Metagenome Family F092043

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F092043
Family Type	Metagenome
Number of Sequences	107
Average Sequence Length	40 residues
Representative Sequence	MMPWYKKLLYILIAPFIIGAWCIMNPRKVWEQAKKDFGVE
Number of Associated Samples	72
Number of Associated Scaffolds	107

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Viruses
% of genes with valid RBS motifs	92.52 %
% of genes near scaffold ends (potentially truncated)	13.08 %
% of genes from short scaffolds (< 2000 bps)	73.83 %
Associated GOLD sequencing projects	61
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Duplodnaviria (45.794 % of family members)
NCBI Taxonomy ID	2731341
Taxonomy	All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (33.645 % of family members)
Environment Ontology (ENVO)	Unclassified (63.551 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (79.439 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 48.53% β-sheet: 0.00% Coil/Unstructured: 51.47%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.46
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 107 Family Scaffolds
PF14743	DNA_ligase_OB_2	2.80
PF07486	Hydrolase_2	2.80
PF04055	Radical_SAM	1.87
PF16473	Rv2179c-like	1.87
PF00596	Aldolase_II	1.87
PF10902	WYL_2	1.87
PF04488	Gly_transf_sug	1.87
PF07068	Gp23	1.87
PF08406	CbbQ_C	1.87
PF01068	DNA_ligase_A_M	0.93
PF12850	Metallophos_2	0.93
PF11927	DUF3445	0.93
PF00574	CLP_protease	0.93
PF13640	2OG-FeII_Oxy_3	0.93
PF00004	AAA	0.93
PF01467	CTP_transf_like	0.93
PF03567	Sulfotransfer_2	0.93
PF14279	HNH_5	0.93
PF09374	PG_binding_3	0.93
PF03232	COQ7	0.93
PF04434	SWIM	0.93
PF07460	NUMOD3	0.93
PF00497	SBP_bac_3	0.93
PF02562	PhoH	0.93

COG ID	Name	Functional Category	% Frequency in 107 Family Scaffolds
COG3773	Cell wall hydrolase CwlJ, involved in spore germination	Cell cycle control, cell division, chromosome partitioning [D]	2.80
COG0616	Periplasmic serine protease, ClpP class	Posttranslational modification, protein turnover, chaperones [O]	1.87
COG0714	MoxR-like ATPase	General function prediction only [R]	1.87
COG0740	ATP-dependent protease ClpP, protease subunit	Posttranslational modification, protein turnover, chaperones [O]	1.87
COG3774	Mannosyltransferase OCH1 or related enzyme	Cell wall/membrane/envelope biogenesis [M]	1.87
COG1030	Membrane-bound serine protease NfeD, ClpP class	Posttranslational modification, protein turnover, chaperones [O]	0.93
COG1423	ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family	Replication, recombination and repair [L]	0.93
COG1702	Phosphate starvation-inducible protein PhoH, predicted ATPase	Signal transduction mechanisms [T]	0.93
COG1793	ATP-dependent DNA ligase	Replication, recombination and repair [L]	0.93
COG1875	Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains	General function prediction only [R]	0.93
COG2941	Demethoxyubiquinone hydroxylase, CLK1/Coq7/Cat5 family (ubiquinone biosynthesis)	Coenzyme transport and metabolism [H]	0.93
COG4279	Uncharacterized protein, contains SWIM-type Zn finger domain	Function unknown [S]	0.93
COG4715	Uncharacterized protein, contains SWIM-type Zn finger domain	Function unknown [S]	0.93
COG5431	Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain	General function prediction only [R]	0.93

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	65.42 %
Unclassified	root	N/A	33.64 %
unclassified Hyphomonas	no rank	unclassified Hyphomonas	0.93 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	57.01 %
Unclassified	root	N/A	33.64 %
cellular organisms	root	All Organisms → cellular organisms	8.41 %
Hyphomonas sp.	species	unclassified Hyphomonas → Hyphomonas sp.	0.93 %

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	45.79 %
Unclassified	root	N/A	33.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.28 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	8.41 %
Hyphomonas sp.	species	unclassified Hyphomonas → Hyphomonas sp.	0.93 %

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	45.79 %
Unclassified	root	N/A	33.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.28 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	5.61 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	2.80 %
