Basic Information | |
---|---|
Family ID | F092012 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 107 |
Average Sequence Length | 44 residues |
Representative Sequence | MPRLRTIAIAAVVVVVTDVTWDGTSLHISFGWPGRKPLASFVFP |
Number of Associated Samples | 86 |
Number of Associated Scaffolds | 107 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 48.60 % |
% of genes near scaffold ends (potentially truncated) | 23.36 % |
% of genes from short scaffolds (< 2000 bps) | 89.72 % |
Associated GOLD sequencing projects | 79 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (58.879 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.888 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.234 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.794 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.06% β-sheet: 20.83% Coil/Unstructured: 61.11% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 107 Family Scaffolds |
---|---|---|
PF01042 | Ribonuc_L-PSP | 5.61 |
PF10988 | DUF2807 | 3.74 |
PF00196 | GerE | 2.80 |
PF04828 | GFA | 2.80 |
PF00768 | Peptidase_S11 | 2.80 |
PF12840 | HTH_20 | 2.80 |
PF00583 | Acetyltransf_1 | 1.87 |
PF07992 | Pyr_redox_2 | 1.87 |
PF01391 | Collagen | 1.87 |
PF00378 | ECH_1 | 0.93 |
PF13796 | Sensor | 0.93 |
PF01381 | HTH_3 | 0.93 |
PF03631 | Virul_fac_BrkB | 0.93 |
PF12681 | Glyoxalase_2 | 0.93 |
PF00999 | Na_H_Exchanger | 0.93 |
PF01613 | Flavin_Reduct | 0.93 |
PF00753 | Lactamase_B | 0.93 |
PF02518 | HATPase_c | 0.93 |
PF02687 | FtsX | 0.93 |
PF08240 | ADH_N | 0.93 |
PF06351 | Allene_ox_cyc | 0.93 |
PF01039 | Carboxyl_trans | 0.93 |
PF03734 | YkuD | 0.93 |
PF00211 | Guanylate_cyc | 0.93 |
PF13385 | Laminin_G_3 | 0.93 |
PF01435 | Peptidase_M48 | 0.93 |
PF13559 | DUF4129 | 0.93 |
PF00561 | Abhydrolase_1 | 0.93 |
PF08486 | SpoIID | 0.93 |
PF04542 | Sigma70_r2 | 0.93 |
PF00127 | Copper-bind | 0.93 |
PF04075 | F420H2_quin_red | 0.93 |
PF01168 | Ala_racemase_N | 0.93 |
PF00756 | Esterase | 0.93 |
PF00294 | PfkB | 0.93 |
PF02585 | PIG-L | 0.93 |
PF12847 | Methyltransf_18 | 0.93 |
COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
---|---|---|---|
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 5.61 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 2.80 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 2.80 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.93 |
COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.93 |
COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.93 |
COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.93 |
COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.93 |
COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.93 |
COG2385 | Peptidoglycan hydrolase (amidase) enhancer domain SpoIID | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.93 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.93 |
COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.93 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.93 |
COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.93 |
COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.93 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.93 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.93 |
COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.93 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.93 |
COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.93 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 58.88 % |
Unclassified | root | N/A | 41.12 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559005|cont_contig02944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2350 | Open in IMG/M |
2170459003|FZN2CUW02G0JZR | Not Available | 508 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101691267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1176 | Open in IMG/M |
3300000956|JGI10216J12902_109883761 | Not Available | 609 | Open in IMG/M |
3300000956|JGI10216J12902_112067772 | Not Available | 627 | Open in IMG/M |
3300002568|C688J35102_117989324 | Not Available | 521 | Open in IMG/M |
3300002568|C688J35102_120284192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 967 | Open in IMG/M |
3300002568|C688J35102_120760563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1506 | Open in IMG/M |
3300004081|Ga0063454_100386485 | Not Available | 928 | Open in IMG/M |
3300004157|Ga0062590_101207806 | Not Available | 738 | Open in IMG/M |
3300004463|Ga0063356_100674126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1416 | Open in IMG/M |
3300005093|Ga0062594_103207323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 513 | Open in IMG/M |
3300005329|Ga0070683_100875681 | Not Available | 861 | Open in IMG/M |
3300005332|Ga0066388_106110274 | Not Available | 608 | Open in IMG/M |
3300005338|Ga0068868_100221775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1583 | Open in IMG/M |
3300005338|Ga0068868_101084837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 736 | Open in IMG/M |
3300005355|Ga0070671_100287039 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
3300005434|Ga0070709_11606024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
3300005436|Ga0070713_101247599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 720 | Open in IMG/M |
3300005437|Ga0070710_10588773 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300005456|Ga0070678_101697266 | Not Available | 594 | Open in IMG/M |
3300005564|Ga0070664_100989753 | Not Available | 790 | Open in IMG/M |
3300005764|Ga0066903_100267821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Couchioplanes → Couchioplanes caeruleus | 2661 | Open in IMG/M |
3300005764|Ga0066903_100597662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1911 | Open in IMG/M |
3300005764|Ga0066903_101194026 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1412 | Open in IMG/M |
3300005764|Ga0066903_105354114 | Not Available | 678 | Open in IMG/M |
3300005841|Ga0068863_101226247 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300005842|Ga0068858_101865034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
3300006028|Ga0070717_11741222 | Not Available | 564 | Open in IMG/M |
3300006032|Ga0066696_10508357 | Not Available | 790 | Open in IMG/M |
