NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092058

Metagenome / Metatranscriptome Family F092058

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092058
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 110 residues
Representative Sequence MTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEDHLKN
Number of Associated Samples 93
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.61 %
% of genes near scaffold ends (potentially truncated) 39.25 %
% of genes from short scaffolds (< 2000 bps) 68.22 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.832 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(22.430 % of family members)
Environment Ontology (ENVO) Unclassified
(55.140 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(81.308 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.60%    β-sheet: 19.30%    Coil/Unstructured: 42.11%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF05065Phage_capsid 11.21
PF06791TMP_2 2.80
PF05876GpA_ATPase 1.87
PF06141Phage_tail_U 1.87
PF05136Phage_portal_2 1.87
PF13550Phage-tail_3 0.93
PF13884Peptidase_S74 0.93
PF13856Gifsy-2 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 11.21
COG5281Phage-related minor tail proteinMobilome: prophages, transposons [X] 2.80
COG5511Phage capsid proteinMobilome: prophages, transposons [X] 1.87
COG5525Phage terminase, large subunit GpAMobilome: prophages, transposons [X] 1.87


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.26 %
UnclassifiedrootN/A3.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10053031All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2010Open in IMG/M
3300001349|JGI20160J14292_10158749All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium698Open in IMG/M
3300001352|JGI20157J14317_10000629Not Available35730Open in IMG/M
3300003346|JGI26081J50195_1022200All Organisms → Viruses → Predicted Viral1436Open in IMG/M
3300003583|JGI26253J51717_1001119All Organisms → cellular organisms → Bacteria → Proteobacteria11079Open in IMG/M
3300003617|JGI26082J51739_10014290All Organisms → cellular organisms → Bacteria3665Open in IMG/M
3300005941|Ga0070743_10079425All Organisms → Viruses → Predicted Viral1108Open in IMG/M
3300006027|Ga0075462_10041179All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1478Open in IMG/M
3300006029|Ga0075466_1064861All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300006484|Ga0070744_10010657All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2731Open in IMG/M
3300006484|Ga0070744_10203681All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium563Open in IMG/M
3300006752|Ga0098048_1065232All Organisms → Viruses → Predicted Viral1128Open in IMG/M
3300006802|Ga0070749_10101260All Organisms → Viruses → Predicted Viral1703Open in IMG/M
3300006810|Ga0070754_10174023All Organisms → Viruses → Predicted Viral1016Open in IMG/M
3300006874|Ga0075475_10069280All Organisms → Viruses → Predicted Viral1632Open in IMG/M
3300006919|Ga0070746_10523563All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium518Open in IMG/M
3300007276|Ga0070747_1017792All Organisms → Viruses → Predicted Viral2921Open in IMG/M
3300007276|Ga0070747_1022200All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2575Open in IMG/M
3300007346|Ga0070753_1130854All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium960Open in IMG/M
3300007538|Ga0099851_1016450Not Available3004Open in IMG/M
3300007538|Ga0099851_1031470All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2120Open in IMG/M
3300007538|Ga0099851_1050820All Organisms → cellular organisms → Bacteria → Proteobacteria1628Open in IMG/M
3300007540|Ga0099847_1001377All Organisms → cellular organisms → Bacteria → Proteobacteria8450Open in IMG/M
3300007540|Ga0099847_1220759All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium550Open in IMG/M
3300007692|Ga0102823_1117363All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium705Open in IMG/M
3300008107|Ga0114340_1001973Not Available18233Open in IMG/M
3300008113|Ga0114346_1226310All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium721Open in IMG/M