Hyphomonas sp.	species	unclassified Hyphomonas → Hyphomonas sp.	0.93 %

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	45.79 %
Unclassified	root	N/A	33.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.28 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	2.80 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.87 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.87 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.93 %
Hyphomonas sp.	species	unclassified Hyphomonas → Hyphomonas sp.	0.93 %

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	45.79 %
Unclassified	root	N/A	33.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.28 %
Chlorobi	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi	2.80 %
Pseudomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales	1.87 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1.87 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.93 %
Hyphomonas sp.	species	unclassified Hyphomonas → Hyphomonas sp.	0.93 %

Name	Rank	Taxonomy	Distribution
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	38.32 %
Unclassified	root	N/A	33.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.28 %
unclassified Chlorobiota	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota	2.80 %
Boseaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae	1.87 %
unclassified Caudoviricetes	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes	0.93 %
Marinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae	0.93 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	0.93 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.93 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	0.93 %
Hyphomonas sp.	species	unclassified Hyphomonas → Hyphomonas sp.	0.93 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	38.32 %
Unclassified	root	N/A	33.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.28 %
Chlorobiota bacteirum	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum	2.80 %
Bosea	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea	1.87 %
Siphoviridae sp. ctrgt10	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctrgt10	0.93 %
Limnohabitans	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans	0.93 %
Myoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	0.93 %
Marinobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter	0.93 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.93 %
Hyphomonas sp.	species	unclassified Hyphomonas → Hyphomonas sp.	0.93 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	38.32 %
Unclassified	root	N/A	33.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.28 %
Chlorobiota bacteirum	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum	2.80 %
unclassified Bosea	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea	1.87 %
unclassified Limnohabitans	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans	0.93 %
Pseudomonas aeruginosa group	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group	0.93 %
unclassified Marinobacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter	0.93 %
Siphoviridae sp. ctrgt10	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctrgt10	0.93 %
Myoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	0.93 %
Hyphomonas sp.	species	unclassified Hyphomonas → Hyphomonas sp.	0.93 %

Name	Rank	Taxonomy	Distribution
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	38.32 %
Unclassified	root	N/A	33.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	10.28 %
Chlorobiota bacteirum	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum	2.80 %
Bosea sp. BK604	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. BK604	1.87 %
Limnohabitans sp. 2KL-3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. 2KL-3	0.93 %
Marinobacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp.	0.93 %
Pseudomonas aeruginosa group	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group	0.93 %
Siphoviridae sp. ctrgt10	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctrgt10	0.93 %
Myoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	0.93 %
Hyphomonas sp.	species	unclassified Hyphomonas → Hyphomonas sp.	0.93 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002161\|JGI24766J26685_10039175	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1099	Open in IMG/M