3300006573|Ga0074055_11266555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1023 | Open in IMG/M |
3300006854|Ga0075425_100096169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3362 | Open in IMG/M |
3300006871|Ga0075434_100072762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3429 | Open in IMG/M |
3300006903|Ga0075426_10171246 | Not Available | 1570 | Open in IMG/M |
3300006904|Ga0075424_100455803 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
3300009098|Ga0105245_10049654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3758 | Open in IMG/M |
3300009098|Ga0105245_11852658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 656 | Open in IMG/M |
3300009120|Ga0117941_1059663 | Not Available | 1024 | Open in IMG/M |
3300009148|Ga0105243_11592632 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 679 | Open in IMG/M |
3300009162|Ga0075423_11374113 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
3300009176|Ga0105242_10963570 | Not Available | 858 | Open in IMG/M |
3300009551|Ga0105238_11984864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 615 | Open in IMG/M |
3300009789|Ga0126307_10005643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8775 | Open in IMG/M |
3300009789|Ga0126307_10030246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 4160 | Open in IMG/M |
3300010037|Ga0126304_10704624 | Not Available | 682 | Open in IMG/M |
3300010042|Ga0126314_10356199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Chelatococcaceae → Chelatococcus → Chelatococcus reniformis | 1050 | Open in IMG/M |
3300010360|Ga0126372_10153687 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
3300010376|Ga0126381_101722780 | Not Available | 905 | Open in IMG/M |
3300010376|Ga0126381_104279684 | Not Available | 553 | Open in IMG/M |
3300012203|Ga0137399_10919765 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300012212|Ga0150985_109977437 | All Organisms → cellular organisms → Bacteria → Elusimicrobia → Elusimicrobia | 1256 | Open in IMG/M |
3300012496|Ga0157353_1050399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
3300012951|Ga0164300_10377570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
3300012955|Ga0164298_10587923 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300012955|Ga0164298_10774477 | Not Available | 683 | Open in IMG/M |
3300012957|Ga0164303_10261318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 998 | Open in IMG/M |
3300012958|Ga0164299_10070074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1719 | Open in IMG/M |
3300012958|Ga0164299_11195977 | Not Available | 575 | Open in IMG/M |
3300012960|Ga0164301_10355216 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
3300012961|Ga0164302_11177599 | Not Available | 611 | Open in IMG/M |
3300012977|Ga0134087_10434677 | Not Available | 647 | Open in IMG/M |
3300012985|Ga0164308_10128139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1837 | Open in IMG/M |
3300012986|Ga0164304_11585983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
3300012989|Ga0164305_10178322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1472 | Open in IMG/M |