3300009054|Ga0102826_1003446All Organisms → cellular organisms → Bacteria → Proteobacteria4106Open in IMG/M
3300009076|Ga0115550_1014104All Organisms → Viruses → Predicted Viral4075Open in IMG/M
3300009181|Ga0114969_10010041All Organisms → cellular organisms → Bacteria7017Open in IMG/M
3300009181|Ga0114969_10040386All Organisms → Viruses → Predicted Viral3170Open in IMG/M
3300009435|Ga0115546_1104988All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1024Open in IMG/M
3300009440|Ga0115561_1021491All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3199Open in IMG/M
3300009447|Ga0115560_1002618All Organisms → cellular organisms → Bacteria → Proteobacteria11652Open in IMG/M
3300009495|Ga0115571_1042860All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2134Open in IMG/M
3300009606|Ga0115102_10166452All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium532Open in IMG/M
3300010316|Ga0136655_1022036All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2119Open in IMG/M
3300010370|Ga0129336_10090946All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1794Open in IMG/M
3300010389|Ga0136549_10257778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria737Open in IMG/M
3300011254|Ga0151675_1100550All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium551Open in IMG/M
3300017697|Ga0180120_10337940All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium598Open in IMG/M
3300017774|Ga0181358_1053958All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1514Open in IMG/M
3300017783|Ga0181379_1320343All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium525Open in IMG/M
3300017950|Ga0181607_10419740All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium726Open in IMG/M
3300017951|Ga0181577_10433213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae832Open in IMG/M
3300018041|Ga0181601_10216335All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1113Open in IMG/M
3300020161|Ga0211726_10013413All Organisms → Viruses → Predicted Viral1043Open in IMG/M
3300020166|Ga0206128_1162967All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium888Open in IMG/M
3300020182|Ga0206129_10236710All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium778Open in IMG/M
3300020187|Ga0206130_10088805All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1883Open in IMG/M
3300020194|Ga0181597_10276530All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium763Open in IMG/M
3300021378|Ga0213861_10289979All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium846Open in IMG/M
3300021957|Ga0222717_10134790All Organisms → Viruses → Predicted Viral1517Open in IMG/M
3300021963|Ga0222712_10014738Not Available6801Open in IMG/M
3300021963|Ga0222712_10094313All Organisms → Viruses → Predicted Viral2108Open in IMG/M
3300021963|Ga0222712_10123306All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1781Open in IMG/M
3300021963|Ga0222712_10194093All Organisms → Viruses → Predicted Viral1335Open in IMG/M
3300021964|Ga0222719_10490410All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium740Open in IMG/M
3300022061|Ga0212023_1055170All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium552Open in IMG/M
3300022178|Ga0196887_1029082All Organisms → Viruses → Predicted Viral1558Open in IMG/M
3300022198|Ga0196905_1107718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae739Open in IMG/M
3300022200|Ga0196901_1234734All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium575Open in IMG/M
3300022308|Ga0224504_10079097All Organisms → Viruses → Predicted Viral1323Open in IMG/M
3300022921|Ga0255765_1263788All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium709Open in IMG/M
(restricted) 3300023109|Ga0233432_10127252All Organisms → Viruses → Predicted Viral1378Open in IMG/M
3300024221|Ga0228666_1056874All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium794Open in IMG/M
3300024226|Ga0228667_1089719All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium578Open in IMG/M
3300024231|Ga0233399_1024637All Organisms → Viruses → Predicted Viral1791Open in IMG/M
3300024319|Ga0228670_1088274All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium637Open in IMG/M