3300002161\|JGI24766J26685_10069253	Not Available	770	Open in IMG/M
3300002835\|B570J40625_100019572	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	11529	Open in IMG/M
3300002835\|B570J40625_100485409	All Organisms → Viruses → Predicted Viral	1166	Open in IMG/M
3300002835\|B570J40625_101055072	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	690	Open in IMG/M
3300003277\|JGI25908J49247_10051339	Not Available	1077	Open in IMG/M
3300004685\|Ga0065177_1036586	Not Available	926	Open in IMG/M
3300005580\|Ga0049083_10221847	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	640	Open in IMG/M
3300005581\|Ga0049081_10001540	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	8690	Open in IMG/M
3300005581\|Ga0049081_10287134	Not Available	569	Open in IMG/M
3300005582\|Ga0049080_10004985	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4609	Open in IMG/M
3300005582\|Ga0049080_10225625	Not Available	615	Open in IMG/M
3300005662\|Ga0078894_10004630	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	10542	Open in IMG/M
3300005662\|Ga0078894_10991383	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	724	Open in IMG/M
3300005805\|Ga0079957_1021369	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	4501	Open in IMG/M
3300006030\|Ga0075470_10220931	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	539	Open in IMG/M
3300006101\|Ga0007810_1110359	Not Available	524	Open in IMG/M
3300006484\|Ga0070744_10063889	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1072	Open in IMG/M
3300007169\|Ga0102976_1008386	All Organisms → Viruses → Predicted Viral	1056	Open in IMG/M
3300007212\|Ga0103958_1004212	All Organisms → Viruses → Predicted Viral	4949	Open in IMG/M
3300007214\|Ga0103959_1173404	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1140	Open in IMG/M
3300007216\|Ga0103961_1325458	All Organisms → Viruses	1248	Open in IMG/M
3300008110\|Ga0114343_1158192	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	712	Open in IMG/M
3300008113\|Ga0114346_1108156	All Organisms → Viruses → Predicted Viral	1259	Open in IMG/M
3300008113\|Ga0114346_1247560	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	665	Open in IMG/M
3300009151\|Ga0114962_10000443	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	36759	Open in IMG/M
3300009151\|Ga0114962_10035087	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3410	Open in IMG/M
3300009152\|Ga0114980_10341003	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum	865	Open in IMG/M
3300009155\|Ga0114968_10009226	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7160	Open in IMG/M
3300009155\|Ga0114968_10692928	Not Available	534	Open in IMG/M
3300009158\|Ga0114977_10110806	All Organisms → Viruses → Predicted Viral	1659	Open in IMG/M
3300009159\|Ga0114978_10140379	Not Available	1563	Open in IMG/M
3300009159\|Ga0114978_10331526	Not Available	925	Open in IMG/M
3300009159\|Ga0114978_10719906	Not Available	568	Open in IMG/M
3300009159\|Ga0114978_10753143	Not Available	552	Open in IMG/M
3300009161\|Ga0114966_10026025	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4367	Open in IMG/M
3300009161\|Ga0114966_10055284	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2800	Open in IMG/M
3300009161\|Ga0114966_10294162	Not Available	985	Open in IMG/M
3300009164\|Ga0114975_10300392	Not Available	889	Open in IMG/M
3300009172\|Ga0114995_10081542	Not Available	1820	Open in IMG/M
3300009181\|Ga0114969_10153720	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1443	Open in IMG/M
3300009184\|Ga0114976_10590623	Not Available	564	Open in IMG/M
3300009502\|Ga0114951_10362360	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	730	Open in IMG/M
3300009684\|Ga0114958_10229685	Not Available	921	Open in IMG/M
3300010160\|Ga0114967_10342048	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	758	Open in IMG/M
3300010334\|Ga0136644_10692232	Not Available	554	Open in IMG/M
3300010354\|Ga0129333_10020224	Not Available	6327	Open in IMG/M
3300010354\|Ga0129333_10477335	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1095	Open in IMG/M
3300010354\|Ga0129333_11284099	Not Available	605	Open in IMG/M
3300010354\|Ga0129333_11664539	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	520	Open in IMG/M