3300012989|Ga0164305_11758902 | Not Available | 558 | Open in IMG/M |
3300013297|Ga0157378_10482505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1235 | Open in IMG/M |
3300013297|Ga0157378_12475015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 571 | Open in IMG/M |
3300013770|Ga0120123_1008263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1977 | Open in IMG/M |
3300014498|Ga0182019_10895325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
3300015371|Ga0132258_10981608 | All Organisms → cellular organisms → Bacteria | 2134 | Open in IMG/M |
3300015371|Ga0132258_11190589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1926 | Open in IMG/M |
3300015371|Ga0132258_11301466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1837 | Open in IMG/M |
3300015371|Ga0132258_11508909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1697 | Open in IMG/M |
3300015371|Ga0132258_12005373 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
3300015371|Ga0132258_13141751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1141 | Open in IMG/M |
3300015373|Ga0132257_103485885 | Not Available | 572 | Open in IMG/M |
3300015374|Ga0132255_103599936 | Not Available | 659 | Open in IMG/M |
3300017792|Ga0163161_10748039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
3300018422|Ga0190265_11657309 | Not Available | 750 | Open in IMG/M |
3300018469|Ga0190270_10166835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1814 | Open in IMG/M |
3300018476|Ga0190274_10053659 | Not Available | 2934 | Open in IMG/M |
3300021560|Ga0126371_11164374 | Not Available | 909 | Open in IMG/M |
3300021560|Ga0126371_12421063 | Not Available | 635 | Open in IMG/M |
3300024323|Ga0247666_1004425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3145 | Open in IMG/M |
3300025909|Ga0207705_10916364 | Not Available | 679 | Open in IMG/M |
3300025927|Ga0207687_10831081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 789 | Open in IMG/M |
3300025929|Ga0207664_11994450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
3300025931|Ga0207644_10231036 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
3300025935|Ga0207709_10993861 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 685 | Open in IMG/M |
3300025944|Ga0207661_10475119 | Not Available | 1141 | Open in IMG/M |
3300026035|Ga0207703_12303165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
3300028755|Ga0307316_10022203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2033 | Open in IMG/M |
3300029987|Ga0311334_11933068 | Not Available | 505 | Open in IMG/M |
3300030294|Ga0311349_10503770 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
3300031232|Ga0302323_101823527 | Not Available | 689 | Open in IMG/M |
3300031366|Ga0307506_10406882 | Not Available | 558 | Open in IMG/M |
3300031546|Ga0318538_10363237 | Not Available | 782 | Open in IMG/M |
3300031726|Ga0302321_102091749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 658 | Open in IMG/M |
3300031769|Ga0318526_10210962 | Not Available | 794 | Open in IMG/M |
3300031797|Ga0318550_10241503 | Not Available | 876 | Open in IMG/M |
