NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092106

Metagenome / Metatranscriptome Family F092106

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092106
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 127 residues
Representative Sequence MYVATLMAMVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDHKYWNNDLRPEFEGETRGLWETTHADKYTGRIF
Number of Associated Samples 94
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 12.50 %
% of genes near scaffold ends (potentially truncated) 47.66 %
% of genes from short scaffolds (< 2000 bps) 94.39 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (88.785 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(21.495 % of family members)
Environment Ontology (ENVO) Unclassified
(62.617 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(66.355 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.19%    β-sheet: 22.52%    Coil/Unstructured: 56.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.20 %
UnclassifiedrootN/A2.80 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003621|JGI26083J51738_10033987All Organisms → Viruses → Predicted Viral1415Open in IMG/M
3300006399|Ga0075495_1414600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea831Open in IMG/M
3300006415|Ga0099654_11337787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea619Open in IMG/M
3300006920|Ga0070748_1292043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea581Open in IMG/M
3300007557|Ga0102821_1128397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea644Open in IMG/M
3300007629|Ga0102895_1103370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea736Open in IMG/M
3300007692|Ga0102823_1036641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1329Open in IMG/M
3300008108|Ga0114341_10104337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1716Open in IMG/M
3300008938|Ga0103741_1078032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea657Open in IMG/M
3300009071|Ga0115566_10177700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1312Open in IMG/M
3300009422|Ga0114998_10294283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea761Open in IMG/M
3300009432|Ga0115005_10114237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2079Open in IMG/M
3300009432|Ga0115005_11359436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea580Open in IMG/M
3300009434|Ga0115562_1187350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea748Open in IMG/M
3300009442|Ga0115563_1257180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea649Open in IMG/M
3300009495|Ga0115571_1179050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea876Open in IMG/M
3300009497|Ga0115569_10059654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2062Open in IMG/M
3300009505|Ga0115564_10332886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea754Open in IMG/M
3300009592|Ga0115101_1435028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea629Open in IMG/M
3300009599|Ga0115103_1578728All Organisms → Viruses → Predicted Viral1949Open in IMG/M
3300009599|Ga0115103_1592854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea586Open in IMG/M
3300009608|Ga0115100_11009333All Organisms → Viruses → Predicted Viral1942Open in IMG/M
3300009677|Ga0115104_10124023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea669Open in IMG/M
3300009677|Ga0115104_11198206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea678Open in IMG/M
3300009677|Ga0115104_11206328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea799Open in IMG/M
3300010309|Ga0102890_1011676All Organisms → Viruses → Predicted Viral1737Open in IMG/M
3300012408|Ga0138265_1365479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1976Open in IMG/M
3300012414|Ga0138264_1194330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea796Open in IMG/M
3300012415|Ga0138263_1384149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea857Open in IMG/M