3300024346|Ga0244775_10010032All Organisms → cellular organisms → Bacteria → Proteobacteria9042Open in IMG/M
3300024346|Ga0244775_10041553All Organisms → Viruses → Predicted Viral4045Open in IMG/M
3300024346|Ga0244775_10049091All Organisms → Viruses → Predicted Viral3681Open in IMG/M
3300024346|Ga0244775_10753879All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium781Open in IMG/M
(restricted) 3300024520|Ga0255047_10371688All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium721Open in IMG/M
3300025483|Ga0209557_1001330All Organisms → cellular organisms → Bacteria → Proteobacteria13799Open in IMG/M
3300025543|Ga0208303_1007357All Organisms → cellular organisms → Bacteria → Proteobacteria3601Open in IMG/M
3300025543|Ga0208303_1020224All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1900Open in IMG/M
3300025621|Ga0209504_1027293All Organisms → Viruses → Predicted Viral2038Open in IMG/M
3300025637|Ga0209197_1120879All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300025641|Ga0209833_1047798All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1467Open in IMG/M
3300025647|Ga0208160_1027207All Organisms → Viruses → Predicted Viral1758Open in IMG/M
3300025652|Ga0208134_1099255All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium808Open in IMG/M
3300025652|Ga0208134_1134692All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium640Open in IMG/M
3300025654|Ga0209196_1009139All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium4709Open in IMG/M
3300025666|Ga0209601_1083534All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium974Open in IMG/M
3300025701|Ga0209771_1023573All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2550Open in IMG/M
3300025704|Ga0209602_1191413All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium616Open in IMG/M
3300025860|Ga0209119_1269728All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium619Open in IMG/M
3300025879|Ga0209555_10131538All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1053Open in IMG/M
3300025886|Ga0209632_10069013All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2171Open in IMG/M
3300025889|Ga0208644_1324886All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium599Open in IMG/M
3300026420|Ga0247581_1057660All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium617Open in IMG/M
3300026453|Ga0228644_1098686All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium503Open in IMG/M
3300027191|Ga0208021_1065244All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium538Open in IMG/M
3300027193|Ga0208800_1037175All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium657Open in IMG/M
3300027631|Ga0208133_1016987All Organisms → Viruses → Predicted Viral1909Open in IMG/M
3300027754|Ga0209596_1032160All Organisms → Viruses → Predicted Viral2950Open in IMG/M
(restricted) 3300027861|Ga0233415_10348874All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium704Open in IMG/M
3300031589|Ga0307996_1039072All Organisms → Viruses → Predicted Viral1253Open in IMG/M
3300031787|Ga0315900_10118152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2531Open in IMG/M
3300031857|Ga0315909_10525393All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium810Open in IMG/M
3300032092|Ga0315905_11176868All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium628Open in IMG/M
3300032116|Ga0315903_11108438All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium543Open in IMG/M
3300032277|Ga0316202_10007836All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium5689Open in IMG/M
3300032373|Ga0316204_10509415All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium896Open in IMG/M
3300034104|Ga0335031_0011897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Thalassobius → Thalassobius litoralis6402Open in IMG/M
3300034112|Ga0335066_0490172All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales654Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous22.43%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine10.28%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine7.48%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater6.54%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine5.61%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water5.61%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.74%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.74%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine3.74%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.80%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.80%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.80%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater2.80%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.87%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.87%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat1.87%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.93%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.93%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.93%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.93%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.93%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.93%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.93%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.93%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.93%
Marine Methane Seep SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment0.93%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300001349Pelagic Microbial community sample from North Sea - COGITO 998_met_10EnvironmentalOpen in IMG/M
3300001352Pelagic Microbial community sample from North Sea - COGITO 998_met_07EnvironmentalOpen in IMG/M
3300003346Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNAEnvironmentalOpen in IMG/M
3300003583Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNAEnvironmentalOpen in IMG/M
3300003617Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNAEnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009076Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511EnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009440Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512EnvironmentalOpen in IMG/M
3300009447Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010316Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010389Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsfEnvironmentalOpen in IMG/M
3300011254Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020187Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1EnvironmentalOpen in IMG/M
3300020194Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022061Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022308Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24EnvironmentalOpen in IMG/M
3300022921Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaGEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300024221Seawater microbial communities from Monterey Bay, California, United States - 80DEnvironmentalOpen in IMG/M
3300024226Seawater microbial communities from Monterey Bay, California, United States - 81DEnvironmentalOpen in IMG/M
3300024231Seawater microbial communities from Monterey Bay, California, United States - 43DEnvironmentalOpen in IMG/M
3300024319Seawater microbial communities from Monterey Bay, California, United States - 85DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024520 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1EnvironmentalOpen in IMG/M
3300025483Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025621Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes)EnvironmentalOpen in IMG/M
3300025637Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 (SPAdes)EnvironmentalOpen in IMG/M
3300025641Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025654Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 (SPAdes)EnvironmentalOpen in IMG/M
3300025666Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 (SPAdes)EnvironmentalOpen in IMG/M
3300025701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025704Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)EnvironmentalOpen in IMG/M
3300025860Pelagic Microbial community sample from North Sea - COGITO 998_met_03 (SPAdes)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025886Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026453Seawater microbial communities from Monterey Bay, California, United States - 56DEnvironmentalOpen in IMG/M
3300027191Estuarine microbial communities from the Columbia River estuary - metaG S.737 (SPAdes)EnvironmentalOpen in IMG/M
3300027193Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)EnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300031589Marine microbial communities from David Island wharf, Antarctic Ocean - #35EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1005303143300000101MarineMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEDHLKN*
JGI20160J14292_1015874913300001349Pelagic MarineMTLAKRIAAKRADQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKSEDEDGEKAFTLEDKSILLGEPVNVIAKVFGSIFDTDSPEDHLKN*
JGI20157J14317_1000062913300001352Pelagic MarineRCHNMTLAKRIAAKRADQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKSEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEDHLKN*
JGI26081J50195_102220013300003346MarineMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFNEVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVSVIAKVFGSIFDTDSTEDHLKN*
JGI26253J51717_100111933300003583MarineMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFNEVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSTEDHLKN*
JGI26082J51739_1001429023300003617MarineMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFNEVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVSVIAKVFGSIFDTDSKEDHLKN*
Ga0070743_1007942533300005941EstuarineMTLAKRIAAKRAEQQRGFSDVEEWGEAENPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSTEDHLKN*
Ga0075462_1004117953300006027AqueousMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPV
Ga0075466_106486123300006029AqueousMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEEHLKN*
Ga0070744_1001065733300006484EstuarineMSIAKRIAANRAAQPRGSVDVEEWGEEGKPLRLFFTQVTARDIEKVQRKYKDFLASTSLGGMIEMIIEKCEDEKGTSAFTLEDRPILMSEPPLLIARVFNSVFNAGSSEDHAKN*
Ga0070744_1020368113300006484EstuarinePRLWRSNSIDGCLMSIAKRIAANRAAQPRGFVDVEEWGEGGKPLRLFFTQVNARDIEKVQRKYKDFLVSSSLGGMVEMIIEKCEDEKGTSAFTLEDKPILMSEPPLLIARVFNSVFNAESSEDHAKN*
Ga0098048_106523213300006752MarineMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTEVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSAEDHLKN*
Ga0070749_1010126043300006802AqueousMSIAQRIAANRAAQARSVVEVADWGEGDNPLRLYFGPVTARDIEKVQRKYKDFLSNATMGAMVEMIIHKCEDEKGEAAFTLEDKPILMGEPVGTIAHVFGAIFNSTSVEDQEKN*
Ga0070754_1017402313300006810AqueousMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVN
Ga0075475_1006928013300006874AqueousMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIF
Ga0070746_1052356313300006919AqueousMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQISARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDDAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEDHLKN*
Ga0070747_101779223300007276AqueousMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPGMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEEHLKN*
Ga0070747_102220063300007276AqueousMSVAKRIAAKRAEKQREFIDVEAWGEGETPLRLYFTEVSARDIEKVQRKYPNFLSETSMSAMVEMIIAKCEDEKGDKVFTLEDKPILLNETVATIAKVFGGIFSADSAEEHVKN*
Ga0070753_113085413300007346AqueousMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDDAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEDHLKN*
Ga0099851_101645043300007538AqueousMSIAQRIAANRAAQARSVVEVADWGEGDNPLRLYFGPVTARDIEKVQRKYKDFLSNATMGAMVEMIIHKCEDEKGEAAFTLEDKPILMGEPIGTIAHVFGAIFNSTSVEDQEKN*
Ga0099851_103147033300007538AqueousMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQISARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEDHLKN*
Ga0099851_105082023300007538AqueousMSIAQRIAANRAAQARSVVEVADWGEGDNPLRLYFGPVTARDIEKVQRKYKDFLSNATMGAMVEMIIHKCEDEKGEAAFTLEDKPILMGEPVGTIAHVFGAVFTSTSVEDQEKN*
Ga0099847_100137783300007540AqueousMSIAKRIAAKRAEKERGFVDVEEWGEGDNSLRLFFNQVNARDIEKVQRKYKDFLTSPSLASMVELIIDKCEDEKGDRAFTLEDKAILMGEPVNVIATVFGAVFGAPSVEEHEKN*
Ga0099847_122075913300007540AqueousMTLAKRIAAKRADQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKSEDEDGEKAFTLEDKSILLGEPVNVI
Ga0102823_111736323300007692EstuarineMTLAKRIAAKRAEQQRGFSDVEEWGEAENPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSI
Ga0114340_1001973133300008107Freshwater, PlanktonMSLAKRIAAKRAEQQRGFVDVEEWGEGETPLRLFFTSVSARDIEKVQRKYKDFLTNTTLGAMVEMLIEKCEDEKGDKAFTLEDKPILMSEPVGVIAKVFGAVFNAGSIEDHAKN*
Ga0114346_122631023300008113Freshwater, PlanktonMSLAKRIAAKRAEQQRGFVDVEEWGEGETPLRLFFTSVSARDIEKVQRKYKDFLTNTTLGAMVEMLIEKCEDEKGDKAFTLEDKPILMSEPVGVIAKVFGAVFNAGS
Ga0102826_100344663300009054EstuarineKRAEQQRGFSDVEEWGEAENPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSTEDHLKN*
Ga0115550_101410413300009076Pelagic MarineMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKSEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEDHLKN*
Ga0114969_1001004183300009181Freshwater LakeMSIAKRIAANRAAQPRGFVDVEEWGEGGKPLRLFFTQVNARDIEKVQRKYKDFLVSSSLGGMVEMIIEKCEDEKGTSAFTLEDKPILMSEPPLLIARVFNSVFNAESSEDHAKN*
Ga0114969_1004038623300009181Freshwater LakeMSIAKRIAANRAAQPRGLVDVEEWGEEGKPLRLFFTQVNARDIEKVQRKYKDFLVASSLGGMIEMIIEKCEDEKGASAFTLEDKPILMSEPPLLIARVFNSVFNAQSSEDHAKN*
Ga0115546_110498833300009435Pelagic MarineMSVAKRIAAKRAEKQREFIDVEAWGEGETPLRLYFTEVSARDIEKVQRKYPNFLSETSMSAMVEMIIAKCEDEKGEKVFTLEDKPILLNETVATIAKVFGGIFSADSAEEHVKN*
Ga0115561_102149133300009440Pelagic MarineMTLAKRIAAKRADQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKSEDEDGEKAFTLEDKSILLGEPVNVIAKVFGSIFDTDRPEDHLKN*
Ga0115560_100261843300009447Pelagic MarineMTLAKRIAAKRADQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKSEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEDHLKN*
Ga0115571_104286013300009495Pelagic MarineMTLAKRIAAKRADQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKSEDEDGEKAFTLEDKSILLGEPVN
Ga0115102_1016645213300009606MarineMTLAKRIAAKRAEQQRGFSDVEEWGEAENPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKSFTLEDKAILLGEPVNVIAKVFGSIFDTDSTEDHLKN*
Ga0136655_102203623300010316Freshwater To Marine Saline GradientMSVAKRIAAKRAEKQREFIDVEAWGEGETPLRLYFTEVSARDIEKVQRKYQNFLSETSMSAMVEMIIAKCEDEKGDKVFTLEDKPILLNETVATIAKVFGGIFSADSAEEHVKN*
Ga0129336_1009094623300010370Freshwater To Marine Saline GradientDGGLMSLAKRIAAKRADQQRGFVDVEEWSEGDKPLRLFFTSVSARDIEKVQRKYKDFLTQTSLGAMVEMIIEKCEDEKGDKAFTLEDKPILMGEPIGVIAKVFGAVFNATNIEEHAKN*
Ga0136549_1025777823300010389Marine Methane Seep SedimentMSLAKRIAAKRAEQERQSVEVDEWGEGGEPLLLYYGPVTARDIEKVQRKYKDFLANVSMGAMVETIILKCQTKDGEPAFTLEDKPILMGEPIGVVTKVFGAVFNSASVEDHEKN*
Ga0151675_110055013300011254MarineGFSDVEEWGEADNPLRLYFTEVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKSEDEAGEKAFTLEDKAILLGEPVSVIAKVFGSIFDATSAEDHIKN*
Ga0180120_1033794023300017697Freshwater To Marine Saline GradientMTLAKRIAAKRADQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKSEDEDGEKAFTLEDKSILLGEPV
Ga0181358_105395813300017774Freshwater LakeNRAAQPRGFVDVEEWGEGGKPLRLFFTQVNARDIEKVQRKYKDFLVSSSLGGMIEMIIEKCEDEKGTSAFTLEDKPILMSEPPLLIARVFNSVFNAESSEDHAKN
Ga0181379_132034313300017783SeawaterMTLAKRIAAKRADQQRGFSDVEEWGEADNPLRLYFTEVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSTEDHLKN
Ga0181607_1041974013300017950Salt MarshAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEDHLKN
Ga0181577_1043321323300017951Salt MarshMSIAQRIAANRAAQARSVVEVADWGEGDNPLRLYFGPVTARDIEKVQRKYKDFLSNATMGAMVEMIIHKCEDEKGEAAFTLEDKPILMGEPIGTIAHVFGAIFNSTSVEDQEKN
Ga0181601_1021633523300018041Salt MarshMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEDHLKN
Ga0211726_1001341333300020161FreshwaterMSIAKRIAANRAAQPRGFVDVEEWGEGDKPLRLFFTQVNARDIEKVQRKYKDFLVASSLGGMIEMIIEKCEDEKGTSAFTLEDKPILMSEPPLLIARVFNAVFNAQSSEDHAKN
Ga0206128_116296723300020166SeawaterMTLAKRIAAKRADQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKSEDEDGEKAFTLEDKSILLGEPVNVIAKVFGSIFDTDSPEDHLKN
Ga0206129_1023671013300020182SeawaterMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTEVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSAEDHLKN
Ga0206130_1008880523300020187SeawaterKRIAAKRADQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKSEDEDGEKAFTLEDKSILLGEPVNVIAKVFGSIFDTDSPEDHLKN
Ga0181597_1027653023300020194Salt MarshMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQISARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPED
Ga0213861_1028997933300021378SeawaterMSVAKRIAAKRAEKQREFIDVEAWGEGETPLRLYFTEVSARDIEKVQRKYPNFLSETSMSAMVEMIIAKCEDEKGDKVFTLEDKPILLNETVATIAKVFGGIFSADSAEEHVKN