3300031831|Ga0318564_10327007 | Not Available | 675 | Open in IMG/M |
3300031910|Ga0306923_10423050 | Not Available | 1514 | Open in IMG/M |
3300031939|Ga0308174_10857572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 765 | Open in IMG/M |
3300032001|Ga0306922_10442860 | Not Available | 1389 | Open in IMG/M |
3300032065|Ga0318513_10507819 | Not Available | 590 | Open in IMG/M |
3300032261|Ga0306920_101004223 | Not Available | 1215 | Open in IMG/M |
3300032261|Ga0306920_101927549 | Not Available | 830 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.89% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 7.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.61% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.67% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.67% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.74% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.74% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.87% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.87% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.87% |
Lake Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.93% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.93% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.93% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.93% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.93% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.93% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.93% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.93% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009120 | Lake sediment microbial communities from Tanners Lake, St. Paul, MN | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012496 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
cont_0944.00000260 | 2166559005 | Simulated | MPRLRTLAFVAAVVVLTDVTWDGTTLHVSFGWPGRKPIASFEFP |
E4A_02808100 | 2170459003 | Grass Soil | MARPRSLAIAAVVLVVVTDVTWDGKKLRVSFGWPGRKPIASFVFP |
INPhiseqgaiiFebDRAFT_1016912673 | 3300000364 | Soil | MPRLRTVVIIAVVVVVTDVTWDGTSLHISFGWPRRKPIASFVFP* |
JGI10216J12902_1098837611 | 3300000956 | Soil | MPRLRTIAIVAAVVVLCDVSWDGNSLHVSFGWPGRKRIVQFSFP* |
JGI10216J12902_1120677723 | 3300000956 | Soil | VPRLRTIAVVAVIVVVVTDVTWDGASLRISVGWPGRRRIAQFVFP* |
C688J35102_1179893241 | 3300002568 | Soil | MPRLRTVAVAVVVVVMTDVTWDGTSLRISIGWPGRRPLASFVVP* |
C688J35102_1202841922 | 3300002568 | Soil | MIGSMPRLRTIAIAAVVVVVTDVTWDGTSLRISVGWPGRKPVASVVFP* |
C688J35102_1207605633 | 3300002568 | Soil | MPRFRTIAVAVAIVVITDVTWDGTSLHISIGWPRRKPIASFVFP* |
Ga0063454_1003864853 | 3300004081 | Soil | MLRLRTVAVAVVVVAMTDVTWDGTSLRISIGWPGRKPIASFAFP* |
Ga0062590_1012078061 | 3300004157 | Soil | MPRLRTIAIAAVAIVVTDVTWDGTSLRISFGWPGRRPIASFVFP* |
Ga0063356_1006741262 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MPRLRTIAILAVIVVVTDVTWDGTSLHISFGWPGRRRIVHFVFP* |
Ga0062594_1032073232 | 3300005093 | Soil | MPRLRTIAIAAVVVVVVTDVTWDGTSLHISFGWPGRKPIASFLFP* |
Ga0070683_1008756811 | 3300005329 | Corn Rhizosphere | MPRLRTIVIVAAVIAATDVTWDGASLRISFGWPGRKPIASFVFP* |
Ga0066388_1061102741 | 3300005332 | Tropical Forest Soil | MPRLRTIAIVAAIVVVTDVTWDGTSLHVSFGWPGRRRIVRFVFP* |
