| Basic Information | |
|---|---|
| Family ID | F092130 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 44 residues |
| Representative Sequence | IRRALPDFHLDVLDHTGHFLMLEAPARFNPLLLQDLQAITQRAAH |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.93 % |
| % of genes near scaffold ends (potentially truncated) | 99.07 % |
| % of genes from short scaffolds (< 2000 bps) | 92.52 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.262 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (39.252 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.318 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.533 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.66% β-sheet: 0.00% Coil/Unstructured: 75.34% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF06206 | CpeT | 49.53 |
| PF02551 | Acyl_CoA_thio | 12.15 |
| PF13622 | 4HBT_3 | 9.35 |
| PF01799 | Fer2_2 | 1.87 |
| PF05188 | MutS_II | 0.93 |
| PF00127 | Copper-bind | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG1946 | Acyl-CoA thioesterase | Lipid transport and metabolism [I] | 12.15 |
| COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.26 % |
| Unclassified | root | N/A | 3.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005436|Ga0070713_100883764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 859 | Open in IMG/M |
| 3300005526|Ga0073909_10222335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 827 | Open in IMG/M |
| 3300005538|Ga0070731_10598492 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300005541|Ga0070733_10388027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 929 | Open in IMG/M |
| 3300005545|Ga0070695_100746818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 780 | Open in IMG/M |
| 3300005552|Ga0066701_10338831 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300005591|Ga0070761_10428049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 810 | Open in IMG/M |
| 3300005610|Ga0070763_10104611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1432 | Open in IMG/M |
| 3300005764|Ga0066903_106735528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300005764|Ga0066903_107275430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300005921|Ga0070766_10261812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1100 | Open in IMG/M |
| 3300006358|Ga0068871_101987139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300006605|Ga0074057_10296046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300006606|Ga0074062_12266158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300009826|Ga0123355_10438443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1656 | Open in IMG/M |
| 3300009826|Ga0123355_11526044 | Not Available | 650 | Open in IMG/M |
| 3300010303|Ga0134082_10181921 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300010320|Ga0134109_10180023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 773 | Open in IMG/M |
| 3300010359|Ga0126376_10752917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 945 | Open in IMG/M |
| 3300010361|Ga0126378_10994720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 943 | Open in IMG/M |
| 3300010362|Ga0126377_12150754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300010376|Ga0126381_105014178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300012971|Ga0126369_11258250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 830 | Open in IMG/M |
| 3300012977|Ga0134087_10046823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1693 | Open in IMG/M |
| 3300012984|Ga0164309_10007774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5155 | Open in IMG/M |
| 3300013100|Ga0157373_11312876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300014322|Ga0075355_1105506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 705 | Open in IMG/M |