3300012524|Ga0129331_1066516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea623Open in IMG/M
3300012954|Ga0163111_11275506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea720Open in IMG/M
3300012969|Ga0129332_1096379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea579Open in IMG/M
3300016737|Ga0182047_1145765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea534Open in IMG/M
3300018426|Ga0181566_10858623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea617Open in IMG/M
3300018692|Ga0192944_1024875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea856Open in IMG/M
3300018871|Ga0192978_1005079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1987Open in IMG/M
3300018871|Ga0192978_1042019All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea861Open in IMG/M
3300018874|Ga0192977_1021814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1220Open in IMG/M
3300018980|Ga0192961_10043874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1264Open in IMG/M
3300018982|Ga0192947_10144156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea795Open in IMG/M
3300019021|Ga0192982_10164355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea781Open in IMG/M
3300019045|Ga0193336_10011234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1484Open in IMG/M
3300019048|Ga0192981_10019525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2053Open in IMG/M
3300019048|Ga0192981_10021697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1988Open in IMG/M
3300019048|Ga0192981_10122107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1028Open in IMG/M
3300019050|Ga0192966_10189963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea734Open in IMG/M
3300020048|Ga0207193_1204483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1555Open in IMG/M
3300020165|Ga0206125_10358700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea536Open in IMG/M
3300021342|Ga0206691_1859405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea508Open in IMG/M
3300021350|Ga0206692_1816807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea587Open in IMG/M
3300021887|Ga0063105_1043981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1248Open in IMG/M
3300021941|Ga0063102_1018026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1697Open in IMG/M
3300021962|Ga0222713_10718411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea567Open in IMG/M
3300024346|Ga0244775_10149687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1970Open in IMG/M
3300025626|Ga0209716_1133499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea662Open in IMG/M
3300025699|Ga0209715_1052027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1745Open in IMG/M
3300025704|Ga0209602_1194200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea609Open in IMG/M
3300025890|Ga0209631_10340840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea711Open in IMG/M
3300026443|Ga0247559_1120009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea536Open in IMG/M
3300026448|Ga0247594_1007517All Organisms → Viruses → Predicted Viral1634Open in IMG/M
3300026448|Ga0247594_1070234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea608Open in IMG/M
3300026448|Ga0247594_1100536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia511Open in IMG/M
3300026462|Ga0247568_1106221All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea552Open in IMG/M
3300026468|Ga0247603_1014637All Organisms → Viruses → Predicted Viral1394Open in IMG/M
3300027525|Ga0208437_1073617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea800Open in IMG/M
3300027810|Ga0209302_10170760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1054Open in IMG/M
3300027833|Ga0209092_10396701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea723Open in IMG/M
3300027833|Ga0209092_10599572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea551Open in IMG/M
3300027899|Ga0209668_10173826All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1324Open in IMG/M
