLMLEAPERFNAVLLQDLGAIVQRSAH
Ga0318575_1056105413300032055SoilDLLPTDAARIRRSLADFHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH
Ga0318533_1021581633300032059SoilDVLDHTGHFLMLEAPARFNPLLLQDIQAITQRAAH
Ga0318513_1056415713300032065SoilIRRSLADFHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH
Ga0318514_1002980343300032066SoilIRRSLPDFHLDVLNHTGHFLMLEDPARFNALLLQDIGVISQRAAH
Ga0318514_1058650423300032066SoilSLPDFHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH
Ga0306924_1015609953300032076SoilPTDAARIRRSLPDFHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH
Ga0306924_1217812523300032076SoilTDAARIRRSLPDFHLDVLDHTGHFLMLEAPARFNPLLLQDIQAITQRAAH
Ga0318525_1005883733300032089SoilLPDFHLDVLDHTGHFLMLEAPERFNAVLLQDLSAIAQRSAH
Ga0318577_1043491923300032091SoilAARIRRSLADFHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH
Ga0307472_10203313713300032205Hardwood Forest SoilAARIHRSLPDFRLDVLNHSGHFLMLEDPPRFNALLLQDLAAITQRAAH
Ga0335083_1104051823300032954SoilRKSLPDFTLDVMPHTGHFPMLEAPERFNALLLKDIDALAARAR
Ga0334854_060640_763_9033300033829SoilRIRKSLPDFTLDVLDHSSHFLMLEDPARFNPLLLKDVAAIAQRAAH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.