| 3300015372|Ga0132256_100607344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1208 | Open in IMG/M |
| 3300016270|Ga0182036_10680334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 831 | Open in IMG/M |
| 3300016319|Ga0182033_10386950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1179 | Open in IMG/M |
| 3300016341|Ga0182035_10466407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1073 | Open in IMG/M |
| 3300016404|Ga0182037_10391602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1142 | Open in IMG/M |
| 3300016445|Ga0182038_10448097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1092 | Open in IMG/M |
| 3300017959|Ga0187779_10526443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 784 | Open in IMG/M |
| 3300017961|Ga0187778_10049026 | Not Available | 2580 | Open in IMG/M |
| 3300017970|Ga0187783_10016916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5384 | Open in IMG/M |
| 3300017974|Ga0187777_10408690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 940 | Open in IMG/M |
| 3300017975|Ga0187782_10274168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1270 | Open in IMG/M |
| 3300018060|Ga0187765_10664859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 680 | Open in IMG/M |
| 3300018085|Ga0187772_10859708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300020581|Ga0210399_10822174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 758 | Open in IMG/M |
| 3300020582|Ga0210395_10390100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1047 | Open in IMG/M |
| 3300021088|Ga0210404_10861339 | Not Available | 518 | Open in IMG/M |
| 3300021168|Ga0210406_10698738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 782 | Open in IMG/M |
| 3300021178|Ga0210408_10068183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2779 | Open in IMG/M |
| 3300021362|Ga0213882_10270220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 707 | Open in IMG/M |
| 3300021377|Ga0213874_10146573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 821 | Open in IMG/M |
| 3300021401|Ga0210393_11552080 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300021403|Ga0210397_11274868 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300021406|Ga0210386_10127138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2113 | Open in IMG/M |
| 3300021444|Ga0213878_10146509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 978 | Open in IMG/M |
| 3300021474|Ga0210390_11324145 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300021474|Ga0210390_11460854 | Not Available | 542 | Open in IMG/M |
| 3300021560|Ga0126371_10382289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1547 | Open in IMG/M |
| 3300021560|Ga0126371_11729644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 748 | Open in IMG/M |
| 3300022557|Ga0212123_10574046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300024330|Ga0137417_1183801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1217 | Open in IMG/M |
| 3300025928|Ga0207700_10960144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 765 | Open in IMG/M |
| 3300026332|Ga0209803_1160250 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300027590|Ga0209116_1104460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300027855|Ga0209693_10101137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1427 | Open in IMG/M |
| 3300027889|Ga0209380_10124112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1503 | Open in IMG/M |
| 3300028906|Ga0308309_10595238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 960 | Open in IMG/M |
| 3300031057|Ga0170834_104442347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter enzymogenes | 741 | Open in IMG/M |
| 3300031544|Ga0318534_10819824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300031640|Ga0318555_10347823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 803 | Open in IMG/M |