Ga0068868_1002217751 | 3300005338 | Miscanthus Rhizosphere | PATCEDPIMPRLRTIVIVAAVIAATDVTWDGASLRISFGWPGRKPIASFVFP* |
Ga0068868_1010848372 | 3300005338 | Miscanthus Rhizosphere | MPRFRTIALAALVVVVTDVTWDGTSLHVSFGMPRRKPLVSLVFP* |
Ga0070671_1002870393 | 3300005355 | Switchgrass Rhizosphere | MPRLRTIAIAAAVIVVTDVTWDGTSLHISFGWPGRKPLASLVFP* |
Ga0070709_116060242 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRLRTIAIVAVVAVVVTDVTWDDTSLRISIGWPGRKRIVQLAFP* |
Ga0070713_1012475992 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRLRTLVILAVVVVVTDVTWDGTSLHISFGWPRRKPIASFVFP* |
Ga0070710_105887732 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VPRLRTIAIVAVVAVVVTDVTWDDTSLRISIGWPGRKPIIRFAFP* |
Ga0070678_1016972662 | 3300005456 | Miscanthus Rhizosphere | MPRRRTIAIAAVLAVVVTDVTWDGTSLRISIGWPGRRPIASFVFP* |
Ga0070664_1009897532 | 3300005564 | Corn Rhizosphere | MPRLRTIVIVAAVIAATDVTWDGASLHISFGWPGRKPIASFVFP* |
Ga0066903_1002678212 | 3300005764 | Tropical Forest Soil | VVGAVVVLVVTDITWDGTSLRISFGWPGRKPIVSFVFP* |
Ga0066903_1005976623 | 3300005764 | Tropical Forest Soil | VVGAVVVLVVTDVTWDGTSLRISFGWPGRKPILSFVFP* |
Ga0066903_1011940262 | 3300005764 | Tropical Forest Soil | TDKIVSVPRLRTVAVATVVFLVITDVTWNGSSLSISFGWPGRRPIASFVFP* |
Ga0066903_1053541141 | 3300005764 | Tropical Forest Soil | VPRLRTVAVVAAVVVVVTDVTWDGTSLRVSFGWPGRKPLASFAFPSR |
Ga0068863_1012262471 | 3300005841 | Switchgrass Rhizosphere | MPRLRTIAIAAAVIVVTDVTWDGTSLHLSFGLPRRKPLVSLVFP* |
Ga0068858_1018650342 | 3300005842 | Switchgrass Rhizosphere | MLARVDPNCEDHPNMPRLRTIAVAAVIVVVVTDVTWDGTSLHISFGWPGRRRLASFVFP* |
Ga0070717_117412221 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VPRVRTIAIVAAVVVLTDVTWDGTSLRVSFGWPKRKPVLSLVFP* |
Ga0066696_105083572 | 3300006032 | Soil | MPRLGTIAIAVVVVVVTDVTWDGTSLVISFGWPGRKPIASFVFP* |
Ga0074055_112665552 | 3300006573 | Soil | VIAAVVVAVTDVTWDDTSLRISFGWPGRKPLVSFVFP* |
Ga0075425_1000961693 | 3300006854 | Populus Rhizosphere | MVVAAVVVVITDVTWDGTSLRISFGLPRRKPIASFVFP* |
Ga0075434_1000727624 | 3300006871 | Populus Rhizosphere | MVVAAVVVVITDVTWDGTSLRISFGLPRRKPIASFAFP* |
Ga0075426_101712461 | 3300006903 | Populus Rhizosphere | IAAVVIVITDVTWDGTSLHISLGWPGRRRLVRLVIP* |
Ga0075424_1004558033 | 3300006904 | Populus Rhizosphere | VPRLRTLAIAAVVIVITDVTWDGTSLHISLGWPGRRRLVRLVIP* |
Ga0105245_100496541 | 3300009098 | Miscanthus Rhizosphere | APAPPTCEDPIMPRLRTIVIVAAVIAATDVTWDGASLHISFGWPGRKPIASFVFP* |
Ga0105245_118526581 | 3300009098 | Miscanthus Rhizosphere | MPRFRTIALAALVVVVSDVTWDGTSLHVSFGLPRRKPLVSLVFP* |
Ga0117941_10596631 | 3300009120 | Lake Sediment | MPRLRTVVLAAVVVVVTDVTWDGKVLTVSFGWPGRKPLASFVLP* |
Ga0105243_115926322 | 3300009148 | Miscanthus Rhizosphere | MPRIRTIAIPAVVILVTDVTWDVTSLRISIGWPGRRPIASFVLP* |
Ga0075423_113741131 | 3300009162 | Populus Rhizosphere | VPRLRTLVIAAVVIVITDVTWDGTSLHISLGWPGRRRL |
Ga0105242_109635701 | 3300009176 | Miscanthus Rhizosphere | MPRLRTVAILAVVLVVTDVTWDGTSLRISFGWPRRKP |
Ga0105238_119848642 | 3300009551 | Corn Rhizosphere | GPEASSMPRRRTIAIAAVLAVVVTDVTWDGTSLRISIGWPGRRPIASFMFP* |
Ga0126307_100056432 | 3300009789 | Serpentine Soil | MIAIAAVVVVVTDVTWDGKSLRISVGWPGRRPIASFLFP* |
Ga0126307_100302467 | 3300009789 | Serpentine Soil | VPRLRTLALVALVIVVTDVTWDGTSLHISFGWPGRRPLASFVFP* |
Ga0126304_107046242 | 3300010037 | Serpentine Soil | VIAAVVVVMTDVTWDGTSLHVSFGWPRRKRLIQFVIP* |
Ga0126314_103561991 | 3300010042 | Serpentine Soil | VIAAVVVVMTDVTWDGTSLHVSFGWPRRKRLVQFVIP* |
Ga0126372_101536873 | 3300010360 | Tropical Forest Soil | VVVLVVTDVTWDGTSLRISFGWPGRKPILSFVFP* |
Ga0126381_1017227803 | 3300010376 | Tropical Forest Soil | MPRLRTIAVAVVVIVVTDVTWDDGSLRISFGWPGRKPI |
Ga0126381_1042796842 | 3300010376 | Tropical Forest Soil | MPRLGTFAIAAAVVVLTDVTWDGTSLTIAFGWPGRRPLATVVFP* |
Ga0137399_109197652 | 3300012203 | Vadose Zone Soil | MPRLCTIAIAAMVVVVTDVTWDGTSLRISLGWPGRKPIASFVFP* |
Ga0150985_1099774372 | 3300012212 | Avena Fatua Rhizosphere | MLRLRTVAVAVVVVAVTDVTWDGTSLRISIGWPGRKPIVSFAFP* |
Ga0157353_10503992 | 3300012496 | Unplanted Soil | MPRLRTIAIAAVVVVVTDVTWDGTSLRISFGWPGRRPVASFVFP* |
Ga0164300_103775702 | 3300012951 | Soil | MPRFRTIALAALVVVVTDVTWDGTSLHVSFGLPRRKPLVSLVFP* |
Ga0164298_105879231 | 3300012955 | Soil | IAIVAVLVVVTDVTWDGTSLHVSFGWPGRKPVASFVLP* |
Ga0164298_107744771 | 3300012955 | Soil | MPRLRTIALATLVNVVTDVTWDGTSLHISIGWPGRTPLASFVFP* |
Ga0164303_102613182 | 3300012957 | Soil | MPRLRTLVIAAVVVAVTDVTWDDTSLRISFGWPGRKPLVSFVFP* |
Ga0164299_100700744 | 3300012958 | Soil | MPRLRTIAIAAAVIVVTDVTWDGTSLHISFGWPGRKPLASFMFP* |
Ga0164299_111959772 | 3300012958 | Soil | MPRLRTIVIAAVVAVVVTDVTWDGTSLHISIGWPGRTPLASFVFP* |
Ga0164301_103552163 | 3300012960 | Soil | MPRLRTIAIAAAVIVVTDVTWDGTSLHISFGWPGRKPLASFVFP* |
Ga0164302_111775991 | 3300012961 | Soil | MPRFRTIALAALVVVVTDVTWDGTSLHGSFGLPRRKPLVSLVFP* |
Ga0134087_104346772 | 3300012977 | Grasslands Soil | MPRFRTIAVAVAIVVITDVTWDGTSLHISIGWPRRKPIASFVF |
Ga0164308_101281392 | 3300012985 | Soil | MPRLRTLVIAAVVVAVTDVTWDDTSLRISFGWPGRKPLVSFVFS* |
Ga0164304_115859831 | 3300012986 | Soil | LRTLVIAVVVVAVTDVTWDDTSLRISFGWPGRKPLVSFVFP* |
Ga0164305_101783222 | 3300012989 | Soil | MPRLRTIAIVAVVVVVTDVTWDGTSLHISVGWPGRRRIVQLVFP* |
Ga0164305_117589022 | 3300012989 | Soil | MPRLRTIALATLVIVVTDVTWDGTSLHISIGWPGRTPLASFVFP* |
Ga0157378_104825053 | 3300013297 | Miscanthus Rhizosphere | MPRLRTIVIGAIVVAVTDVTWDGTSLHVSFGWPGRKPIASFVFP* |
Ga0157378_124750152 | 3300013297 | Miscanthus Rhizosphere | MPRLRTILIAAVVVVVTDVTWDGTSLHVSFGWPGRKPVASFVLP* |
Ga0120123_10082631 | 3300013770 | Permafrost | MPRLRSIAIVAVVVVVVSDVTWDGTSLLISIGWPGRTPLASFVFP |
Ga0182019_108953251 | 3300014498 | Fen | MTSTASLRTIALAAVVVVVTDVTWDGTSLHISFGWPERRPIASFLFP* |
Ga0132258_109816083 | 3300015371 | Arabidopsis Rhizosphere | MPRLRTIAIAVVVVACTDVTWDGTSLHISFGLPKRKPIASFVFP* |
Ga0132258_111905894 | 3300015371 | Arabidopsis Rhizosphere | MPRPLRIAIALAVLVVVTDVTWDGTSLHISFGLPGRKRIASIRLP* |
Ga0132258_113014661 | 3300015371 | Arabidopsis Rhizosphere | KDPLRMPRLRTIAIAAVIVVLTDVTWDGASLHVSFGLPGRRRIASFVFP* |
Ga0132258_115089092 | 3300015371 | Arabidopsis Rhizosphere | MPRARIIAFAAVALVVVTDVTWDGTSLHVSFGWPGRKPLASFVFP* |
Ga0132258_120053733 | 3300015371 | Arabidopsis Rhizosphere | MPRLRTIAIAAVVVVVTDVTWDGTSLHISFGWPGRKPLASFVFP* |
Ga0132258_131417512 | 3300015371 | Arabidopsis Rhizosphere | VVLVVVTDVTWDGTSLHVSFGWPGRKPLASFVFP* |
Ga0132257_1034858851 | 3300015373 | Arabidopsis Rhizosphere | MPRLRTIAIAVVVVVCTDVTWDGTSLHISFGLPKRKPIASFVFP* |
Ga0132255_1035999362 | 3300015374 | Arabidopsis Rhizosphere | MPRLRTIAIAVVVVACTDVTWDGTSLHISFGLPKRKPLASFVFP* |
Ga0163161_107480393 | 3300017792 | Switchgrass Rhizosphere | AAVVVVVVTDVTWDGTSLRISIGWPGRTPIASFVFP |
Ga0190265_116573092 | 3300018422 | Soil | MPRLRTIAIVAVVVVLTDVTWDGTSLRISVGWPGRRRIVQIVFP |
Ga0190270_101668352 | 3300018469 | Soil | MPRFRTIAIVAVVVVLIDVTWDGTSLRISVGWPGRRRIVQIVFP |
Ga0190274_100536592 | 3300018476 | Soil | MPRLRTIAILAAIIVVTDVTWDGASLRISFGWPRRKPIASFVFP |
Ga0126371_111643742 | 3300021560 | Tropical Forest Soil | MPRLRTFVIAAAVVVLTDVTWDGTSLTIAFGWPGRKPLVTLVFP |
Ga0126371_124210631 | 3300021560 | Tropical Forest Soil | VIVVTDVTWDGASLRISFGWPGRKPIASLVFPSSGS |
Ga0247666_10044252 | 3300024323 | Soil | MPRLGMIAIAAMVVVVTDVTWDGMSLHISVGWPGRRPIASFVFP |
Ga0207705_109163642 | 3300025909 | Corn Rhizosphere | TIVIVAAVIAATDVTWDGASLHISFGWPGRKPIASFVFP |
Ga0207687_108310811 | 3300025927 | Miscanthus Rhizosphere | MPRLRTIVIVAAVIAATDVTWDGASLHISFGWPGRKPIASFVFP |
Ga0207664_119944501 | 3300025929 | Agricultural Soil | AEIRKDLGVPRLRTIAIVAAVAVVVTDVTWDDTSLRISIGWPGRKPIIRFAFP |
Ga0207644_102310362 | 3300025931 | Switchgrass Rhizosphere | MPRLRTIAIAAAVIVVTDVTWDGTSLHISFGWPGRKPLASLVFP |
Ga0207709_109938612 | 3300025935 | Miscanthus Rhizosphere | MPRIRTIAIPAVVILVTDVTWDVTSLRISIGWPGRRPIASFVLP |
Ga0207661_104751192 | 3300025944 | Corn Rhizosphere | MPRLRTIVIVAAFIAATDVTWDGASLRISFGWPGRKPIASFVFP |
Ga0207703_123031651 | 3300026035 | Switchgrass Rhizosphere | MLARVDPNCEDHPNMPRLRTIAVAAVIVVVVTDVTWDGTSLHISFGWPGRRRLASFVFP |
Ga0307316_100222032 | 3300028755 | Soil | VPRFRTVAVAAVVVLVITDVTWDGTSLRISFGWPRRKPIASFMFP |
Ga0311334_119330681 | 3300029987 | Fen | ASRQAPIRNMTNTASLRTIALAAVVVVVTDVTWDGTSLHISFGWPGRRPIASFVFP |
Ga0311349_105037702 | 3300030294 | Fen | MTNTASLRTIALAAVVVIVTDVTWDGTSLHISFGWPERRPIASFLFP |
Ga0302323_1018235272 | 3300031232 | Fen | LAAVVVVVTDVTWDGTSLHISFGWPGRRPIASFVFP |
Ga0307506_104068822 | 3300031366 | Soil | MPRLRTIAIAAAVIVVTDVTWDGTSLHISFGWPGRKPLASFMFP |
Ga0318538_103632372 | 3300031546 | Soil | MPRLRTFVIAAAVVVLTDVTWDGTSLTITFGWPGRKPLATVVLP |
Ga0302321_1020917492 | 3300031726 | Fen | MTNTASLRTIALAAVVVVVTDVTWDGTSLHISFGWPGRRPIASFVFP |
Ga0318526_102109621 | 3300031769 | Soil | MPRLRTFVIAAAVVVLSDVTWDGTSLTIAFGWPGRKPLATVVLP |
Ga0318550_102415033 | 3300031797 | Soil | MPRLRTFVIAAAVVVLTDVTWDGTSLTIAFGWPGRKPLATVV |
Ga0318564_103270071 | 3300031831 | Soil | AAAVVVLTDVTWDGTSLTIAFGWPGRKPLATVVLP |
Ga0306923_104230503 | 3300031910 | Soil | MPRLRTFVIAAAVVVLTDVTWDGTSLTIAFGWPGRKPLATVVLP |
Ga0308174_108575722 | 3300031939 | Soil | MPRLRTIAIAAVVIVVTDVTWDGTSLRVSVGWPGRRPLASFFLP |
Ga0306922_104428602 | 3300032001 | Soil | MPRLRTFVVAAAVVVLTDVTWDGTSLTITFGWPGRKPLATVVLP |
Ga0318513_105078192 | 3300032065 | Soil | LGMPRLRTFVIAAAVVVLTDVTWDGTSLTIAFGWPGRKPLATVVLP |
Ga0306920_1010042232 | 3300032261 | Soil | MVALVAVAVVVVTDVTWDGTSLRVSFGWPGRKPFASFVFP |
Ga0306920_1019275492 | 3300032261 | Soil | MPTHPRLRTLLIVLAVIVFTDVTWDGTSLRLSFGWPRRRPIVSFDFP |
⦗Top⦘ |