3300028106|Ga0247596_1111685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia620Open in IMG/M
3300028137|Ga0256412_1204249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea729Open in IMG/M
3300028137|Ga0256412_1264404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea634Open in IMG/M
3300028290|Ga0247572_1181617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea528Open in IMG/M
3300030670|Ga0307401_10257804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea790Open in IMG/M
3300030671|Ga0307403_10293016All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea866Open in IMG/M
3300030671|Ga0307403_10785765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia518Open in IMG/M
3300030709|Ga0307400_10800930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea582Open in IMG/M
3300031569|Ga0307489_10182598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea1288Open in IMG/M
3300031579|Ga0308134_1094547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea682Open in IMG/M
3300031638|Ga0302125_10219601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea584Open in IMG/M
3300031717|Ga0307396_10195169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea959Open in IMG/M
3300031725|Ga0307381_10240910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea640Open in IMG/M
3300031729|Ga0307391_10682435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea585Open in IMG/M
3300031735|Ga0307394_10066777All Organisms → Viruses → Predicted Viral1307Open in IMG/M
3300031738|Ga0307384_10025688All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1878Open in IMG/M
3300031742|Ga0307395_10360269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia630Open in IMG/M
3300031752|Ga0307404_10467142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea530Open in IMG/M
3300031784|Ga0315899_11247737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea640Open in IMG/M
3300032050|Ga0315906_10444370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1114Open in IMG/M
3300032463|Ga0314684_10565765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea664Open in IMG/M
3300032517|Ga0314688_10167103All Organisms → Viruses → Predicted Viral1094Open in IMG/M
3300032520|Ga0314667_10749068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea532Open in IMG/M
3300032616|Ga0314671_10039272All Organisms → Viruses → Predicted Viral1941Open in IMG/M
3300032666|Ga0314678_10400870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea620Open in IMG/M
3300032708|Ga0314669_10658764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea575Open in IMG/M
3300032723|Ga0314703_10354126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea604Open in IMG/M
3300032724|Ga0314695_1355526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Peniculida → Parameciidae → Paramecium → Paramecium tetraurelia557Open in IMG/M
3300032732|Ga0314711_10476142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea643Open in IMG/M
3300032742|Ga0314710_10336814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea627Open in IMG/M
3300032746|Ga0314701_10451420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea580Open in IMG/M
3300032747|Ga0314712_10434108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea623Open in IMG/M
3300034066|Ga0335019_0623098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea629Open in IMG/M
3300034280|Ga0334997_0955725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea507Open in IMG/M