| 3300031668|Ga0318542_10614085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300031679|Ga0318561_10730902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300031682|Ga0318560_10067318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1800 | Open in IMG/M |
| 3300031682|Ga0318560_10658761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300031713|Ga0318496_10086490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1669 | Open in IMG/M |
| 3300031744|Ga0306918_10567851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 889 | Open in IMG/M |
| 3300031753|Ga0307477_10094137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2080 | Open in IMG/M |
| 3300031754|Ga0307475_10420439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1074 | Open in IMG/M |
| 3300031792|Ga0318529_10066611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1581 | Open in IMG/M |
| 3300031792|Ga0318529_10149565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1074 | Open in IMG/M |
| 3300031793|Ga0318548_10097337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1405 | Open in IMG/M |
| 3300031796|Ga0318576_10256608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 825 | Open in IMG/M |
| 3300031797|Ga0318550_10552673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300031805|Ga0318497_10749008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300031820|Ga0307473_11515581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300031823|Ga0307478_10359649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1200 | Open in IMG/M |
| 3300031832|Ga0318499_10168627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 854 | Open in IMG/M |
| 3300031894|Ga0318522_10248182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300031896|Ga0318551_10177571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1171 | Open in IMG/M |
| 3300031896|Ga0318551_10564613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300031941|Ga0310912_10770773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300031981|Ga0318531_10143466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1067 | Open in IMG/M |
| 3300032001|Ga0306922_11272218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 745 | Open in IMG/M |
| 3300032008|Ga0318562_10232388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1070 | Open in IMG/M |
| 3300032008|Ga0318562_10650952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300032010|Ga0318569_10064673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1609 | Open in IMG/M |
| 3300032025|Ga0318507_10236204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 792 | Open in IMG/M |
| 3300032041|Ga0318549_10408672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300032052|Ga0318506_10109947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1184 | Open in IMG/M |
| 3300032055|Ga0318575_10561054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300032059|Ga0318533_10215816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1378 | Open in IMG/M |
| 3300032065|Ga0318513_10564157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300032066|Ga0318514_10029803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2549 | Open in IMG/M |
| 3300032066|Ga0318514_10586504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300032076|Ga0306924_10156099 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2614 | Open in IMG/M |
| 3300032076|Ga0306924_12178125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300032089|Ga0318525_10058837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1918 | Open in IMG/M |
| 3300032091|Ga0318577_10434919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 626 | Open in IMG/M |