3300010370\|Ga0129336_10500184	Not Available	655	Open in IMG/M
3300010885\|Ga0133913_10249336	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	4715	Open in IMG/M
3300010885\|Ga0133913_10256085	Not Available	4646	Open in IMG/M
3300010885\|Ga0133913_10260631	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4602	Open in IMG/M
3300010885\|Ga0133913_11658321	All Organisms → Viruses → Predicted Viral	1610	Open in IMG/M
3300010885\|Ga0133913_11893819	unclassified Hyphomonas → Hyphomonas sp.	1487	Open in IMG/M
3300011995\|Ga0153800_1017352	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	728	Open in IMG/M
3300012017\|Ga0153801_1011312	All Organisms → Viruses → Predicted Viral	1619	Open in IMG/M
3300012665\|Ga0157210_1032329	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	817	Open in IMG/M
3300013285\|Ga0136642_1066694	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	960	Open in IMG/M
3300013285\|Ga0136642_1092595	All Organisms → cellular organisms → Bacteria → Proteobacteria	784	Open in IMG/M
3300013372\|Ga0177922_10135900	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group	804	Open in IMG/M
3300013372\|Ga0177922_10539986	Not Available	702	Open in IMG/M
3300017754\|Ga0181344_1064976	Not Available	1078	Open in IMG/M
3300017754\|Ga0181344_1153814	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. 2KL-3	656	Open in IMG/M
3300017761\|Ga0181356_1158997	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctrgt10	695	Open in IMG/M
3300017777\|Ga0181357_1330423	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	511	Open in IMG/M
3300017778\|Ga0181349_1072794	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1317	Open in IMG/M
3300020141\|Ga0211732_1598453	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. BK604	1324	Open in IMG/M
3300020161\|Ga0211726_10428430	Not Available	569	Open in IMG/M
3300020161\|Ga0211726_10669910	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	788	Open in IMG/M
3300020162\|Ga0211735_11474635	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Boseaceae → Bosea → unclassified Bosea → Bosea sp. BK604	884	Open in IMG/M
3300021131\|Ga0214206_1004213	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2604	Open in IMG/M
3300022179\|Ga0181353_1041537	All Organisms → Viruses → Predicted Viral	1215	Open in IMG/M
3300022179\|Ga0181353_1048940	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1109	Open in IMG/M
3300022179\|Ga0181353_1079902	Not Available	827	Open in IMG/M
3300022555\|Ga0212088_10352158	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1026	Open in IMG/M
3300022752\|Ga0214917_10013762	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7180	Open in IMG/M
3300024346\|Ga0244775_10128197	Not Available	2148	Open in IMG/M
3300024346\|Ga0244775_10740912	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	790	Open in IMG/M
3300027608\|Ga0208974_1000338	Not Available	20470	Open in IMG/M
3300027697\|Ga0209033_1004547	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	6964	Open in IMG/M
3300027708\|Ga0209188_1229073	Not Available	653	Open in IMG/M
3300027712\|Ga0209499_1089858	Not Available	1181	Open in IMG/M
3300027733\|Ga0209297_1359916	Not Available	525	Open in IMG/M
3300027741\|Ga0209085_1000286	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	37927	Open in IMG/M
3300027752\|Ga0209192_10133547	Not Available	994	Open in IMG/M
3300027754\|Ga0209596_1000019	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	165347	Open in IMG/M
3300027754\|Ga0209596_1094802	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1421	Open in IMG/M
3300027759\|Ga0209296_1011358	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum	5331	Open in IMG/M
3300027759\|Ga0209296_1115286	Not Available	1259	Open in IMG/M
3300027782\|Ga0209500_10045206	Not Available	2386	Open in IMG/M
3300027782\|Ga0209500_10234939	Not Available	808	Open in IMG/M
3300027797\|Ga0209107_10133064	All Organisms → Viruses → Predicted Viral	1291	Open in IMG/M
3300027797\|Ga0209107_10243357	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	868	Open in IMG/M
3300027805\|Ga0209229_10140312	All Organisms → Viruses → Predicted Viral	1090	Open in IMG/M
