| Basic Information | |
|---|---|
| Family ID | F092092 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MSKLEDKVNEILGIDKPEPKKEIVKQEFKPAVPRRDD |
| Number of Associated Samples | 77 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.70 % |
| % of genes near scaffold ends (potentially truncated) | 98.13 % |
| % of genes from short scaffolds (< 2000 bps) | 81.31 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (43.925 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (18.692 % of family members) |
| Environment Ontology (ENVO) | Unclassified (58.879 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (89.720 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.85% β-sheet: 0.00% Coil/Unstructured: 86.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13640 | 2OG-FeII_Oxy_3 | 14.95 |
| PF13759 | 2OG-FeII_Oxy_5 | 14.02 |
| PF04820 | Trp_halogenase | 6.54 |
| PF16724 | T4-gp15_tss | 4.67 |
| PF16778 | Phage_tail_APC | 0.93 |
| PF01833 | TIG | 0.93 |
| PF00622 | SPRY | 0.93 |
| PF13385 | Laminin_G_3 | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.07 % |
| Unclassified | root | N/A | 43.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2222084006|2223608537 | Not Available | 533 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10090735 | Not Available | 1030 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10049211 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
| 3300000949|BBAY94_10197811 | Not Available | 541 | Open in IMG/M |
| 3300006027|Ga0075462_10201258 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 599 | Open in IMG/M |
| 3300006405|Ga0075510_10116269 | Not Available | 692 | Open in IMG/M |
| 3300006735|Ga0098038_1106876 | Not Available | 961 | Open in IMG/M |
| 3300006802|Ga0070749_10006543 | All Organisms → Viruses | 7647 | Open in IMG/M |
| 3300006802|Ga0070749_10083571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1905 | Open in IMG/M |
| 3300006802|Ga0070749_10446233 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 709 | Open in IMG/M |
| 3300006802|Ga0070749_10598153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 595 | Open in IMG/M |
| 3300006810|Ga0070754_10006394 | All Organisms → Viruses | 7820 | Open in IMG/M |
| 3300006810|Ga0070754_10149258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1118 | Open in IMG/M |
| 3300006810|Ga0070754_10306484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 711 | Open in IMG/M |
| 3300006916|Ga0070750_10088112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1449 | Open in IMG/M |
| 3300007345|Ga0070752_1301161 | Not Available | 611 | Open in IMG/M |
| 3300007539|Ga0099849_1056323 | All Organisms → Viruses → Predicted Viral | 1626 | Open in IMG/M |
| 3300007539|Ga0099849_1202149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15 | 747 | Open in IMG/M |
| 3300007539|Ga0099849_1288676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300007960|Ga0099850_1006694 | Not Available | 5340 | Open in IMG/M |
| 3300007960|Ga0099850_1073053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1437 | Open in IMG/M |
| 3300009000|Ga0102960_1029783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2033 | Open in IMG/M |
| 3300009000|Ga0102960_1070518 | Not Available | 1281 | Open in IMG/M |