| 3300032205|Ga0307472_102033137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300032954|Ga0335083_11040518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 642 | Open in IMG/M |
| 3300033829|Ga0334854_060640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 903 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 39.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.54% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.80% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.87% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 1.87% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.93% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.93% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.93% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070713_1008837642 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LPTDAARIRRSLPDFHLDVLNHTGHFLMLEDPPRFNALLLQDIGLITQRAAH* |
| Ga0073909_102223352 | 3300005526 | Surface Soil | SDLLPTDAARIRRSLPDFHLDVLNHTGHFLMLEDPPRFNALLLQDIGLITQRAAH* |
| Ga0070731_105984922 | 3300005538 | Surface Soil | SLPDFTLDVLPHSGHFLMLETPERFNPLLLKDVGALAARAAH* |
| Ga0070733_103880271 | 3300005541 | Surface Soil | LPDFSLDVLDHSGHFLMMEDPARFNPLLLKDLAAIATRAAH* |
| Ga0070695_1007468182 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | PDFHLDVLNHTGHFLMLEDPPRFNALLLQDIGLITQRAAH* |
| Ga0066701_103388311 | 3300005552 | Soil | DAARIRRSLPDFTLDVLDHTGHFLMLEAPARFNPLLLKDIEALSARAGR* |
| Ga0070761_104280492 | 3300005591 | Soil | LPTDAARIRKSLPNFTLDVLDHSGHFLMLETPARFNPLLLKDLALLAAQPSH* |
| Ga0070763_101046111 | 3300005610 | Soil | DVLPHSGHFLMMEDPARFNPLLLKDITAITQHAAH* |
| Ga0066903_1067355282 | 3300005764 | Tropical Forest Soil | DATRIRRALPDFHLDVLDHSGHFLMLEAPERFNPLLLQDLQAITQRATAH* |
| Ga0066903_1072754301 | 3300005764 | Tropical Forest Soil | PDFHLDVLDHSGHFLMLEAPERFNPLLLQDLQAITQRATAH* |
| Ga0070766_102618122 | 3300005921 | Soil | DLLPTDAARIRKSIPNFTLDVLDHSGHFLMLEAPARFNPLLLKDLAALAAQPSH* |
| Ga0068871_1019871391 | 3300006358 | Miscanthus Rhizosphere | DAARIRRSLPDFHLDVLDHTGHFLMLEDPVRFNARLLQDLAVITQRAAH* |
| Ga0074057_102960462 | 3300006605 | Soil | FTLDVLDHSGHFLMLEAPTRFNPLLLKDLAALAAPPAH* |
| Ga0074062_122661581 | 3300006606 | Soil | FTLDVLDHSGHFLMLEAPARFNPLLLKDLAALAAPPAH* |
| Ga0123355_104384434 | 3300009826 | Termite Gut | ALPDFHLDVLEHTGHFLMLETPARLNPLLLADVAALAHGAPH* |
| Ga0123355_115260442 | 3300009826 | Termite Gut | LAPTDAARIRQALPDFHLDVLEHTGHFLMLEAPERFNPLLLADIAALAQGAPH* |
| Ga0134082_101819212 | 3300010303 | Grasslands Soil | DFTLDVLDHTGHFLMLEAPARFNPLLLKDIEALSARAGR* |
| Ga0134109_101800231 | 3300010320 | Grasslands Soil | RKSLPDFTLDVLEHSGHFLMLEAPERFNPLLLKDLDALSARAAH* |
| Ga0126376_107529171 | 3300010359 | Tropical Forest Soil | PDFHLDVLDHSGHFLMLEAPERFNPLLLQDLQAITQRAAH* |
| Ga0126378_109947201 | 3300010361 | Tropical Forest Soil | RIRRALPDFHLDVLDHTGHFLMLEAPARFNPLLLQDLQAITQRASAH* |
| Ga0126377_121507541 | 3300010362 | Tropical Forest Soil | TRIRPALPDFHLDVLDHSGHFLMLEAPERFNPLLLQDLQAITQRAAH* |
| Ga0126381_1050141782 | 3300010376 | Tropical Forest Soil | PTDAARIRRALPDFHLDVLEHTGHFLMLEAPERFNPLLLQDLQAITQRAAH* |
| Ga0126369_112582501 | 3300012971 | Tropical Forest Soil | TTVDVLEHSDHFLMLEDPARFNPLLLKDLAALAARTDAH* |
| Ga0134087_100468233 | 3300012977 | Grasslands Soil | KSLPDFTLDVLDHSGHFLMLEAPARFNPLLLKDLDALSARAAH* |
| Ga0164309_100077741 | 3300012984 | Soil | LLPTDAARIRKALPDFTLDVLDHSGHFLMLEAPARFNPLLLKDLAALAAPPAH* |
| Ga0157373_113128762 | 3300013100 | Corn Rhizosphere | RIRKALPDFTLDVLDHSGHFLMLEAPARFNPLLLKDLAALAAPPAH* |
| Ga0075355_11055062 | 3300014322 | Natural And Restored Wetlands | DLAPTDAARIRKSLPDFTLDLMPHTGDFLMLEDPARFNALLLKDLEAISTRPAR* |
| Ga0132256_1006073441 | 3300015372 | Arabidopsis Rhizosphere | DVLNHTGHFLMLEDPPRFNALLLQDITVITQRAAH* |
| Ga0182036_106803341 | 3300016270 | Soil | PDFHLDVLDHTGHFLMLEAPARFNPLLLQDLQAITQRATH |