3300027805\|Ga0209229_10180708	Not Available	946	Open in IMG/M
3300027805\|Ga0209229_10340209	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	657	Open in IMG/M
3300027963\|Ga0209400_1021921	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3731	Open in IMG/M
3300028394\|Ga0304730_1203328	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	748	Open in IMG/M
3300031784\|Ga0315899_11162444	Not Available	672	Open in IMG/M
3300031857\|Ga0315909_10889667	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum	551	Open in IMG/M
3300033816\|Ga0334980_0020249	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp.	2859	Open in IMG/M
3300033978\|Ga0334977_0001049	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	16082	Open in IMG/M
3300034063\|Ga0335000_0200432	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1286	Open in IMG/M
3300034106\|Ga0335036_0003714	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	13128	Open in IMG/M
3300034106\|Ga0335036_0142221	All Organisms → Viruses → Predicted Viral	1716	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	100.00%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	89.72%
Marine	Environmental → Aquatic → Marine	10.28%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	57.94%
Lentic	Environmental → Aquatic → Freshwater → Lentic	28.97%
Coastal	Environmental → Aquatic → Marine → Coastal	5.61%
Unclassified	Environmental → Aquatic → Marine → Unclassified	2.80%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	1.87%
Oceanic	Environmental → Aquatic → Marine → Oceanic	1.87%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.93%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	57.94%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	23.36%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	5.61%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	3.74%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	2.80%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	1.87%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	1.87%
Unclassified	Environmental → Aquatic → Marine → Oceanic → Unclassified	1.87%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.93%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	33.64%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	11.21%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	10.28%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	5.61%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	5.61%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	4.67%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	4.67%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	3.74%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	3.74%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	2.80%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	2.80%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	1.87%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment	1.87%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	1.87%
Marine	Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine	1.87%
Freshwater Lake Hypolimnion	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion	0.93%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	0.93%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.93%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	0.93%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002161	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300003277	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD	Environmental	Open in IMG/M
3300004685	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (version 2)	Environmental	Open in IMG/M
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300006030	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA	Environmental	Open in IMG/M
3300006101	Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300007169	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects	Environmental	Open in IMG/M
3300007212	Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects	Environmental	Open in IMG/M
3300007214	Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects	Environmental	Open in IMG/M
3300007216	Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects	Environmental	Open in IMG/M