Ga0222717_1013479043300021957Estuarine WaterMTLAKRIAAKRADQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKSEDEAGEKAFTLEDKSILLGEPVNV
Ga0222712_1001473853300021963Estuarine WaterMSIAKRIAANRAAQPRGFVDVEEWGEEGKPLRLFFTQVNARDIEKVQRKYKDFLSNPSLAAMVEMVIEKCEDEKGDRTFTLEDKPILMSETVSIIAKVFGAVFGSEAPEEHAKN
Ga0222712_1009431333300021963Estuarine WaterNSSDGCLMSIAKRIAANRAAQPRGFVDVEEWGEGGKPLRLFFTQVNARDIEKVQRKYKDFLVSSSLGGMIEMIIEKCEDEKGTSAFTLEDKPILMSEPPLLIARVFNSVFNAESSEDHAK
Ga0222712_1012330633300021963Estuarine WaterAQPRGFVDVEEWGEEGKPLRLFFTQVNARDIEKVQRKYKDFLSNPSLAAMVEMIIEKCEDEKGDRTFTLEDKPILMSETVSIIAKLFGAVFGSEAPEEHAKN
Ga0222712_1019409343300021963Estuarine WaterMSLAKRIAAKRAEQQRGFVDVEEWGEGETPLRLFFTSVSARDIEKVQRKYKDFLTNTALGAMVEMLIEKCEDEKGDKAFTLEDKPILMSEPVGVIAKVFGAVFNAGSI
Ga0222719_1049041023300021964Estuarine WaterMSLAKRIAAKRSERERGIVEVAEWGEGDEPLHLYFTEVSARDIEKVQRKHPDFLTNPSMSAMVEMIIIKCEDQAGEKAFTLEDKPILLGETVSVIAKVFGAVFS
Ga0212023_105517013300022061AqueousEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPGMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEEHLKN
Ga0196887_102908213300022178AqueousMSVAQRIAAKRADKQREFIDVEAWGEGDTPLRLYFSEVSARDIEKVQRKYPNFLSDTSMSAMVEMIVAKCEDEKGDKVFTLEDKSILLNETVSTIAKVFGGIFSAESAEDHVKN
Ga0196905_110771813300022198AqueousMSIAQRIAANRAAQARSVVEVADWGEGENPLRLYFGPVTARDIEKVQRKYKDFLSNATMGAMVEMIIHKCEDEKGEAAFTLEDKPILMGEPVGTIAHVFGAIFNSTSVEDQEKN
Ga0196901_123473423300022200AqueousMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEDH
Ga0224504_1007909733300022308SedimentMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTDVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSTEDHLKN
Ga0255765_126378823300022921Salt MarshRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEDHLKN
(restricted) Ga0233432_1012725233300023109SeawaterMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFNEVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSTEDHLKN
Ga0228666_105687423300024221SeawaterMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAVLLGEPVNVIAKVFGSIFDTDSPEDHLKN
Ga0228667_108971913300024226SeawaterMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAVLLGEPVNVIAKLFGSIFDTDSPEDHLKN
Ga0233399_102463723300024231SeawaterMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTEVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSTEDHLKN
Ga0228670_108827413300024319SeawaterMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYHNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVVAKVFGSIFDTDSPEDHLKN
Ga0244775_1001003233300024346EstuarineMTLAKRIAAKRAEQQRGFSDVEEWGEAENPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSTEDHLKN
Ga0244775_1004155363300024346EstuarineMSIAKRIAANRAAQPRGFVDVEEWGEEGKPLRLFFTQVNARDIEKVQRKYKDFLSNPSLAAMVEMIIEKCEDEKGDRTFTLEDKPILMSETVSIIAKLFGAVFGSEAPEEHAKN
Ga0244775_1004909133300024346EstuarineMSIAKRIAANRAAQPRGSVDVEEWGEEGKPLRLFFTQVTARDIEKVQRKYKDFLASTSLGGMIEMIIEKCEDEKGTSAFTLEDRPILMSEPPLLIARVFNSVFNAGSSEDHAKN
Ga0244775_1075387923300024346EstuarineMSIAKRIAANRAAQPRGFVDVEEWGEGGKPLRLFFTQVNARDIEKVQRKYKDFLVSSSLGGMVEMIIEKCEDEKGTSAFTLEDKPILMSEPPLLIARVFNSVFNAESSEDHAKN
(restricted) Ga0255047_1037168823300024520SeawaterMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFNEVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVSVIAKVFGSIFDTDSKEDHLKN
Ga0209557_100133063300025483MarineMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFNEVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVSVIAKVFGSIFDTDSTEDHLKN
Ga0208303_100735773300025543AqueousMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQISARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEDHLKN
Ga0208303_102022423300025543AqueousMSIAKRIAAKRAEKERGFVDVEEWGEGDNSLRLFFNQVNARDIEKVQRKYKDFLTSPSLASMVELIIDKCEDEKGDRAFTLEDKAILMGEPVNVIATVFGAVFGAPSVEEHEKN
Ga0209504_102729313300025621Pelagic MarineRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEDHLKN
Ga0209197_112087923300025637Pelagic MarineMTLAKRIAAKRADQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKSEDEDGEKAFTLEDKSILLGEPVNVIAKVFGSIFDT
Ga0209833_104779813300025641Pelagic MarineKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDDAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEDHLKN
Ga0208160_102720743300025647AqueousMSIAQRIAANRAAQARSVVEVADWGEGDNPLRLYFGPVTARDIEKVQRKYKDFLSNATMGAMVEMIIHKCEDEKGEAAFTLEDKPILMGEPVGTIAHVFGAVFTSTSVEDQEKN
Ga0208134_109925513300025652AqueousMSVAKRIAAKRAEKQREFIDVEAWGEGETPLRLYFTEVSARDIEKVQRKYPNFLSETSMSAMVEMIIAKCEDEKGDKVFTLEDKPILLNETVATIAKVFGGIFSA
Ga0208134_113469223300025652AqueousMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPGMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEEHLKN
Ga0209196_100913923300025654Pelagic MarineMTLAKRIAAKRADQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKSEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEDHLKN
Ga0209601_108353423300025666Pelagic MarineMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDDAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEDHLKN
Ga0209771_102357343300025701MarineRIAAKRAEQQRGFSDVEEWGEADNPLRLYFNEVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVSVIAKVFGSIFDTDSTEDHLKN
Ga0209602_119141313300025704Pelagic MarineGFSDVEEWGEADNPLRLYFTEVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSAEDHLKN
Ga0209119_126972813300025860Pelagic MarineMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKSEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSPEDHLKN
Ga0209555_1013153833300025879MarineMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSVFDTDSAEDHLKN
Ga0209632_1006901373300025886Pelagic MarineMTLAKRIAAKRADQQRGFSDVEEWGEADNPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKSEDEDGEKAFTLEDKSILLGEPVNVIAKVFGSIFDTDSPEDQLKN
Ga0208644_132488613300025889AqueousCNDMSIAQRIAANRAAQARSVVEVADWGEGENPLRLYFGPVTARDIEKVQRKYKDFLSNATMGAMVEMIIHKCEDEKGEAAFTLEDKPILMGEPVGTIAHVFGAIFNSTSVEDQEKN
Ga0247581_105766033300026420SeawaterEEWGEADNPLRLYFTEVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSTEDHLKN
Ga0228644_109868613300026453SeawaterMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTEVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIA
Ga0208021_106524433300027191EstuarineKRAEQQRGFSDVEEWGEAENPLRLYFTQVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVNVIAKVFGSIFDTDSTEDHLKN
Ga0208800_103717523300027193EstuarineMSIAKRIAANRAAQPRGSVDVEEWGEEGKPLRLFFTQVTARDIEKVQRKYKDFLASTSLGGMIEMIIEKCEDEKGTSAFTLEDRPILMSEPPLLIARVFNSVFNAGSSE
Ga0208133_101698723300027631EstuarineMSIAKRIAANRAAQPRGFVDVEEWGEEGKPLRLFFTQVTARDIEKVQRKYKDFLASTSLGGMIEMIIEKCEDEKGTSAFTLEDRPILMSEPPLLIARVFNSVFNAGSSEDHAKN
Ga0209596_103216023300027754Freshwater LakeMSIAKRIAANRAAQPRGLVDVEEWGEEGKPLRLFFTQVNARDIEKVQRKYKDFLVASSLGGMIEMIIEKCEDEKGASAFTLEDKPILMSEPPLLIARVFNSVFNAQSSEDHAKN
(restricted) Ga0233415_1034887423300027861SeawaterMTLAKRIAAKRAEQQRGFSDVEEWGEADNPLRLYFTEVSARDIEKVQRKYPNFLAEPSMSAMVEMIIVKCEDEAGEKAFTLEDKAILLGEPVSVIAKVFGSIFDTDSTEDHLKN
Ga0307996_103907243300031589MarineMSLAKRIAAKRSEQQRGFSDVEEWGEGDHPLRLYFTEISARDIEKVQRKYPKFLSDTSMSAMVEMIILKCEDEAGDKAFTLEDKAILLGETVSVIASVFGAIFSGDS
Ga0315900_1011815243300031787FreshwaterMSIAKRIAAKRAEQQRGFVDVEEWGEGETPLRLFFTSVSARDIEKVQRKYKDFLTNTTLGAMVEMLIEKCEDQKGDKAFTLEDKPILMSEPVGVIAKVFGAVFNAGSIEDHAKN
Ga0315909_1052539313300031857FreshwaterMSLAKRIAAKRAEQQRGFVDVEEWGEGETPLRLFFTSVSARDIEKVQRKYKDFLTNTTLGAMVEMLIEKCEDQKGDKAFTLEDKPILMSEPVGVIAKVFGAVFNAGSI
Ga0315905_1117686813300032092FreshwaterFVDVEEWGEGETPLRLFFTSVSARDIEKVQRKYKDFLTNTSFGAMVEMVIEKCEDEKGDKAFTLEDKPILMSEPVGVIAKVFGAVFNATSIEDHTKN
Ga0315903_1110843813300032116FreshwaterFVDVEEWGEGETPLRLFFTSVSARDIEKVQRKYKDFLTNTSLGAMVEMVIEKCEDEKGDKAFTLEDKPILMSEPVGVIAKVFGAVFNATSIEDHTKN
Ga0316202_1000783643300032277Microbial MatMTLAKRIAAKRADQQRGFSDVEEWGEADNPLRLYFTQISARDIEKVQRKYPNFLAEPSMSAMVEMIIVKSEDEDGEKAFTLEDKSILLGEPVNVIAKVFGSIFDTDSPEDHLKN
Ga0316204_1050941513300032373Microbial MatMTLAKRIAAKRADQQRGFSDVEEWGEADNPLRLYFTQISARDIEKVQRKYPNFLAEPSMSAMVEMIIVKSEDEDGEKAFTLEDKSILLGEPVNVIAKVFGSIFDTDSSEDHLKN
Ga0335031_0011897_6062_64003300034104FreshwaterLAKRIAAKRADQQRGFVDVEEWGEGETPLRLFFTSVSARDIEKVQRKYKDFLTNTSLGAMVEMVIEKCEDEKGDKAFTLEDKPILMSEPVGVIAKVFGAVFNAGSIEDHAKN
Ga0335066_0490172_235_5793300034112FreshwaterMSLAKRIAAKRADQQRGFVDVEEWGEGETPLRLFFTSVSARDIEKVQRKYKDFLTNTSLGAMVEMVIEKCEDQKGDKAFTLEDKPILMSEAVGVIAKVFGAVFNATSIEDHAKN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.