3300034355|Ga0335039_0223522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1029Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine21.50%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine17.76%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater11.21%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater9.35%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine8.41%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.67%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.80%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.80%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.87%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.87%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.87%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.93%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.93%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.93%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.93%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.93%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.93%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.93%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.93%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.93%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.93%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.93%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003621Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNAEnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007557Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715EnvironmentalOpen in IMG/M
3300007629Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010309Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025704Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300026443Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 4R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027525Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034280Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI26083J51738_1003398723300003621MarineMEGYRYCDDHDYMNLQYGMKRSIVRPSHTMYVASLMALIYSMDFDYVTKMRYNKDKDLVFVTKPDRFWGETEHVYEMHHLEQLVPAPVTAMKDMTALDENGILTVSDMAEKEYLKFYKDEKYWNL
Ga0075495_141460023300006399AqueousMNVQYGAKRSVVRPSHTMYVATLMAMVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAVKDMSSKDENGIMTVHCMAQNEQMKFYKDQKFWNNDLRPEFENETRGLWETTHADKYTGRIF*
Ga0099654_1133778713300006415LakeMDLDYATKMRYNKDKDLVFVTKPDRFWGEKEHVYEMHHLEQMVPSAVTAMKDMSSLSPTGIMTVHDMSENENIKLYKDPKYWNMDVREEFFAETRTLWENTHADKYKGRLF*
Ga0070748_129204323300006920AqueousATLMALLYGMDFDYVTKMRYNKDKDLVFVTKPNKLWGEKEHVYEVHHLEQMVPSPVTAMKEMSGMNEKGIMTVHCMAQNENLKLYKEEKYWNSDLRQDFFKETMGLWDTTHADKYTGRIFQSRGAPPKDLELAM*
Ga0102821_112839723300007557EstuarineDHDYMNIQYGAKRTVVRSSHTMYVATAMALLYGMDFDYVTKMRYNKDKDLVFVTKPDKLWGEKEHVYEVHHLEQMVPAPVTAMKHMSAMRHDGIMTVKDMAQNENLKFYKEDKYWNADLKKEFMNETRGLWE*
Ga0102895_110337013300007629EstuarineMNIQYGAKRTVVRSSHTMYVATAMALLYGMDFDYVTKMRYNKDKDLVFVTKPDKLWGEKEHVYEVHHLEQMVPAPVTAMKHMSAMRHDGIMTVKDMAQNENLKFYKEDKYWNADLKKEFMNETRGLWE*
Ga0102823_103664123300007692EstuarineMNIQYGAKRTVVRSSHTLYVATAMALLYGMDFDYVTKMRYNKDKDLVFVTKPDKLWGEKEHVYEVHHLEQMVPAPVTAMKHMSAMRHDGIMTVKDMAQNENLKFYKEDKYWNADLKKEFMNETRGLWE*
Ga0114341_1010433733300008108Freshwater, PlanktonMDLDYATKMRYNKDKDLVFVTKPDRFWGEKEHVFEMHHLEQMVPSPVTAMKDMSSLSPTGIMTVHDMAENENIKLYKDPKYWNMELREEFFAETRTLWENTHADKYQGRLF*
Ga0103741_107803213300008938Ice Edge, Mcmurdo Sound, AntarcticaMYVATLMGLVHQMDFDYVTKMRYNKDKDLVFITKPDRLWGESEHCYEMHHLEQLVPAAVTAMKDMTALDPKGVLTVCDMAEKEYLKFYKDDKYWNQELREEFLGETRGLWETTHADKYTGRIFQTRGAPWQERCPCLGRL*
Ga0115566_1017770033300009071Pelagic MarineMYVVTVMTLIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPAAVTAMKNMSAMDHDGILTVHDMGEKDYLKFYKEDKYWNLELKEEF*
Ga0114998_1029428313300009422MarineMYVATLMGLVHQMDFDYVTKMRYNKDKDLVFVTKPDRLWGESEHCYEMHHLEQLVPAAVTAMKDMTALDPKGVLTVCDMAEKEYLKFYKDEKYWNQELREEFLGETRGLWETTHADKYTGRIFQTRGAPSKDTVLAMDK
Ga0115005_1011423723300009432MarineMYVATLMAMVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDHKYWNNDLRPEFEGETRGLWETTHADKYTGRIF*
Ga0115005_1135943623300009432MarineTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDQKYWNNDLRPEFEGETRGLWETTHADKYTGRIF*
Ga0115562_118735023300009434Pelagic MarineMYVATLMAMVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAVKDMSSKDENGIMTVHCMAQNEQMKFYKDQKFWNNDLRPEFENETRGLWETTHAD
Ga0115007_1122044313300009441MarineYVTKMRYNKEKDLVFVQRVDRLWGETEHTYEMHHLEQMVPAAVTAMKNSPALHPNGILTVHDMADKHYLKFYQDTKYWNSDLK*