3300008110	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300009151	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG	Environmental	Open in IMG/M
3300009152	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009172	Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154	Environmental	Open in IMG/M
3300009181	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG	Environmental	Open in IMG/M
3300009184	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG	Environmental	Open in IMG/M
3300009502	Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG	Environmental	Open in IMG/M
3300009684	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG	Environmental	Open in IMG/M
3300010160	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG	Environmental	Open in IMG/M
3300010334	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010370	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300011995	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m	Environmental	Open in IMG/M
3300012017	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m	Environmental	Open in IMG/M
3300012665	Freshwater microbial communities from Talbot River, Ontario, Canada - S11	Environmental	Open in IMG/M
3300013285	Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300017754	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017778	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020162	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1	Environmental	Open in IMG/M
3300021131	Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnion	Environmental	Open in IMG/M
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental	Open in IMG/M
3300022555	Alinen_combined assembly	Environmental	Open in IMG/M
3300022752	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027697	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)	Environmental	Open in IMG/M
3300027708	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027712	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027733	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027741	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027752	Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)	Environmental	Open in IMG/M
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027797	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)	Environmental	Open in IMG/M
3300027805	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)	Environmental	Open in IMG/M
3300027963	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300028394	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2)	Environmental	Open in IMG/M
3300031784	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300033816	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005	Environmental	Open in IMG/M
3300033978	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002	Environmental	Open in IMG/M
3300034063	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24766J26685_100391753	3300002161	Freshwater And Sediment	MIPWYKKLLYIVIAPFIIGAWCIMNPRRVWDQAKKDFGVEE*
JGI24766J26685_100692534	3300002161	Freshwater And Sediment	NDIAPHMELKMIPWYRRLLYILVAPFIIGAWCIMNPRKVWEQAKKDFGVE*
B570J40625_10001957239	3300002835	Freshwater	MMPWYKKLLYILIAPFIIGAWCIMNPRKVWEQAKKDFGVE*
B570J40625_1004854093	3300002835	Freshwater	MPWYKNLLYILIAPFIIGAWCVMNPRKVWEQAKKDFGVE*
B570J40625_1010550722	3300002835	Freshwater	MIMPWYKKLLYILIAPFIIGAWCIVNPRKVWEQAKKDFGVE*
JGI25908J49247_100513395	3300003277	Freshwater Lake	MISGYKKLVYIFIAPFVIGAWCVMNPRKVWEQAKKDFGVEL*
Ga0065177_10365861	3300004685	Freshwater	MIPKYKIVLYILIAPFVIGAWCIMNPRKVWEQAKKDFGVEE*
Ga0049083_102218472	3300005580	Freshwater Lentic	MMPWYKKLLLMIIAPFIIGAWCIMNPRKVWEQAKKDFGVEL*
Ga0049081_1000154010	3300005581	Freshwater Lentic	MPWYKKLLYILIAPFIIGVWCIMNPRTVWEQAKKDFGFEK*
Ga0049081_102871342	3300005581	Freshwater Lentic	MIPWYKKLLYIVIAPFIIGAWCIMNPRRVWDQAKKDFGVKE*
Ga0049080_1000498511	3300005582	Freshwater Lentic	MMPWYKKLLYILIAPFIIGVWCIMNPRTVWEQAKKDFGFEK*
Ga0049080_102256251	3300005582	Freshwater Lentic	MMPWYKKLLYILLAPFIIGAWCIMNPGKVWEQAKKDFGVEE*
Ga0078894_100046309	3300005662	Freshwater Lake	MMPWHKKLLLIIIAPFVIGAWCIMNPRRVWEQAKKDFGVEL*
Ga0078894_109913833	3300005662	Freshwater Lake	MMPWYKKIGYLAIAPFIIGAWCVINPKKVWEQAKKDLLRK*