| Ga0182033_103869501 | 3300016319 | Soil | AARIRRALPDFHLDVLDHTGHFLMLEAPARFNPLLLQDLQAITQRAAH |
| Ga0182035_104664071 | 3300016341 | Soil | LPTDAARIRRSLPDFHLDVLDHTGHFLMLEAPARFNPLLLQDLEAITQHAAH |
| Ga0182037_103916022 | 3300016404 | Soil | LLPTDAARIRRALPDFHLDVLDHTGHFLMLEAPARFNPLLLQDLQAITQRATH |
| Ga0182038_104480971 | 3300016445 | Soil | IRRSLPDFHLDVLDHTGHFLMLEDPARFNALLLQDLAAISQRAAH |
| Ga0187779_105264431 | 3300017959 | Tropical Peatland | AARIRRSLPDFTLDVIDHSGTFLMLEAPQRFNPLLLKDIAAIAQRAPH |
| Ga0187778_100490264 | 3300017961 | Tropical Peatland | RRSISDFTLDVLPHSGNFLMLEAPARFDPLLLKDVAALAARAAH |
| Ga0187783_100169161 | 3300017970 | Tropical Peatland | ARIRKSLPDFTLDVLDHSGHFLMLEAPQRFNPLLLKDVAAIVQRAPH |
| Ga0187777_104086902 | 3300017974 | Tropical Peatland | RRALPDFHLDVLDHTGHFLMLEAPERFNPLLLQDLQAITQRATH |
| Ga0187782_102741683 | 3300017975 | Tropical Peatland | SLPDFTLDVLDHSGHFLMLEAPARFNPLLLRDLKAIAQRAAH |
| Ga0187765_106648591 | 3300018060 | Tropical Peatland | EVLAHSDHFLMLEDPARFNPLLLQAVGALAATAAH |
| Ga0187772_108597081 | 3300018085 | Tropical Peatland | RKSLPDFHLDVLDHTGHFLMLEAPARFNPLLLRDVAAIAQRTSH |
| Ga0210399_108221741 | 3300020581 | Soil | LPGLSLEVLDHSGHFLMLEAPARFNPLLLKDIGALAAGAAH |
| Ga0210395_103901001 | 3300020582 | Soil | RIRKSLPDFTLDVLEHSGHFLMLEAPARFNPLLLKDLDALSARAAH |
| Ga0210404_108613391 | 3300021088 | Soil | PQFTLQVLPHTGHFLMMEAPARFNPLLLQDLDALAQQAAH |
| Ga0210406_106987381 | 3300021168 | Soil | EVLDHSGHFLMLEAPARFNPLLLKDIGALAAGAAH |
| Ga0210408_100681835 | 3300021178 | Soil | AARIAKSLPQFTLQVLPHTGHFLMMEAPARFNPLLLQDLDALAQQAAH |
| Ga0213882_102702201 | 3300021362 | Exposed Rock | DVLHHSSHFPMLEAPARFNPLLLKDVASIVQRAAH |
| Ga0213874_101465731 | 3300021377 | Plant Roots | RLVPDFHVDVIPHSSHFLMMDDAARFNPLLLKDIALLQQRAGSQR |
| Ga0210393_115520802 | 3300021401 | Soil | RSLPQFTLDVLPHTGHFLMMEAPARFNPLLLKDLEALAPHGA |
| Ga0210397_112748682 | 3300021403 | Soil | TDGDRIRKSLPGFTLDVLPHSGHFLMLEAPERFNPLLTRDIDALAARAGH |
| Ga0210386_101271381 | 3300021406 | Soil | IRRSLPDFHLDVLNHTGHFLMLEDPPRFNALLLQDLTAITQRAAH |
| Ga0213878_101465091 | 3300021444 | Bulk Soil | SDLLPTDAARIRRSLPDFHLDVLAHTGHFLMLEDPARFNALLLQDLSAITRHAAH |
| Ga0210390_113241452 | 3300021474 | Soil | LPTDGDRIRKSLPGFTLDVLPHSGHFLMLEAPERFNPLLTREIDALATRAGH |
| Ga0210390_114608542 | 3300021474 | Soil | RIRKSLPDFTLDVLPHTGHFLMLEAPGRFNPLLIKDIDALAARAPH |
| Ga0126371_103822891 | 3300021560 | Tropical Forest Soil | IRKSLPDFTLDVLDHSSHFLMLETPARFNPLLLKDIAAIVQRAPH |
| Ga0126371_117296442 | 3300021560 | Tropical Forest Soil | AVRIRKALPDFTLDVLDHTGHFLMLEDPARFNPLLLKDIAAITQRSTH |
| Ga0212123_105740462 | 3300022557 | Iron-Sulfur Acid Spring | SLDVLDHSGHFLMMEDPARFNPLLLKDLAAIATRAAH |
| Ga0137417_11838012 | 3300024330 | Vadose Zone Soil | TDAARIRKSLPDFTLDVLEHSGHFLMLEAPARFNPLLLKDLDALSARAAH |
| Ga0207700_109601442 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LDVLNHTGHFLMLEDPPRFNALLLQDIGLITQRAAH |
| Ga0209803_11602502 | 3300026332 | Soil | IRRSLPDFTLDVLDHTGHFLMLEAPARFNPLLLKDIEALSARAGR |
| Ga0209116_11044602 | 3300027590 | Forest Soil | LPDFSLDVLDHSGHFLMMEDPARFNPLLLKDVAAITARAAH |
| Ga0209693_101011373 | 3300027855 | Soil | DVLPHSGHFLMMEDPARFNPLLLKDITAITQHAAH |
| Ga0209380_101241124 | 3300027889 | Soil | QFTLDVLPHTGHFLMMEAPARFNPLLLKDLEALAPHGA |
| Ga0308309_105952382 | 3300028906 | Soil | RKSLPNFTLDVLSHSGHFLMLEDPARFNPLLLKDVAAIAATTGAH |
| Ga0170834_1044423471 | 3300031057 | Forest Soil | TDAVRIKKSLPDFTLDVMAHTGDFPMLEDPARFNALLLKDLEAIGARSAR |
| Ga0318534_108198241 | 3300031544 | Soil | DVLDHTGHFLMLEDPARFNALLLQDLAAISQRAAH |
| Ga0318555_103478232 | 3300031640 | Soil | LLPTDAARIRRSLPDFHLDVLDHTGHFLMLEDPARFNALLLQDLAAISQRAAH |
| Ga0318542_106140852 | 3300031668 | Soil | DAARIRRSLPDFHLDVLNHTGHFLMLEDPPRFNALLLQDIGVISQRAAH |
| Ga0318561_107309022 | 3300031679 | Soil | AARIRKALPDFTLDVLDHTGHFLMLEDPARFNPLLLKDIDAITRRSTH |