| 3300009000|Ga0102960_1313042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 554 | Open in IMG/M |
| 3300009001|Ga0102963_1253047 | Not Available | 697 | Open in IMG/M |
| 3300009001|Ga0102963_1374156 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300009507|Ga0115572_10498861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Maricaulaceae → Maricaulis → unclassified Maricaulis → Maricaulis sp. | 675 | Open in IMG/M |
| 3300010153|Ga0098059_1364985 | Not Available | 547 | Open in IMG/M |
| 3300010318|Ga0136656_1053259 | Not Available | 1454 | Open in IMG/M |
| 3300010318|Ga0136656_1283434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium TMED131 | 541 | Open in IMG/M |
| 3300012920|Ga0160423_10138745 | All Organisms → Viruses → Predicted Viral | 1709 | Open in IMG/M |
| 3300012953|Ga0163179_10283930 | All Organisms → Viruses → Predicted Viral | 1303 | Open in IMG/M |
| 3300012954|Ga0163111_10682736 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300017710|Ga0181403_1109340 | Not Available | 578 | Open in IMG/M |
| 3300017713|Ga0181391_1018903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P → Pelagibacter phage HTVC011P | 1725 | Open in IMG/M |
| 3300017713|Ga0181391_1019480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P → Pelagibacter phage HTVC011P | 1696 | Open in IMG/M |
| 3300017713|Ga0181391_1032696 | All Organisms → cellular organisms → Bacteria | 1264 | Open in IMG/M |
| 3300017713|Ga0181391_1054542 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
| 3300017714|Ga0181412_1160465 | Not Available | 502 | Open in IMG/M |
| 3300017721|Ga0181373_1093820 | Not Available | 531 | Open in IMG/M |
| 3300017724|Ga0181388_1067210 | Not Available | 857 | Open in IMG/M |
| 3300017730|Ga0181417_1167733 | Not Available | 529 | Open in IMG/M |
| 3300017731|Ga0181416_1061984 | Not Available | 883 | Open in IMG/M |
| 3300017741|Ga0181421_1165890 | Not Available | 570 | Open in IMG/M |
| 3300017742|Ga0181399_1122350 | Not Available | 636 | Open in IMG/M |
| 3300017750|Ga0181405_1006073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 3572 | Open in IMG/M |
| 3300017752|Ga0181400_1116719 | Not Available | 773 | Open in IMG/M |
| 3300017760|Ga0181408_1165918 | Not Available | 566 | Open in IMG/M |
| 3300017765|Ga0181413_1255261 | Not Available | 516 | Open in IMG/M |
| 3300017768|Ga0187220_1006234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3622 | Open in IMG/M |
| 3300017771|Ga0181425_1008639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 3451 | Open in IMG/M |
| 3300017773|Ga0181386_1059401 | Not Available | 1221 | Open in IMG/M |
| 3300017773|Ga0181386_1093538 | Not Available | 941 | Open in IMG/M |
| 3300017786|Ga0181424_10030471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 2342 | Open in IMG/M |
| 3300017824|Ga0181552_10517125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 561 | Open in IMG/M |
| 3300017950|Ga0181607_10615498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → Pelagibacter virus HTVC019P → Pelagibacter phage HTVC019P | 570 | Open in IMG/M |
| 3300017967|Ga0181590_10056309 | Not Available | 3131 | Open in IMG/M |
| 3300017967|Ga0181590_10179630 | Not Available | 1602 | Open in IMG/M |
| 3300017967|Ga0181590_10354462 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