Ga0115563_125718023300009442Pelagic MarineIVRPSHTMYVVTVMTLIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPAAVTAMKNMSAMDHDGILTVHDMGDKDYLKFYKEDKYWNLELKEEF*
Ga0115571_117905023300009495Pelagic MarineMYVATLMAMVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAVKDMSSKDENGIMTVHCMAQNEQMKFYKDQKFWNNDLRPEFENETRGLWETTHADKYTGRIF*
Ga0115569_1005965423300009497Pelagic MarineMNVQYGAKRSIVRPAHTMYVCSLMGLIYSMDFDYVTKMRYNKEKDLVFVTKPDRFWGESEHVYEMHHLEQMVPSAITAMKNMSANDHDGILTVHDMGDKDYLKFYKEDKYWNLELKDEFMGETRGLWDTTHADKYTGRIF*
Ga0115564_1033288613300009505Pelagic MarineWYDIPRQFQDGSGWGLEGVRYCDDHDYMNIQYGAKRSIVRPSHTMYVVTIMTLIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGESEHVYEMHHLEQMVPAAVTAMKNMSAMDHDGILTVHDMGEKDYLKFYKEDKYWNLELKDEFTQETRGLWDTTH*
Ga0115101_143502813300009592MarineYMNIQYGAKRSIVRPSHTMYVVTLMTLIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGESEHVYEMHHLEQMVPAAVTAMKNMSAMDHDGILTVHDMGEKDYLKFYKEDKYWNLELKDEFTQETRGLWDTTH*
Ga0115103_157872823300009599MarineMYVATLMAMVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAVKDMSSKDENGIMTVHCMAMNEQMKFYKDQKYWNNDLRPEFENETRGLWETTHADKYTGRIF*
Ga0115103_159285423300009599MarineMNLQYGAKRAIVRPAHTMYVATLMALIYSMDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQLVPAPVTAVKNMTALEPDGILTVCDMAEKEYLKFYKEEKYWNQDLKEEFYGETRGLWETTHADKYTGRIFQARGAAPK
Ga0115100_1100933323300009608MarineMYVATLMAMVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAVKDMSAKDENGIMTVHCMAMNEQMKFYKDQKYWNNDLRPEFENETRGLWETTHADKYTGRIF*
Ga0115104_1012402313300009677MarineMYVATLMAMVWCLDFDYVTKMRYNKDKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDHKYWNNDLRPEFEGETRGLWETTHADKYTGRIF*
Ga0115104_1119820623300009677MarineMYVATLMAMVWSLDLDYVTKMRYNKDKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVGAIKDMASKGEDGILTVHCMAQNEQMKFYKDHKYWNNELRPEFENETRGLWETTHANKYAGRIF*
Ga0115104_1120632823300009677MarineMYVACLAYMIYAMDMDYVTKMKYNKDKDLVFVQRQDRLWGETEHTYEMHHLEQMVPAAITAMKNMPSLDPNGILTIHDMADKHYLKFYQDPKYWNAELKEEFLSETRSLWDTTHADKYNGRILGNLGGLADRE*
Ga0102890_101167613300010309EstuarineMEGYRYCDDHDYMNLQYGMKRSIVRPSHTMYVASLMALIYSMDFDYVTKMRYNKDKDLVFVTKPDRFWGETEHVYEMHHLEQLVPAPVTAMKDMTALDENGILTVSDMAEKEYLKFYKDEKYWNLDLKDEFMQETRGLW
Ga0138265_136547923300012408Polar MarineMNAQYGAKRSVVRPSHTMYVATLMAMVWCLDFDYVTKMRYNKDKDLVFVTKPDRFWGETEHIYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDHKFWNNDLRPEFEGETRGLWETTHADKYTGRIF*
Ga0138264_119433023300012414Polar MarineMNAQYGAKRYVVRPSHTMYVATIMAMVWCLDFDYVTKMRYNKDKDLVFVTKPDRFWGETEHIYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDHKFWNNDLRPEFEGETRGLWETTHADKYTGRIF*
Ga0138263_138414923300012415Polar MarineMYVATLMAMVWCLDFDYVTKMRYNKDKDLVFVTKPDRFWGETEHIYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDHKFWNNDLRPEFEGETRGLWETTHADKYTGRIF*
Ga0129331_106651623300012524AqueousNIQYGAKRSIVRPSHTMYVVTVMTLIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPAAVTAMKNMSAMDHDGILTVHDMGDKDYLKFYKEDKYWNLELKEEF*
Ga0163111_1127550623300012954Surface SeawaterGWGLEGIRYCDDHDYMNIQYGAKRSMVRPAHTMYVCSLMALIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAMKNMSANDHDGILTVHDMAEKDYLKLYKEEKYWNLELRDEFMAETRGLWDTTHADKYTGRIF*
Ga0129332_109637923300012969AqueousTLMAMVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAVKDMSSKDENGIMTVHCMAQNEQMKFYKDQKFWNNDLRPEFENETRGLWETTHADKYTGRIF*
Ga0182047_114576513300016737Salt MarshLLYGMDFDYVTKMRYNKDKDLVFVTKPNKFWGEKEHVYEVHHLEQMVPSPVTAMKEMSGMNEKGIMTVHCMAQNENLKLYKEEKYWNSDLRQDFFKETMGLWDTTHADKYTGRIFQSRGAPPKDLELAM
Ga0181566_1085862313300018426Salt MarshIQYGGKRALARPAHTMYVATLMAMIYGLDLDYVTKMRYNRDKDLVFVTKPDKFWGETEHVYEMHHLEQMVPAPVTAMKNITSLDQNGVLTVFDMAEKENLKFYNNPKYWNTDLR
Ga0192944_102487523300018692MarineMNIQYGAKRSIVRPSHTMYVVTIMTLIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGESEHVYEMHHLEQMVPAAVTAMKNMSAMDHDGILTVHDMGEKDYLKFYKEDKYWNLELKDEFTQETRGLWDTTH
Ga0192978_100507953300018871MarineMYVAALAYLIYSMDMDYVTKMRYNKEKDLVFVQRVDRLWGETEHTFEMHHLEQTVPAAVTAMKNNPALAPDGILTIHDMADKNYLKFY
Ga0192978_104201923300018871MarineMNAQYGAKRSVVRPSHTMYVATLMAMVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHIYEMHHLEQMVPSAVGAIKDMSSKDENGIMTVHCMAQNEQMKFYKDHKFWNNDLRPEFEGETRGLWETTHADKYTGRIF
Ga0192977_102181433300018874MarineMNVQYGAKRSIVRPSHTMYVVTIMTLIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGESEHVYEMHHLEQMVPAAVTAMKNMSAMDHDGILTVHDMGEKDYLKFYKEDKYWNLELKDEFT
Ga0192961_1004387423300018980MarineMNAQYGAKRSIVRPSHTMYVATLMAMVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDHKYWNNDLRPEFEGETRGLWETTHADKYTGRIF
Ga0192947_1014415623300018982MarineMDLDYVTKMRYNKDKDLVFVNKPDNLWGETEHVYEMHHLEQMVPSPITAMKNMSANDPNGILTIQDMAEKEYLKFYKDTKYWNMDLRDEFISETRGLWEGTHCDKRMGRAFQTTGASVPRDFAVAM
Ga0192982_1016435523300019021MarineMYVVTIMTLIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGESEHVYEMHHLEQMVPAAVTAMKNMSAMDHDGILTVHDMGEKDYLKFYKEDKYWNLELKDEFT
Ga0193336_1001123433300019045MarineMHFNYVSKMSYNKDKDLVFVTKPDRFWGESEHIYEVHHLEEMVPAPVLAMKNMSSMREDGLMSVYCMATKESMKFYKDPKYWNTDLRPEFFAEIRSLWGDTHYDRN
Ga0192981_1001952553300019048MarineVRPAHTMYVAALAYLIYSMDMDYVTKMRYNKEKDLVFVQRVDRLWGETEHTFEMHHLEQTVPAAVTAMKNNPALAPDGILTIHDMADKNYLKFY
Ga0192981_1002169753300019048MarineMNAQYGAKRSVVRPSHTMYVATLMAMVWCLDFDYVTKMRYNKDKDLVFVTKPDRFWGETEHIYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDHKFWNNDLRPEFEGETRGLWETTHADKYTGRIF
Ga0192981_1012210723300019048MarineMYVATLMGLVHQMDFDYVTKMRYNKDKDLVFITKPDRLWGESEHCYEMHHLEQLVPAAVTAMKDMTALDPKGVLTVCDMAEKEYLKFYKDDKYWNQELREEFLGETRGLWETTHADKYTGRIFQTRGAPSKDTALAMDKV
Ga0192966_1018996313300019050MarineMALIYSMDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAITAMKNMSANDHDGILTVHDMADKEYLKLYKEEKYWNLELRDEFMAETRGLWDTTHADKYTGRIF
Ga0207193_120448313300020048Freshwater Lake SedimentMDLDYATKMRYNKDKDLVFVTKPDRFWGEKEHVYEMHHLEQMVPSAVTAMKDMSSLSPTGIMTVHDMSENENIKLYKDPKYWNMDVREEFFAETRTLWENTHADKYKGR
Ga0206125_1035870013300020165SeawaterVTKPDRFWGETEHVYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDHKYWNNDLRPEFEGETRGLWETTHADKYTGRIF
Ga0206691_185940513300021342SeawaterKDKDLVFVNKPDRFWGETEHVYEMHHLEQMVPAAVTAMKDMSANHEKGILTVHDMSVNENLKFYNEEKYWNTDLRPEFMNETRGLWETTHADKNTGRIFQSRGAPTQD
Ga0206692_181680713300021350SeawaterPSHTMYVVTLMTLIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGESEHVYEMHHLEQMVPAAVTAMKNMSAMDHDGILTVHDMGEKDYLKFYKEDKYWNLELKDEFTQETRGLWDTTH
Ga0063105_104398133300021887MarineMNAQYGAKRSVVRPSHTMYVATLMAMVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDQKYWNNDLRPEFEGETRGLWETTHADKYTGRIF
Ga0063102_101802633300021941MarineMNAQYGAKRSVVRPSHTMYVATLMAMVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDHKYWNNDLRPEFEGETRGLWETTHADKYTGRIF
Ga0222713_1071841123300021962Estuarine WaterAMALLYGMDFDYVTKMRYNKDKDLVFVTKPDKLWGEKEHVYEVHHLEQMVPAPVTAMKHMSAMRHDGIMTVKDMAQNENLKFYKEDKYWNADLKKEFMNETRGLWE
Ga0244775_1014968723300024346EstuarineMNIQYGAKRTVVRSSHTMYVATAMALLYGMDFDYVTKMRYNKDKDLVFVTKPDKLWGEKEHVYEVHHLEQMVPAPVTAMKHMSAMRHDGIMTVKDMAQNENLKFYKEDKYWNADLKKEFMNETRGLWE
Ga0209716_113349913300025626Pelagic MarineNVQYGAKRSVVRPSHTMYVATLMAMVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAVKDMSSKDENGIMTVHCMAQNEQMKFYKDQKFWNNDLRPEFENETRGLWETTHADKYTGRIF
Ga0209715_105202723300025699Pelagic MarineMNVQYGAKRSIVRPAHTMYVCSLMGLIYSMDFDYVTKMRYNKEKDLVFVTKPDRFWGESEHVYEMHHLEQMVPSAITAMKNMSANDHDGILTVHDMGDKDYLKFYKEDKYWNLELKDEFMGETRGLWDTTHADKYTGRIF
Ga0209602_119420023300025704Pelagic MarineVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAVKDMSSKDENGIMTVHCMAQNEQMKFYKDQKFWNNDLRPEFENETRGLWETTHADKYTGRIF
Ga0208544_1014713423300025887AqueousMTLQYGAKRTVVRSSHTMFVATVMALLYSLDFDYVTKMRYSKDKDLVFVTKPNRLWGEKETVYEVHHLEQMVPAPVTAMKNMSQNDPTGIMTVHCMAQNENLKLYKDDKYWNSDLKNEFYAETRSLWDTTHADKYTGRIFQSRGAMPTDFALAMNKIDKEMEAAVA
Ga0209631_1034084033300025890Pelagic MarineLEGVRYCDDHDYMNIQYGAKRSIVRPSHTMYVVTVMTLIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPAAVTAMKNMSAIDHDGILTVHDMGEKDYLKFYKEDKYWNLELKEEF
Ga0247559_112000913300026443SeawaterMEGIRYCDDHDYMNIQYGAKRSIVRPSHTMYIAAVASLIYSLDFDYVTKMRYNKDKDLVFVSRPNALFGENEAVYEMHHLEQMVPAPVTAIKNMASLDKNGILTVHDMAEKENLRFYQEDKYW