| Ga0318560_100673183 | 3300031682 | Soil | DFHLDVLDHTGHFLMLEDPARFNTLLLQDLAAITQRAAH |
| Ga0318560_106587612 | 3300031682 | Soil | FHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH |
| Ga0318496_100864903 | 3300031713 | Soil | LPTDAARIRRSLPDFHLDVLDHTGHFLMLEDPARFNTLLLQDLAAITQRAAH |
| Ga0306918_105678512 | 3300031744 | Soil | IRRALPDFHLDVLDHTGHFLMLEAPARFNPLLLQDLQAITQRAAH |
| Ga0307477_100941371 | 3300031753 | Hardwood Forest Soil | IRKSLPDFTLDVLDHSGHFLMLEAPARFNPLLLKDLDALGARATH |
| Ga0307475_104204391 | 3300031754 | Hardwood Forest Soil | PTDGDRIRKSLPGFTLDVLPHSGHFLMLEAPERFNPLLTRDIDALAARAGH |
| Ga0318529_100666111 | 3300031792 | Soil | DAARIRRALPDFHLDVLDHTGHFLMLEAPARFNPLLLQDLQAITQRAAH |
| Ga0318529_101495651 | 3300031792 | Soil | YAINSDMLPTDAARIRRSLPDFHLDVLNHTGHFLMLEDPARFNALLLQDIGVISQRAAH |
| Ga0318548_100973373 | 3300031793 | Soil | TDAARIRRSLPDFHLDVLDHTGHFLMLEAPERFNAVLLQDLGAIVQHSAH |
| Ga0318576_102566082 | 3300031796 | Soil | ARIRRALPDFHLDVLDHTGHFLMLEAPARFNPLLLQDLQAITQRAAH |
| Ga0318550_105526732 | 3300031797 | Soil | FHLDVLDHTGHFLMLEAPARFNPLLLQDIQAITQRAAH |
| Ga0318497_107490081 | 3300031805 | Soil | ARIRRSLPDFHLDVLDHTGHFLMLEAPERFNAVLLQDLGAIAQRSAH |
| Ga0307473_115155811 | 3300031820 | Hardwood Forest Soil | SLPGFTLDVLPHSGHFLMLEAPERFNPLLTRDIDALAARAGH |
| Ga0307478_103596491 | 3300031823 | Hardwood Forest Soil | LPGFTLDVLPHSGHFLMLEAPERFNPLLTRDIDALAARAGH |
| Ga0318499_101686272 | 3300031832 | Soil | SGALPDFHLDVLDHTGHFLMLEAPARFNPLLLQDLQAITQRAAH |
| Ga0318522_102481821 | 3300031894 | Soil | LADFHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH |
| Ga0318551_101775712 | 3300031896 | Soil | RIRRSLADFHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH |
| Ga0318551_105646132 | 3300031896 | Soil | DVLDHTGHFLMLEAPARFNPLLLQDLQAITQRATH |
| Ga0310912_107707731 | 3300031941 | Soil | FHLDVLDHTGHFLMLEAPERFNAVLLQDLSAIAQRSAH |
| Ga0318531_101434662 | 3300031981 | Soil | HLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH |
| Ga0306922_112722181 | 3300032001 | Soil | LPDFHLDVLNHTGHFLMLEDPARFNALLLQDIGVISQRAAH |
| Ga0318562_102323881 | 3300032008 | Soil | PDFHLDVLDHTGHFLMLEDPARFNALLLQDLAAISQRAAH |
| Ga0318562_106509521 | 3300032008 | Soil | ADFHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH |
| Ga0318569_100646733 | 3300032010 | Soil | FHLDVLDHTGHFLMLEDPARFNTLLLQDLAAITQRAAH |
| Ga0318507_102362041 | 3300032025 | Soil | SLPDFHLDVLPHTGHFLMLEDPTRFNSLLLQDLAVITQRAAH |
| Ga0318549_104086721 | 3300032041 | Soil | DFHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH |
| Ga0318506_101099471 | 3300032052 | Soil | IRRSLPDFHLDVLDHTGHFLMLEAPERFNAVLLQDLGAIVQRSAH |
| Ga0318575_105610541 | 3300032055 | Soil | DLLPTDAARIRRSLADFHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH |
| Ga0318533_102158163 | 3300032059 | Soil | DVLDHTGHFLMLEAPARFNPLLLQDIQAITQRAAH |
| Ga0318513_105641571 | 3300032065 | Soil | IRRSLADFHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH |
| Ga0318514_100298034 | 3300032066 | Soil | IRRSLPDFHLDVLNHTGHFLMLEDPARFNALLLQDIGVISQRAAH |
| Ga0318514_105865042 | 3300032066 | Soil | SLPDFHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH |
| Ga0306924_101560995 | 3300032076 | Soil | PTDAARIRRSLPDFHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH |
| Ga0306924_121781252 | 3300032076 | Soil | TDAARIRRSLPDFHLDVLDHTGHFLMLEAPARFNPLLLQDIQAITQRAAH |
| Ga0318525_100588373 | 3300032089 | Soil | LPDFHLDVLDHTGHFLMLEAPERFNAVLLQDLSAIAQRSAH |
| Ga0318577_104349192 | 3300032091 | Soil | AARIRRSLADFHLDVLDHTGHFLMLEDPARFNVLLLQDLAAITQGAAH |
| Ga0307472_1020331371 | 3300032205 | Hardwood Forest Soil | AARIHRSLPDFRLDVLNHSGHFLMLEDPPRFNALLLQDLAAITQRAAH |
| Ga0335083_110405182 | 3300032954 | Soil | RKSLPDFTLDVMPHTGHFPMLEAPERFNALLLKDIDALAARAR |
| Ga0334854_060640_763_903 | 3300033829 | Soil | RIRKSLPDFTLDVLDHSSHFLMLEDPARFNPLLLKDVAAIAQRAAH |
| ⦗Top⦘ |