| 3300018048|Ga0181606_10050655 | Not Available | 2823 | Open in IMG/M |
| 3300018421|Ga0181592_10024673 | All Organisms → cellular organisms → Bacteria | 4880 | Open in IMG/M |
| 3300018421|Ga0181592_10417450 | Not Available | 944 | Open in IMG/M |
| 3300018421|Ga0181592_10989646 | Not Available | 543 | Open in IMG/M |
| 3300018424|Ga0181591_10193261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1606 | Open in IMG/M |
| 3300020051|Ga0181555_1126663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1078 | Open in IMG/M |
| 3300020053|Ga0181595_10041681 | Not Available | 2616 | Open in IMG/M |
| 3300020055|Ga0181575_10552127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300020175|Ga0206124_10105868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 1162 | Open in IMG/M |
| 3300020177|Ga0181596_10323078 | Not Available | 612 | Open in IMG/M |
| 3300020414|Ga0211523_10214777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 796 | Open in IMG/M |
| 3300020421|Ga0211653_10261835 | Not Available | 753 | Open in IMG/M |
| 3300020439|Ga0211558_10138435 | Not Available | 1177 | Open in IMG/M |
| 3300020441|Ga0211695_10386696 | Not Available | 528 | Open in IMG/M |
| 3300020595|Ga0206126_10211634 | Not Available | 899 | Open in IMG/M |
| 3300021356|Ga0213858_10147113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1150 | Open in IMG/M |
| 3300021364|Ga0213859_10184830 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300021425|Ga0213866_10578150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300021957|Ga0222717_10274905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 970 | Open in IMG/M |
| 3300021957|Ga0222717_10277997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 963 | Open in IMG/M |
| 3300021958|Ga0222718_10027043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 3890 | Open in IMG/M |
| 3300021958|Ga0222718_10036805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P → Pelagibacter phage HTVC011P | 3219 | Open in IMG/M |
| 3300021958|Ga0222718_10211244 | Not Available | 1053 | Open in IMG/M |
| 3300021958|Ga0222718_10293930 | Not Available | 846 | Open in IMG/M |
| 3300021958|Ga0222718_10375006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 717 | Open in IMG/M |
| 3300021958|Ga0222718_10389617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 699 | Open in IMG/M |
| 3300021958|Ga0222718_10591143 | Not Available | 522 | Open in IMG/M |
| 3300021960|Ga0222715_10042623 | All Organisms → Viruses → Predicted Viral | 3183 | Open in IMG/M |
| 3300021961|Ga0222714_10263643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 960 | Open in IMG/M |
| 3300021964|Ga0222719_10050781 | Not Available | 3160 | Open in IMG/M |
| 3300021964|Ga0222719_10202938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1354 | Open in IMG/M |
| 3300021964|Ga0222719_10227237 | Not Available | 1256 | Open in IMG/M |
| 3300021964|Ga0222719_10250273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1178 | Open in IMG/M |
| 3300022842|Ga0222632_1006728 | All Organisms → Viruses | 2497 | Open in IMG/M |
| 3300022843|Ga0222631_1023597 | Not Available | 900 | Open in IMG/M |
| 3300023176|Ga0255772_10118498 | Not Available | 1632 | Open in IMG/M |