Ga0247594_100751723300026448SeawaterMNAQYGAKRSIVRPSHTMYVATLMAMVWCLDFDYVTKMRYNKDKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDHKYWNNDLRPEFEGETRGLWETTHADKYTGRIF
Ga0247594_107023413300026448SeawaterAKRSIVRPSHTMYVVTLMTLIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGESEHVYEMHHLEQMVPAAVTAMKNMSAMDHDGILTVHDMGEKDYLKFYKEDKYWNLELKDEFTQETRGLWDTTH
Ga0247594_110053613300026448SeawaterMYVATLMGLVHQMDFDYVTKMRYNKDKDLVFVTKPDRLWGESEHCYEMHHLEQLVPAAVTAMKDMTALDPKGVLTVCDMAEKEYLKFYEDDKYWNQELREEFLGETRGLWETTHADKRAGRIFSSRGAADM
Ga0247568_110622123300026462SeawaterYNKDKDLVFVSRPNALFGENEAVYEMHHLEQMVPAPVTAIKNMASLDKNGILTVHDMAEKENLRFYQEDKYWNMDLKEEFLAETRGLWETTHADKYEGRLFNSAGTAPLSF
Ga0247603_101463733300026468SeawaterMYVATLMAMVWCLDFDYVTKMRYNKDKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDHKYWNNDLRPEFEGETRGLWETTHADKYTGRIF
Ga0208437_107361713300027525EstuarineMNIQYGAKRTVVRSSHTMYVATAMALLYGMDFDYVTKMRYNKDKDLVFVTKPDKLWGEKEHVYEVHHLEQMVPAPVTAMKHMSAMRHDGIMTVKDMAQNENLKFYKEDKYWNADLKKEFMNETRGLWESTHSDKYTGRIFQ
Ga0209302_1017076023300027810MarineMEGIRYCDDHDYMNIQYGFKRSLVRPAHTMYVAALAYLIYNMDMDYVTKMRYNKEKDLVFVQRVDRLWGETEHTYEMHHLEQMVPAAVTAMKNSPALHPNGILTVHDMADKHYLKFYQDTKYWNSDLK
Ga0209092_1039670123300027833MarineWDLKGYRYCDDHDYMNAQYGAKRSVVRPSHTMYVATLMAMVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDHKYWNNDLRPEFEGETRGLWETTHADKYTGRIF
Ga0209092_1059957213300027833MarineKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDHKYWNNDLRPEFESETRGLWETTHADKYTGRIF
Ga0209668_1017382633300027899Freshwater Lake SedimentMDLDYATKMRYNKDKDLVFVTKPDRFWGEKEHVYEMHHLEQMVPSAVTAMKDMSSLSPTGIMTVHDMSENENIKLYKDPKYWNMDVREEFFAETRTLWENTHADKYKGRLF
Ga0247596_111168513300028106SeawaterMEGIRYCDDHDYMNIQYGAKRSIVRPSHTMYIAAVASLIYSLDFDYVTKMRYNKDKDLVFVSRPNALFGENEAVYEMHHLEQMVPAPVTAIKNMASLDKNGILTVHDMAEKENLRFYQEDKYWNMDLKEEFLAETRGLWETTHADKYEGRLFNSAGTAPLSF
Ga0256412_120424923300028137SeawaterMNLQYGAKRSIVRPAHTMYVCSLMALIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAMKNMSANDHDGILTVHDMAEKDYLKLYKEEKYWNLELRDEFMAETRGLWDTTHADKYTGRIF
Ga0256412_126440413300028137SeawaterMYVATLMAMVWSLDLDYVTKMRYNKDKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVGAIKDMASMGEDGIMTVHCMAQNEQMKFYKDHKYWNNELRPEFENETRGLWETTHANKYAGRIF
Ga0247572_118161713300028290SeawaterDYVTKMRYNKEKDLVFVTKPDRFWGESEHVYEMHHLEQMVPAAVTAMKNMSAMDHDGILTVHDMGEKDYLKFYKEDKYWNLELKDEFTQETRGLWDTTH
Ga0307401_1025780423300030670MarineVRPAHTMYVAALAYLIYSMDMDYVTKMRYNKEKDLVFVQRVDRLWGETEHTFEMHHLEQTVPAAVTAMKNNPALATDGILTIHDMADKNYLKFY
Ga0307403_1029301623300030671MarineMNAQYGAKRSVVRPSHTMYVATLMAMIWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDHKYWNNDLRPEFEGETRGLWETTHADKYTGRIF
Ga0307403_1078576513300030671MarineMNIQYGAKRSIIRPAHTMYVATLMGLVHQMDFDYVTKMRYNKDKDLVFITKPDRLWGESEHCYEMHHLEQLVPAAVTAMKDMTALDPKGVLTVCDMAEKEYLKFYKDDKYWNQELREEFLGETRGLWETTHADKYTGRIFQ
Ga0307400_1080093013300030709MarineMEGVRYCDDHDYMNIQYGFKRSIVRPAHTMYVACLAYMIYNLDMDYVTKMRYNKEKDLVFVQRQDRLWGETEHTYEMHHLEQMVPAAVTAMKNMPSLDPNGILTIHDMADKHYLKFYQDPKYWNSDLKDEFLGETRSLWDSTHADK
Ga0307489_1018259813300031569Sackhole BrineMYVASLMALIYSMDFDYVTKMRYNKDKDLVFVTKPDRFWGESEHVYEMHHLEQLVPAPVTATKDMTALDENGILTVSDMAEKEYLKFYKEEKYWNLDLKDEFMNETRGLWETTHADKYTGRIFQARGAMSKDF
Ga0308134_109454713300031579MarinePRQFQDGSGWGLEGVRYCDDHDYMNVQYGAKRSIVRPSHTMYVVTIMTLIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGESEHVYEMHHLEQMVPAAVTAMKNMSAMDHDGILTVHDMGEKDYLKFYKEDKYWNLELKDEFTQETRGLWDTTH
Ga0302125_1016726213300031638MarineMSENWNWGEIPRQFQDGSGWDLKGYRYCDDHDYMNAQYGAKRSIVRPSHTMYVATLMAMVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAITAVKDMSAKDENGILTVHCMAQNEQMKFYKDHKYWNNDLRPEFESETRGLWETTHADKYTGR
Ga0302125_1021960113300031638MarineELVFVNKPDKLWGETEHVYEMHHLEQMVPFPVTSMKHMSANSPTGIMTVCDMAEKEYLKFYKDNKYWNMDLRDEFVSETRSLWEGTHSDKRTGRIF
Ga0307396_1019516923300031717MarineMNIQYGAKRSIVRPAHTMYVCSLMALIYSMDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAITAMKNMSANDHDGILTVHDMADKEYLKLYKEEKYWNLELRDEFMAETRGLWDTTHADKYTGRIF
Ga0307381_1024091013300031725MarineGWDLKGYRYCDDHDYMNAQYGAKRSIVRPSHTMYVATLMAMVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDHKYWNNDLRPEFEGETRGLWETTHADKYTGRIF
Ga0307391_1068243523300031729MarineMNIQYGAKRSIVRPAHTMYVCSLMALIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAITAMKNMSANDHDGILTVHDMADKEYLKLYKEEKYWNLELRDEFMAETRGLWDTTHADKYTGRIF
Ga0307394_1006677733300031735MarineMNAQYGAKRSVVRPSHTMYVATLMAMVWCLDFDYVTKMRYNKDKDLVFVTKPDRFWGETEHIYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDHKYWNNDLRPEFEGETRGLWETTHADKYTGRIF
Ga0307384_1002568823300031738MarineMYVATLMGLIHQMDFDYVTKMRYNKDKDLVFVTKPDRLWGESTTVYEMHHLEQLVPAPVTAMKNMSAMDPKGIMTVCDMAEKDYLKLYNEDKYWNAELRDEFMQETRGLWETTHANKYHGRIFNSGGSED
Ga0307395_1036026913300031742MarineMNAQYGAKRSVVRPSHTMYVATLMAMIWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDHKFWNNDLRPEFEGETRGLWETTHADKYTGRIF
Ga0307404_1046714213300031752MarineWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAIKDMASKDENGIMTVHCMAQNEQMKFYKDHKFWNNDLRPEFEGETRGLWETTHADKYTGRIF
Ga0315899_1124773723300031784FreshwaterFVYGMDLDYATKMRYNKDKDLVFVTKPDRFWGEKEHVFEMHHLEQMVPSPVTAMKDMSSLSPTGIMTVHDMAENENIKLYKDPKYWNMELREEFFAETRTLWENTHADKYQGRLF
Ga0315906_1044437013300032050FreshwaterMDLDYATKMRYNKDKDLVFVTKPDRFWGEKEHVFEMHHLEQMVPSPVTAMKDMSSLSPTGIMTVHDMAENENIKLYKDPKYWNMELREEFFAETRTLWE
Ga0314684_1056576513300032463SeawaterVRYCDDHDYMNVQYGAKRSIVRPSHTMYVVTIMTLIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGESEHVYEMHHLEQMVPAAVTAMKNMSAMDHDGILTVHDMGEKDYLKFYKEDKYWNLELKDEFTQETRGLWDTTH
Ga0314688_1016710333300032517SeawaterMNVQYGAKRSVVRPSHTMYVATLMAMVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAVKDMSSKDENGIMTVHCMAQNEQMKFYKDQKFWNNDLRPEFENETRGLWETTHADKYTGRIF
Ga0314667_1074906823300032520SeawaterFDYVTKMRYNKEKDLVFVTKPDRFWGESEHVYEMHHLEQMVPAAVTAMKNMSAMDHDGILTVHDMGEKDYLKFYKEDKYWNLELKDEFTQETRGLWDTTH
Ga0314671_1003927253300032616SeawaterMEHLRLQIFDDHDYMNVQYGAKRSVVRPSHTMYVATLMAMVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAVKDMSSKDENGIMTVHCMAQNEQMKFYKDQKFWNNDLRPEFENETRGLWETTHADKYTGRIF
Ga0314678_1040087013300032666SeawaterDDHDYMNVQYGAKRSIVRPSHTMYVVTIMTLIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGESEHVYEMHHLEQMVPAAVTAMKNMSAMDHDGILTVHDMGEKDYLKFYKEDKYWNLELKDEFTQETRGLWDTTH
Ga0314669_1065876413300032708SeawaterRYCDDHDYMNVQYGAKRSVVRPSHTMYVATLMAMVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAVKDMSSKDENGIMTVHCMAQNEQMKFYKDQKFWNNDLRPEFENETRGLWETTHADKYTGRIF
Ga0314703_1035412623300032723SeawaterCDDHDYMNVQYGAKRSIVRPSHTMYVVTIMTLIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGESEHVYEMHHLEQMVPAAVTAMKNMSAMDHDGIMTVHDMGEKDYLKFYKEDKYWNLELKDEFTQETRGLWDTTH
Ga0314695_135552613300032724SeawaterMNVQYGAKRSVVRPSHTMYVATLMAMVWCLDFDYVTKMRYNKEKDLVFVTKPDRFWGETEHVYEMHHLEQMVPSAVTAVKDMSSKDENGIMTVHCMAQNEQMKFYKDQKFWNNDLRPEFENETRGLWETTHADK
Ga0314711_1047614213300032732SeawaterWGLEGVRYCDDHDYMNVQYGAKRSIVRPSHTMYVVTIMTLIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGESEHVYEMHHLEQMVPAAVTAMKNMSAMDHDGILTVHDMGEKDYLKFYKEDKYWNLELKDEFTQETRGLWDTTH
Ga0314710_1033681423300032742SeawaterVRYCDDHDYMNIQYGAKRSIVRPSHTMYVVTIMTLIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGESEHVYEMHHLEQMVPAAVTAMKNMSAMDHDGIMTVHDMGEKDYLKFYKEDKYWNLELKDEFT
Ga0314701_1045142023300032746SeawaterSLVRPAHTMYVACLAYFIYNLDMDYVTKMRYNKEKDLVFVQRQDRLWGETEHTYEMHHLEQMVPAAITAMKNMPALDPNGILTIHDMADKHYMKFYQDPKYWNAELKEEFLSETRSLWDTTHADKYEGRIFSSGGIASKEQ
Ga0314712_1043410813300032747SeawaterVRYCDDHDYMNIQYGAKRSIVRPSHTMYVVTIMTLIYNMDFDYVTKMRYNKEKDLVFVTKPDRFWGESEHVYEMHHLEQMVPAAVTAMKNMSAMDHDGILTVHDMGEKDYLKFYKEDKYWNLELKDEFTQETRGLWDTTH
Ga0335019_0623098_292_6273300034066FreshwaterMDLDYATKMRYNKDKDLVFVTKPDRFWGEKEHVFEMHHLEQMVPSPVTAMKDMSSLSPTGIMTVHDMAENENIKLYKDPKYWNMELREEFFAETRTLWENTHSDKYQGRLF
Ga0334997_0955725_189_5003300034280FreshwaterMRYNKDKDLVFVTKPDRFWGEKEHVFEMHHLEQMVPSPVTAMKDMSSLSPTGIMTVHDMAENENIKLYKDPKYWNMELREEFFAETRTLWENTHSDKYQGRLF
Ga0335039_0223522_292_6273300034355FreshwaterMDLDYATKMRYNKDKDLVFVTKPDRFWGEKEHVFEMHHLEQMVPSPVTAMKDMSSLSPTGIMTVHDMAENENIKLYKDPKYWNMELREEFFAETRTLWENTHADKYQGRLF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.