Ga0079957_10213695	3300005805	Lake	MIPWYRKLVYVLIAPFIIVLWCIMNPGKVWEQAKKDFGVE*
Ga0075470_102209312	3300006030	Aqueous	MIPWYRKLVYIVIAPFIIGAWCIMNPRRVWEQAKKDFGVEE*
Ga0007810_11103593	3300006101	Freshwater	MMPWYKKLLYIIIAPFIIGAWCLMNPRKVWEQAKKDFGVE*
Ga0070744_100638893	3300006484	Estuarine	MPWYKKLLLIIIAPFVIGAWCIMNPRRVWEQAKKDFGVEL*
Ga0102976_10083863	3300007169	Freshwater Lake	MNIPWYRKVLYLFIAPFIILAFCILNPRKVYEQAKKDFGVE*
Ga0103958_10042123	3300007212	Freshwater Lake	MNIPWYRKVLYFFIAPFIILAFCILNPRKVYEQAKKDFGVE*
Ga0103959_11734045	3300007214	Freshwater Lake	MNIPWYRKVLYLFIAPFIILAFCILNPRKVWEQAKKDFG
Ga0103961_13254584	3300007216	Freshwater Lake	MNIPWYRKVLYLFIAPFIILAFCILNPRKVWEQAKKDFGVE*
Ga0114343_11581921	3300008110	Freshwater, Plankton	MTPWYKKLLLIIIAPVVIGAWCIMNPRKVWEQAKKDFGVKE*
Ga0114346_11081563	3300008113	Freshwater, Plankton	MIMPWYKKLLLIIIAPFVIGAWCIMNPWKLWEQAKKDFGVKE*
Ga0114346_12475602	3300008113	Freshwater, Plankton	MMPWYKKIGYLAIAPFIIGAWCVMNPKKVWEQAKKDLLRK*
Ga0114962_1000044342	3300009151	Freshwater Lake	MIPWYKKLLLMIIAPFIIGAWCVMNPRKVWVQAKKDFGVKE*
Ga0114962_100350875	3300009151	Freshwater Lake	MIPWYKKLVYILIAPFVIGAWCVMNPRKVWEQAKKDFGVEE*
Ga0114980_103410031	3300009152	Freshwater Lake	MMPWYKKLLLMIIAPFIIGAWCIMNPRKVWEQAKKDFGVEE*
Ga0114968_1000922611	3300009155	Freshwater Lake	MPWYKKLLLLLIAPFIIGAWCVMNPRRVWEQAKKDFGVE*
Ga0114968_106929282	3300009155	Freshwater Lake	MMPWYKKLFLMIIAPFIIGAWCIMNPRKVWAQAKKDFGVEE*
Ga0114977_101108063	3300009158	Freshwater Lake	MMPWYKKLLLIIIAPFIIGAWCVMNPRKVWEQAKKDFGVTE*
Ga0114978_101403792	3300009159	Freshwater Lake	MMTWYKKLLFMIIAPFIIGAWCIMNPRKVWEQAKKDFGVEEN*
Ga0114978_103315262	3300009159	Freshwater Lake	MSWYKKLLLIIIAPFVIGAWCIMNPRKVWEQAKKDFGVTE*
Ga0114978_107199062	3300009159	Freshwater Lake	MLPLYRKVLLIIVAPFIIGAWCIMNPRKVWEQAKKDYKL*
Ga0114978_107531431	3300009159	Freshwater Lake	MPWHKKLLLIIIAPFIIGAWCVMNPRKVWEQAKKDFGVTE*
Ga0114966_100260253	3300009161	Freshwater Lake	MMPWYKKLLLMIIAPFIIGAWCIMNPRKVWEQAKKHFGDKE*
Ga0114966_100552844	3300009161	Freshwater Lake	MMPWYKKLFLMIIAPFIIGAWCIMNPRKVWAQAKKDFGVK*
Ga0114966_102941624	3300009161	Freshwater Lake	MMPWYKKLFLMIIAPFIIGAWCIMNPRRVWDQAKKDFGVKE*
Ga0114975_103003922	3300009164	Freshwater Lake	MTPWYKKLVYILLAPFVIGAWCVMNPRKVWEQAKKDFGVE*
Ga0114995_100815426	3300009172	Marine	MIPWYNKLLLMIIAPFIIGAWCIMNPRKVWEQAKKDFGVEE*
Ga0114969_101537205	3300009181	Freshwater Lake	MMPWYKKLLLIIIAPFIIGAWCIMNPSKVWKQAKKDFGVEE*
Ga0114976_105906232	3300009184	Freshwater Lake	MMTWYKKLLFMIIAPFIIGAWCIMNPRKVWEQAKKDFGVTE*
Ga0114951_103623604	3300009502	Freshwater	MMPWYKKLLLLLIAPFVIGAWCIMNPRRVWEQAKK
Ga0114958_102296854	3300009684	Freshwater Lake	MIPWYKRLVYILIAPFVIGAWCVMNPRKVWEQAKKDFGVEE*
Ga0114967_103420481	3300010160	Freshwater Lake	RMMPWYKKLLLMIIAPFIIGAWCIMNPRKVWEQAKKDFGVEE*
Ga0136644_106922322	3300010334	Freshwater Lake	MIRKYRIILYILIAPFIIGAWCVMNPRKVWEQAKKDFGVEE*
Ga0129333_1002022413	3300010354	Freshwater To Marine Saline Gradient	MIPWYKKLLYILIAPFIIVLWCVMNPGKVWQQAKKDFGVE*
Ga0129333_104773351	3300010354	Freshwater To Marine Saline Gradient	MIPWYRKLVYILIAPFIIVLWCIMNPGKVWEQAKKD
Ga0129333_112840992	3300010354	Freshwater To Marine Saline Gradient	MMNIPWYRKVLYLFIAPFIILAFCILNPRKVWEQAKKDFGVE*
Ga0129333_116645393	3300010354	Freshwater To Marine Saline Gradient	MIMPWYKKLLLIIIAPFVIGAWCIMNPWKLWEQAKKDFG
Ga0129336_105001843	3300010370	Freshwater To Marine Saline Gradient	MNIPWYRKVLYLFIAPFIILAFCILNPRKVWEQAKKDFGVE
Ga0133913_102493364	3300010885	Freshwater Lake	MMPWYKKLLLIIIAPFVIGAWCVMNPRRVWEQAKKDFGVEL*
Ga0133913_102560852	3300010885	Freshwater Lake	MPWYKKLLLMIIAPFVIGAWCIMNPRKVWEQAKKDFGVEE*
Ga0133913_102606318	3300010885	Freshwater Lake	PWYKKLVYILIAPFVIGAWCVMNPRKVWEQAKKDFGVEE*
Ga0133913_116583212	3300010885	Freshwater Lake	MIRKYRIILYILIAPFIIGAWCVMNPRKVWEQAKKDFGVE*
Ga0133913_118938192	3300010885	Freshwater Lake	MMTDKLRGYKKLVFMIIAPFIIGAWCVMNPRKVWEQAKKDFGVKE*
Ga0153800_10173523	3300011995	Freshwater	MIPWYKKLLYIVIAPFIIGAWCIMNPRKVWEQAKKDFGVEE*
Ga0153801_10113121	3300012017	Freshwater	MIMPWYKNLLYILIAPFIIGAWCIMNPRKVWEQAKK
Ga0157210_10323293	3300012665	Freshwater	MMPWYKKLLLMIIAPFIIGAWCIMNPRKVWEQAKKDFGVKE*
Ga0136642_10666943	3300013285	Freshwater	MMPWYKKLLYIFIAPFIIGAWCIMNPRRVWEQAKKDFGVEE*