| 3300025137|Ga0209336_10015213 | Not Available | 2885 | Open in IMG/M |
| 3300025138|Ga0209634_1120060 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED97 | 1123 | Open in IMG/M |
| 3300025646|Ga0208161_1049173 | All Organisms → Viruses → Predicted Viral | 1360 | Open in IMG/M |
| 3300025674|Ga0208162_1006753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 5158 | Open in IMG/M |
| 3300025680|Ga0209306_1138635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 697 | Open in IMG/M |
| 3300025769|Ga0208767_1039553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2318 | Open in IMG/M |
| 3300025771|Ga0208427_1185134 | Not Available | 669 | Open in IMG/M |
| 3300025822|Ga0209714_1124658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 684 | Open in IMG/M |
| 3300025892|Ga0209630_10263490 | Not Available | 802 | Open in IMG/M |
| 3300026138|Ga0209951_1048170 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 917 | Open in IMG/M |
| 3300031647|Ga0308012_10173226 | Not Available | 849 | Open in IMG/M |
| 3300032073|Ga0315315_10890082 | Not Available | 805 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 18.69% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 18.69% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 14.02% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 14.02% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 5.61% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 4.67% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.74% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.80% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.80% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.87% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.87% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.87% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.87% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.87% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.93% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Marine | 0.93% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.93% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.93% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.93% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2222084006 | Marine microbial communities from Deepwater Horizon oil blowout, Alabama, USA - oil_dispersant_7 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006405 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017721 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaG | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020051 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020177 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020441 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022842 | Saline water microbial communities from Ace Lake, Antarctica - #46 | Environmental | Open in IMG/M |
| 3300022843 | Saline water microbial communities from Ace Lake, Antarctica - #5 | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300031647 | Marine microbial communities from water near the shore, Antarctic Ocean - #179 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2224062671 | 2222084006 | Marine | MSKLEDKVNEILGIDKPEPKKKLSNKSSNLQVPRRDDDSKAECR |
| DelMOSum2011_100907351 | 3300000115 | Marine | MSKLEEKVNEILGIDKPEPSKQVVKQEVKPPVPRMEDAKKADVD |
| DelMOSpr2010_100492114 | 3300000116 | Marine | MSKLEEKVNEILGIDKPEPSKQVVKQEVKPPVPRMEDAKKA |
| BBAY94_101978111 | 3300000949 | Macroalgal Surface | MSKLEDKVNEILGIDKPEPKKEIVKQEFKPAVPRK |
| Ga0075462_102012582 | 3300006027 | Aqueous | MSKLEDKVNEILGIDKSEPKKEIVKQEFKPAVPRKDD |
| Ga0075510_101162693 | 3300006405 | Aqueous | MSKLEDKVNEILGINEPEPKKEVVKQDFKPAVPRRED |
| Ga0098038_11068761 | 3300006735 | Marine | MSKLEEKVNEILGIDKPEPSKQVVKQEIKPPVPRVEDAKKPDVD |
| Ga0070749_1000654311 | 3300006802 | Aqueous | MSKLEDKVNEILGINEPEPKKEIVKQDFKPVVPRREDNEKADV |
| Ga0070749_100835713 | 3300006802 | Aqueous | MSKLEDKVNEILGIDKPEPKKEIVKQEFKPAVPRRDD |
| Ga0070749_104462332 | 3300006802 | Aqueous | MTKLEDKVNEILGIDKPEPKKEIVKQDFKPVVPRREDND |
| Ga0070749_105981532 | 3300006802 | Aqueous | MSKLEDKVNEILGIDKPEPKKEIVKQEFKPAVPRRDDDSK |
| Ga0070754_1000639411 | 3300006810 | Aqueous | MSKLEDKVNEILGINEPEPKKEIVKQDFKPVVPRREDNEKADVDND* |
| Ga0070754_101492582 | 3300006810 | Aqueous | MSKLEDKVNEILGIDKPEPKKEIVKQEFKPAVPRRDDDSKADVD |
| Ga0070754_103064841 | 3300006810 | Aqueous | MSKLEDKVNEILGIDKPEPKKEIVKQEFKPAVPRRD |
| Ga0070750_100881124 | 3300006916 | Aqueous | MSKLEDKVNEILGIDKPEPKKEIVKQEFKPAVPRKDD |
| Ga0070752_13011612 | 3300007345 | Aqueous | MTKLEDKVNEILGIDKPEPKKEIVKQDFKPAVPRR |
| Ga0099849_10563233 | 3300007539 | Aqueous | MTKLEDKVNEILGIDKPEPKKEIVKQDFKPVVPRREDNDKADV |
| Ga0099849_12021491 | 3300007539 | Aqueous | MSKLEDKVNEILGIDKPETKELVKQDFKPVVPRKENKESPDVD |
| Ga0099849_12886762 | 3300007539 | Aqueous | MSKLEEKVNEILGIDKPEPSKEIVKQDFKPAVPRKEDE |
| Ga0099850_10066941 | 3300007960 | Aqueous | MSKLEDKVNEILGIDKPETKELVKQDFKPVVPRKENKESP |
| Ga0099850_10730533 | 3300007960 | Aqueous | MTKLEDKVNEILGIDKPEPKKEIVKQEFKPAVPRRDDDSKADVDN |
| Ga0102960_10297834 | 3300009000 | Pond Water | MSKLEDKVNEILGINEPEPKKEVVKQEFKPAVPRREDDNKADVD |
| Ga0102960_10705182 | 3300009000 | Pond Water | MTKLEDKVNEILGINEPETKKEVVKQDFKPAVPRKEETD |
| Ga0102960_13130423 | 3300009000 | Pond Water | MSKLEDKVNEILGINEPEPKKEVVKQDFKPAVPRR |
| Ga0102963_12530472 | 3300009001 | Pond Water | MTKLEDKVNEILGINEPETKKEVVKQDFKPAVPRKED |
| Ga0102963_13741561 | 3300009001 | Pond Water | MSKLEDKVNEILGIDKPEPKKEIVKQEFKPAVPRRDDDSKADV |
| Ga0115572_104988612 | 3300009507 | Pelagic Marine | MSKLEKKVNEILGIDKPEPKKEIVKQEFKPVVPRKEETGKADVD |
| Ga0098059_13649852 | 3300010153 | Marine | MSKLEEKVNEILGIDKPEPSKQVVKQEVKPPVPRME |
| Ga0136656_10532591 | 3300010318 | Freshwater To Marine Saline Gradient | MSKLEDKVNEILGIDKPEPKKEIVKQEFKPAVPRR |
| Ga0136656_12834343 | 3300010318 | Freshwater To Marine Saline Gradient | MSKLEDKVNEILGIDKPEPKKEIVKQDFKPIVPRREDNDKADVDND |
| Ga0160423_101387451 | 3300012920 | Surface Seawater | MSKLEEKVNEILGIDKPEPTKEIVKQEFKPAVPRKEDDKKAD |
| Ga0163179_102839303 | 3300012953 | Seawater | LININMTKLEDKVNEILGIDKPEPTKAVVKQEFKPVVPRK |
| Ga0163111_106827361 | 3300012954 | Surface Seawater | MSKLEDKVNEILGINEKKPSKAVVKQEFKPAVPRREDNNKAD |
| Ga0181403_11093401 | 3300017710 | Seawater | MSKLEDKVNEILGIDTPEPSKQVVKQEIKPPVPRVEDAKKPDVDN |
| Ga0181391_10189033 | 3300017713 | Seawater | MSKLEDKVNEILGIDTPEPSKQVVKQEIKPPVPRVE |
| Ga0181391_10194803 | 3300017713 | Seawater | MSKLEEKVNEILGIDKPEPSKQVVKQEIKPPVPRVEDAK |
| Ga0181391_10326963 | 3300017713 | Seawater | MSKLEEKVNEILGIDKPEPSKQVVKQEVKPPVPRM |
| Ga0181391_10545423 | 3300017713 | Seawater | MSKLEEKVNEILGIDKPEPSKQVVKQETKPPVPRMEDAKKADV |
| Ga0181412_11604651 | 3300017714 | Seawater | MSKLEEKVNEILGIDKPEPSKEIVKQEFKPAVPRKED |
| Ga0181373_10938202 | 3300017721 | Marine | MSKLEEKVNEILGIDKPEPSKQVVKQEIKPPVPRMEDA |
| Ga0181388_10672102 | 3300017724 | Seawater | MSKLEEKVNEILGIDKPEPSKQVVKQEVKPPVPRMEDAK |
| Ga0181417_11677332 | 3300017730 | Seawater | MTKLEDKVNEILGIDKPEPSKQVVKQEIKPPVPRVEDAK |
| Ga0181416_10619841 | 3300017731 | Seawater | MSKLEEKVNEILGIDKPEPSKQVVKQEVKPPVPRMEDAKKADVDND |
| Ga0181421_11658902 | 3300017741 | Seawater | MSKLEDKVNEILGIDKKEPSKEIIKQEFKPAVPRREDD |
| Ga0181399_11223502 | 3300017742 | Seawater | MSKLEEKVNEILGIDKPEPSKQVVKQEVKPPVPRMEDAKK |
| Ga0181405_10060734 | 3300017750 | Seawater | MSKLEEKVNEILGIDKPEPSKQVVKQEIKPPVPRVE |
| Ga0181400_11167191 | 3300017752 | Seawater | MTKLEEKVNEILGIDTPEPSKQVVKQDIKPPVPRMEDAK |
| Ga0181408_11659181 | 3300017760 | Seawater | MALEDKVNEILGIDTPEKKEEKEFKPPVARVEEKAKDDVDNDHKNSREY |
| Ga0181413_12552612 | 3300017765 | Seawater | MSKLEEKVNEILGIDKPEPTKEIVKQEFKPAVPRKEDDKKA |
| Ga0187220_10062346 | 3300017768 | Seawater | MSKLEEKVNEILGIDKPEPSKQVVKQETKPPVPRMEDAK |
| Ga0181425_10086391 | 3300017771 | Seawater | MTKLEDKVNEILGIDTPEPTKQIVKQEIKPPVPRMEDAKKAD |
| Ga0181386_10594011 | 3300017773 | Seawater | SKLEEKVNEILGIDKPEPSKEIVKQEFKPAVPRKEDDKKAEVGND |
| Ga0181386_10935383 | 3300017773 | Seawater | MSKLEEKVNEILGIDKPEPSKEIVKQEFKPAVPRKEDDKKA |
| Ga0181424_100304713 | 3300017786 | Seawater | MSKLEEKVNEILGIDKPEPSKQVVKQEIKPPVPRVEDAKK |
| Ga0181552_105171252 | 3300017824 | Salt Marsh | MSKLEEKVNEILGIDKPEPTKEIVKQEFKPAVPRKDD |
| Ga0181607_106154983 | 3300017950 | Salt Marsh | MTKLEDKVNEILGIDKPEPKKEIVKQDFKPVVPRREDN |
| Ga0181590_100563091 | 3300017967 | Salt Marsh | MSKLEDKVNEILGIDKPEPKKEIVKQEFKPAVPRRDDDSKA |
| Ga0181590_101796301 | 3300017967 | Salt Marsh | MTKLEDKVNEILGIDKPEPKKEIVKQDFKPVVPRRED |
| Ga0181590_103544621 | 3300017967 | Salt Marsh | MTKLEDKVNEILGIDKPEPKKEIVKQDFKPVVPRREDNDKA |
| Ga0181606_100506551 | 3300018048 | Salt Marsh | MSKLEDKVNEILGIDKPEPKKEIVKQEFKPAVPRKDDDSK |
| Ga0181592_100246738 | 3300018421 | Salt Marsh | MTKLEDKVNEILGIDKPEPKKEIVKQDFKPAVPRKEDKES |
| Ga0181592_104174501 | 3300018421 | Salt Marsh | MTRLEDKVNEILGIDKPEPKKEIVKQDFKPVVPRRED |
| Ga0181592_109896462 | 3300018421 | Salt Marsh | MTKLEDKVNEILGIDKPEPKKEIVKQDFKPVVPRREDNEKADVD |
| Ga0181591_101932614 | 3300018424 | Salt Marsh | MSKLEDKVNEILGIDKPEPKKEIVKQDFKPVVPRRE |
| Ga0181555_11266633 | 3300020051 | Salt Marsh | MSKLEDKVNEILGIDKPEPKKEIVKQEFKPAVPRRDDDSKAD |
| Ga0181595_100416811 | 3300020053 | Salt Marsh | MTKLEDKVNEILGIDKPEPKKEIVKQDFKPVVPRREDNDKADVD |
| Ga0181575_105521271 | 3300020055 | Salt Marsh | MSKLEEKVNEILGIDKPEPKKEIVKQEFKPAVPRREDEKKED |
| Ga0206124_101058681 | 3300020175 | Seawater | MSKLEDKVNEILGIDTPEPTKELVKAKEIKPPVPRMEDAKKADF |
| Ga0181596_103230781 | 3300020177 | Salt Marsh | MSKLEDKVNEILGIDKPEPKKEIVKQEFKPAVPRRDDDS |
| Ga0211523_102147771 | 3300020414 | Marine | MSKLEKQVNEILGIDSKEPSKEIVKQEFKPAVPRKEDD |
| Ga0211653_102618351 | 3300020421 | Marine | MSKLEDKVNEILGIDKPEPSKQVVKQEIKPPVPRVEDAKKPDVD |
| Ga0211558_101384351 | 3300020439 | Marine | MSKLEDKVNEILGIDKQEPSKQIVKQEFKPAVPRREDDKKADV |
| Ga0211695_103866961 | 3300020441 | Marine | MSKLEEKVNEILGIDKKEPSKEIVKQEFKPAVPRRE |
| Ga0206126_102116341 | 3300020595 | Seawater | MSKLEDKVNEILGIDTPEPTKEIVKQEFKPAVPRTEDKEAPNVDNDY |
| Ga0213858_101471133 | 3300021356 | Seawater | MSKLEKQVNEILGIEPKEPSKEIVKQEFKPAVPRREDNKKAD |
| Ga0213859_101848301 | 3300021364 | Seawater | MSKLEDKVNEILGINEPEPKKEIVKQDFKPVVPRREDNEK |
| Ga0213866_105781501 | 3300021425 | Seawater | MSKLEDKVNEILGIDKPEPKKEIVKQEFKPAVPRKDDDSKA |
| Ga0222717_102749053 | 3300021957 | Estuarine Water | MSKLEDKVNEILGINEPEPKKEVVKQEFKPAVPRRDDDS |
| Ga0222717_102779971 | 3300021957 | Estuarine Water | MSKLEEKVNEILGIDKPEPSKQVVKQDIKPPVPRMEDAKKA |
| Ga0222718_100270431 | 3300021958 | Estuarine Water | MTKLEDKVNEILGINEPEPKKEVVKQDFKPAVPRREDNDK |
| Ga0222718_100368054 | 3300021958 | Estuarine Water | MTKLEDKVNEILGIDKPEPKKEIVKQDFKPVVPRREDNDK |
| Ga0222718_102112442 | 3300021958 | Estuarine Water | MTKLEDKVNEILGIDKPEPKKEIVKQEFKPAVPRKEDNNKADVDN |
| Ga0222718_102939303 | 3300021958 | Estuarine Water | MSKLEDKVNEILGINEPEPKKEVVKQEFKPAVPRREDDNKADVDN |
| Ga0222718_103750061 | 3300021958 | Estuarine Water | MSKLEDKVNEILGINEPEPKKEVVKQEFKPAVPRREDDNKAD |
| Ga0222718_103896171 | 3300021958 | Estuarine Water | MTKLEDKVNEILGINEPEPKKEIVKQEFKPAVPRREDDN |
| Ga0222718_105911431 | 3300021958 | Estuarine Water | MTKLEDKVNEILGIDKPEPTKEVVKQDFKPAVPRKEDNDKADVDN |
| Ga0222715_100426233 | 3300021960 | Estuarine Water | MTKLEDKVNEILGIDKPEPKKEIVKQDFKPVVPRREDNEKADVDN |
| Ga0222714_102636431 | 3300021961 | Estuarine Water | MSKLEDKVNEILGINEPEPKKEIVKQEFKPAVPRRDDDSKA |
| Ga0222719_100507813 | 3300021964 | Estuarine Water | MTKLEDKVNEILGINEPETKKEVVKQDFKPAVPRKEDNNK |
| Ga0222719_102029383 | 3300021964 | Estuarine Water | MSKLEDKVNEILGINEPEPKKEVVKQDFKPTVPRRE |
| Ga0222719_102272371 | 3300021964 | Estuarine Water | MSKLEDKVNEILGINEPEPKKEVVKQEFKPAVPRREDDNKA |
| Ga0222719_102502731 | 3300021964 | Estuarine Water | MTKLEDKVNEILGIDKPEPKKEIVKQDFKPVVPRREDNEKA |
| Ga0222632_10067281 | 3300022842 | Saline Water | MSKLEDKVNEILGIDTPEPTKEIVKAKEIKPPVPRMED |
| Ga0222631_10235971 | 3300022843 | Saline Water | MSKLEEKVNEILGIDTPEPTKEIVKAKEIKPPVPRMEDAKKPDVDN |
| Ga0255772_101184982 | 3300023176 | Salt Marsh | MTKLEDKVNEILGIDKPEPKKEIVKQDFKPVVPRRE |
| Ga0209336_100152131 | 3300025137 | Marine | MSKLEEKVNEILGIDKPEPSKQVVKQEVKPPVPRMEDAKKADV |
| Ga0209634_11200601 | 3300025138 | Marine | MSKLEEKVNEILGIDKPEPSKQVVKQEVKPPVPRMEDA |
| Ga0208161_10491733 | 3300025646 | Aqueous | MTKLEDKVNEILGINKPESKKEIVKQDFKPIVPRKE |
| Ga0208162_10067536 | 3300025674 | Aqueous | MSKLEDKVNEILGIDKPEPKKEIVKQEFKPAVPRRDDD |
| Ga0209306_11386352 | 3300025680 | Pelagic Marine | MSKLEDKVNEILGIDTPEPTKEIVKAKEIKPPVPR |
| Ga0208767_10395531 | 3300025769 | Aqueous | MTKLEDKVNEILGIDKPEPKKEIVKQDFKPVVPRKEDNDKADVDND |
| Ga0208427_11851341 | 3300025771 | Aqueous | MTKLEDKVNEILGIDKPEPKKEIVKQDFKPAVPRREDNDKADV |
| Ga0209714_11246581 | 3300025822 | Pelagic Marine | MSKLEDKVNEILGIDTPEPTKEIVKAKEFKPMVPRAEDDKK |
| Ga0209630_102634901 | 3300025892 | Pelagic Marine | MSKLEEKVNEILGIDKPEPTKEIVKQEFKPAVPRK |
| Ga0209951_10481701 | 3300026138 | Pond Water | MSKLEDKVNEILGINEPEPKKEIVKQEFKPAVPRKDDD |
| Ga0308012_101732261 | 3300031647 | Marine | MTKLEDKVNEILGINTPEPTKELVKKEDVKPPVPRTEDKT |
| Ga0315315_108900822 | 3300032073 | Seawater | MSKLEEKVNEILGIDKPEPSKEIVKQEFKPAGPRKE |
| ⦗Top⦘ |