Ga0136642_10925953	3300013285	Freshwater	MMPWYKKLLYIFIAPFIIGAWCIMNPRRVWEQAKKDFGVKE*
Ga0177922_101359003	3300013372	Freshwater	MMPWYRKVLLIIVAPFIIGAWCIMNPRKVWEQAKKDYNL*
Ga0177922_105399862	3300013372	Freshwater	MLPLYRKVLLIIVAPFIIGAWCIMNPRKVWEQAKKDYNI*
Ga0181344_10649762	3300017754	Freshwater Lake	MMPWYKKIGYLAIAPFIIGAWCVMNPKKVWEQAKKDLLRK
Ga0181344_11538142	3300017754	Freshwater Lake	YKKIGYLAIAPFIIGAWCVMNPKKVWEQAKKDLLRK
Ga0181356_11589973	3300017761	Freshwater Lake	MISGYKKLVYIFIAPFVIGAWCVMNPRKVWEQAKKDFGVEL
Ga0181357_13304232	3300017777	Freshwater Lake	MISGYKKLVYIFIAPFVIGAWCVMNPRKVWEQAKKDFGVEE
Ga0181349_10727942	3300017778	Freshwater Lake	MMPWYKKLFIMIIAPFIIGAWCIMNPRRVWAQAKKDFGVKE
Ga0211732_15984533	3300020141	Freshwater	MPWYKKLFIIIIAPFVIGAWCIMNPRKVWEQAKKDFGVEE
Ga0211726_104284301	3300020161	Freshwater	MPWYKKLLLMIIAPFIIGAWCVMNPRKVWVQAKKDFGVKE
Ga0211726_106699103	3300020161	Freshwater	MPWYRKLLLVVIAPFVIGAWCVMNPRLVWQQAKKDFGLEE
Ga0211735_114746352	3300020162	Freshwater	MTPWYKKLLLIIIAPVVIGAWCIMNPRKVWEQAKKDFGVEE
Ga0214206_10042137	3300021131	Freshwater	MMPWYKKLLYIIIAPFIIGAWCLMNPRKVWEQAKKDFGVEE
Ga0181353_10415373	3300022179	Freshwater Lake	MSWYKKLLYILIAPFIIGTWCVMNPRKVWEQAKKDFGVEE
Ga0181353_10489402	3300022179	Freshwater Lake	MSWYKKLLYILIAPFIIGTWCVMNPRKVWEQAKKDFGVEQ
Ga0181353_10799022	3300022179	Freshwater Lake	MSDKLREYKKLLFMIIAPFIIGAWCVMNPRKVWEQAKKDWG
Ga0212088_103521583	3300022555	Freshwater Lake Hypolimnion	MMPWYKKLLLLLIAPFVIGAWCIMNPRRVWEQAKKDFGVEE
Ga0214917_1001376214	3300022752	Freshwater	MMPWYKKLLLMIIAPFIIGAWCIMNPRKVWEQAKKDFGVEQ
Ga0244775_101281972	3300024346	Estuarine	MNIPWYRKILYIIIAPVIIGAWMISNPRKVWEQAKKEWNIK
Ga0244775_107409123	3300024346	Estuarine	MPWYKKLLLIIIAPFVIGAWCIMNPRRVWEQAKKDFGVEL
Ga0208974_10003384	3300027608	Freshwater Lentic	MIPWYKKLLYIVIAPFIIGAWCIMNPRRVWDQAKKDFGVKE
Ga0209033_10045473	3300027697	Freshwater Lake	MMPWYRKVLLIILAPFIIGAWCIMNPRKVWEQAKKDYNL
Ga0209188_12290734	3300027708	Freshwater Lake	MIPWYKKLVYILIAPFVIGAWCVMNPRKVWEQAKKDFGV
Ga0209499_10898584	3300027712	Freshwater Lake	MIPWYKKLVYILIAPFVIGAWCVMNPRKVWEQAKKDFGVEE
Ga0209297_13599162	3300027733	Freshwater Lake	MMPWYKKLLLIIIAPFIIGAWCVMNPRKVWEQAKKDFGVTE
Ga0209085_100028622	3300027741	Freshwater Lake	MIPWYKKLLLMIIAPFIIGAWCVMNPRKVWVQAKKDFGVKE
Ga0209192_101335474	3300027752	Marine	MIPWYNKLLLMIIAPFIIGAWCIMNPRKVWEQAKKDFGVEE
Ga0209596_1000019226	3300027754	Freshwater Lake	MMPWYKKLLLMIIAPFIIGAWCIMNPRKVWEQAKKHFGDKE
Ga0209596_10948025	3300027754	Freshwater Lake	MMPWYKKLLLIIIAPFIIGAWCIMNPSKVWKQAKKDFGVEE
Ga0209296_10113582	3300027759	Freshwater Lake	MMPWYKKLLLIIIAPFVIGAWCVMNPRRVWEQAKKDFGVEL
Ga0209296_11152862	3300027759	Freshwater Lake	MPWHKKLLLIIIAPFIIGAWCVMNPRKVWEQAKKDFGVTE
Ga0209500_100452063	3300027782	Freshwater Lake	MMTWYKKLLFMIIAPFIIGAWCIMNPRKVWEQAKKDFGVEEN
Ga0209500_102349392	3300027782	Freshwater Lake	MSWYKKLLLIIIAPFVIGAWCIMNPRKVWEQAKKDFGVTE
Ga0209107_101330642	3300027797	Freshwater And Sediment	MIPWYKKLLYIVIAPFIIGAWCIMNPRKVWEQAKKDFGVEE
Ga0209107_102433574	3300027797	Freshwater And Sediment	MMPWYKKLLLMIIAPFIIGAWCIMNPRRVWDQAKKDFGVKE
Ga0209229_101403123	3300027805	Freshwater And Sediment	MIRKLLYLIIAPFVIGAWCVMNPRKVWEQAKKEYGIEE
Ga0209229_101807082	3300027805	Freshwater And Sediment	MMPWYKKLLLIIIAPFVIGAWCIMNPRKVWEQAKKDFGVKL
Ga0209229_103402092	3300027805	Freshwater And Sediment	MIPWYKKLLYIVIAPFIIGAWCIMNPRRVWDQAKKDFGVEE
Ga0209400_10219212	3300027963	Freshwater Lake	MPWYKKLLLLLIAPFIIGAWCVMNPRRVWEQAKKDFGVE
Ga0304730_12033281	3300028394	Freshwater Lake	PWYKKLLLMIIAPFIIGAWCIMNPRKVWEQAKKDFGVEE
Ga0315899_111624442	3300031784	Freshwater	MTPWYKKLLLIIIAPVVIGAWCIMNPRKVWEQAKKDFGVKE
Ga0315909_108896671	3300031857	Freshwater	MIPLYRKLLYILIAPFIIVLWCVMNPGKVWEQAKKDC
Ga0334980_0020249_1259_1384	3300033816	Freshwater	MIMPWYKNLLYILIAPFIIGAWCVMNPRKVWEQAKKDFGFE
Ga0334977_0001049_7611_7736	3300033978	Freshwater	MPWYKNLLYILIAPFIIGAWCIMNPRKVWEQAKKDFGINNE
Ga0335000_0200432_291_413	3300034063	Freshwater	MMPWYKNLLYILIAPFIIGAWCVMNPRKVWEQAKKDFGVE
Ga0335036_0003714_7044_7163	3300034106	Freshwater	MPWYKKLLYILIAPFIIGAWCIVNPRKVWEQAKKDFGVE
Ga0335036_0142221_304_423	3300034106	Freshwater	MPWYKNLLYILIAPFIIGAWCVMNPRKVWEQAKKDFGFE

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F092043

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences