NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F091996

Metagenome / Metatranscriptome Family F091996

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091996
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 45 residues
Representative Sequence MFPSRAPFFRDRLNPRAAEIAAWAEENKRGNLPVSPFAPS
Number of Associated Samples 87
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 81.31 %
% of genes near scaffold ends (potentially truncated) 64.49 %
% of genes from short scaffolds (< 2000 bps) 69.16 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (84.112 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(30.841 % of family members)
Environment Ontology (ENVO) Unclassified
(35.514 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(56.075 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.06%    β-sheet: 0.00%    Coil/Unstructured: 77.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF00583Acetyltransf_1 5.61
PF02401LYTB 4.67
PF03618Kinase-PPPase 3.74
PF03780Asp23 3.74
PF01041DegT_DnrJ_EryC1 2.80
PF00528BPD_transp_1 2.80
PF06245DUF1015 1.87
PF03167UDG 1.87
PF08545ACP_syn_III 1.87
PF00082Peptidase_S8 1.87
PF00203Ribosomal_S19 1.87
PF01425Amidase 1.87
PF00202Aminotran_3 0.93
PF11946DUF3463 0.93
PF02686Glu-tRNAGln 0.93
PF00834Ribul_P_3_epim 0.93
PF08352oligo_HPY 0.93
PF13469Sulfotransfer_3 0.93
PF00146NADHdh 0.93
PF12836HHH_3 0.93
PF14306PUA_2 0.93
PF00988CPSase_sm_chain 0.93
PF01894UPF0047 0.93
PF07977FabA 0.93
PF02934GatB_N 0.93
PF00291PALP 0.93
PF01960ArgJ 0.93
PF00814TsaD 0.93
PF02790COX2_TM 0.93
PF01098FTSW_RODA_SPOVE 0.93
PF02894GFO_IDH_MocA_C 0.93
PF01507PAPS_reduct 0.93
PF01513NAD_kinase 0.93
PF07040DUF1326 0.93
PF01583APS_kinase 0.93
PF13407Peripla_BP_4 0.93
PF027395_3_exonuc_N 0.93
PF01370Epimerase 0.93
PF01326PPDK_N 0.93
PF13672PP2C_2 0.93
PF13191AAA_16 0.93
PF01642MM_CoA_mutase 0.93
PF02812ELFV_dehydrog_N 0.93
PF02608Bmp 0.93
PF01979Amidohydro_1 0.93
PF05681Fumerase 0.93
PF01820Dala_Dala_lig_N 0.93
PF05683Fumerase_C 0.93
PF03099BPL_LplA_LipB 0.93
PF02621VitK2_biosynth 0.93
PF00696AA_kinase 0.93
PF02578Cu-oxidase_4 0.93
PF13460NAD_binding_10 0.93
PF00889EF_TS 0.93
PF01040UbiA 0.93
PF13559DUF4129 0.93
PF13288DXPR_C 0.93
PF00266Aminotran_5 0.93
PF01694Rhomboid 0.93
PF10128OpcA_G6PD_assem 0.93
PF00005ABC_tran 0.93
PF01467CTP_transf_like 0.93
PF01578Cytochrom_C_asm 0.93
PF00885DMRL_synthase 0.93
PF00313CSD 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG07614-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspHLipid transport and metabolism [I] 9.35
COG1302Uncharacterized conserved protein YloU, alkaline shock protein (Asp23) familyFunction unknown [S] 3.74
COG1806Regulator of PEP synthase PpsR, kinase-PPPase family (combines ADP:protein kinase and phosphorylase activities)Signal transduction mechanisms [T] 3.74
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 2.80
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 2.80
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 2.80
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 2.80
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 2.80
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 2.80
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 1.87
COG0505Carbamoylphosphate synthase small subunitAmino acid transport and metabolism [E] 1.87
COG0185Ribosomal protein S19Translation, ribosomal structure and biogenesis [J] 1.87
COG4198Uncharacterized conserved protein, DUF1015 familyFunction unknown [S] 1.87
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 1.87
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 1.87
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 1.87
COG5588Uncharacterized conserved protein, DUF1326 domainFunction unknown [S] 0.93
COG2511Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domainTranslation, ribosomal structure and biogenesis [J] 0.93
COG1181D-alanine-D-alanine ligase or related ATP-grasp enzymeCell wall/membrane/envelope biogenesis [M] 0.93
COG1214tRNA A37 threonylcarbamoyladenosine modification protein TsaBTranslation, ribosomal structure and biogenesis [J] 0.93
COG4706Predicted 3-hydroxylacyl-ACP dehydratase, HotDog domainLipid transport and metabolism [I] 0.93
COG1364Glutamate N-acetyltransferase (ornithine transacetylase)Amino acid transport and metabolism [E] 0.93
COG1427Chorismate dehydratase (menaquinone biosynthesis, futalosine pathway)Coenzyme transport and metabolism [H] 0.93
COG1496Copper oxidase (laccase) domainInorganic ion transport and metabolism [P] 0.93
COG1622Heme/copper-type cytochrome/quinol oxidase, subunit 2Energy production and conversion [C] 0.93
COG1744Lipoprotein Med, regulator of KinD/Spo0A, PBP1-ABC superfamily, includes NupNSignal transduction mechanisms [T] 0.93
COG0721Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunitTranslation, ribosomal structure and biogenesis [J] 0.93
COG1838Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domainEnergy production and conversion [C] 0.93
COG1884Methylmalonyl-CoA mutase, N-terminal domain/subunitLipid transport and metabolism [I] 0.93
COG1951Tartrate dehydratase alpha subunit/Fumarate hydratase class I, N-terminal domainEnergy production and conversion [C] 0.93
COG0529Adenylylsulfate kinase or related kinaseInorganic ion transport and metabolism [P] 0.93
COG00546,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain)Coenzyme transport and metabolism [H] 0.93
COG0064Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunitTranslation, ribosomal structure and biogenesis [J] 0.93
COG0095Lipoate-protein ligase ACoenzyme transport and metabolism [H] 0.93
COG02585'-3' exonuclease Xni/ExoIX (flap endonuclease)Replication, recombination and repair [L] 0.93
COG0264Translation elongation factor EF-TsTranslation, ribosomal structure and biogenesis [J] 0.93
COG0321Lipoate-protein ligase BCoenzyme transport and metabolism [H] 0.93
COG0334Glutamate dehydrogenase/leucine dehydrogenaseAmino acid transport and metabolism [E] 0.93
COG0340Biotin-protein ligaseCoenzyme transport and metabolism [H] 0.93
COG0432Thiamin phosphate synthase YjbQ, UPF0047 familyCoenzyme transport and metabolism [H] 0.93
COG1005NADH:ubiquinone oxidoreductase subunit 1 (chain H)Energy production and conversion [C] 0.93
COG0533tRNA A37 threonylcarbamoyltransferase TsaDTranslation, ribosomal structure and biogenesis [J] 0.93
COG0574Phosphoenolpyruvate synthase/pyruvate phosphate dikinaseCarbohydrate transport and metabolism [G] 0.93
COG0650Formate hydrogenlyase subunit HyfCEnergy production and conversion [C] 0.93
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 0.93
COG0705Membrane-associated serine protease, rhomboid familyPosttranslational modification, protein turnover, chaperones [O] 0.93
COG0036Pentose-5-phosphate-3-epimeraseCarbohydrate transport and metabolism [G] 0.93
COG07643-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydrataseLipid transport and metabolism [I] 0.93
COG0772Peptodoglycan polymerase FtsW/RodA/SpoVECell cycle control, cell division, chromosome partitioning [D] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.11 %
UnclassifiedrootN/A15.89 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_108729824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales810Open in IMG/M
3300000956|JGI10216J12902_111375387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium630Open in IMG/M
3300001538|A10PFW1_10242293Not Available504Open in IMG/M
3300001538|A10PFW1_11430066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300005103|Ga0066813_1012496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300005166|Ga0066674_10447075Not Available591Open in IMG/M
3300005176|Ga0066679_10127942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1571Open in IMG/M
3300005176|Ga0066679_10402429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales897Open in IMG/M
3300005181|Ga0066678_10039848All Organisms → cellular organisms → Bacteria2620Open in IMG/M
3300005447|Ga0066689_10583497All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300005467|Ga0070706_100053289All Organisms → cellular organisms → Bacteria3733Open in IMG/M
3300005467|Ga0070706_100478791Not Available1158Open in IMG/M
3300005518|Ga0070699_100029223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4753Open in IMG/M
3300005546|Ga0070696_100661239All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300005548|Ga0070665_102013800All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300005552|Ga0066701_10016909All Organisms → cellular organisms → Bacteria3522Open in IMG/M
3300005553|Ga0066695_10892605Not Available508Open in IMG/M
3300005557|Ga0066704_10812790Not Available581Open in IMG/M
3300005576|Ga0066708_10649893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium672Open in IMG/M
3300006579|Ga0074054_10009784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria592Open in IMG/M
3300006796|Ga0066665_10324232All Organisms → cellular organisms → Bacteria1247Open in IMG/M
3300006845|Ga0075421_100333914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1835Open in IMG/M
3300006852|Ga0075433_11695291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300009012|Ga0066710_103012622Not Available655Open in IMG/M
3300009038|Ga0099829_10049380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3110Open in IMG/M
3300009038|Ga0099829_10201221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1612Open in IMG/M
3300009137|Ga0066709_100009872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia8618Open in IMG/M
3300009137|Ga0066709_103013495Not Available618Open in IMG/M
3300009162|Ga0075423_11131261All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300010040|Ga0126308_10084882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1912Open in IMG/M
3300010403|Ga0134123_11229233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria781Open in IMG/M
3300011269|Ga0137392_11601042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium510Open in IMG/M
3300011270|Ga0137391_10107443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2418Open in IMG/M
3300011991|Ga0120153_1008015All Organisms → cellular organisms → Bacteria3030Open in IMG/M
3300012001|Ga0120167_1048447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium942Open in IMG/M
3300012199|Ga0137383_11135534All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300012204|Ga0137374_10010774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia10748Open in IMG/M
3300012204|Ga0137374_10031157All Organisms → cellular organisms → Bacteria5829Open in IMG/M
3300012206|Ga0137380_10029214All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5083Open in IMG/M
3300012207|Ga0137381_11398043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium592Open in IMG/M
3300012209|Ga0137379_10136886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2353Open in IMG/M
3300012211|Ga0137377_10918700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium807Open in IMG/M
3300012211|Ga0137377_11711044Not Available550Open in IMG/M
3300012285|Ga0137370_10205784All Organisms → cellular organisms → Bacteria1155Open in IMG/M
3300012350|Ga0137372_10603596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium805Open in IMG/M
3300012355|Ga0137369_10005920All Organisms → cellular organisms → Bacteria12382Open in IMG/M
3300012355|Ga0137369_10006644All Organisms → cellular organisms → Bacteria11669Open in IMG/M
3300012357|Ga0137384_11405210Not Available546Open in IMG/M
3300012374|Ga0134039_1241926All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15531Open in IMG/M
3300012398|Ga0134051_1070240Not Available690Open in IMG/M
3300012929|Ga0137404_10095838All Organisms → cellular organisms → Bacteria2384Open in IMG/M
3300012930|Ga0137407_12344208Not Available510Open in IMG/M
3300012972|Ga0134077_10468195All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300013296|Ga0157374_11488418Not Available700Open in IMG/M
3300013297|Ga0157378_13258985Not Available504Open in IMG/M
3300013772|Ga0120158_10008230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10080Open in IMG/M
3300014827|Ga0120171_1042034All Organisms → cellular organisms → Bacteria1473Open in IMG/M
3300015053|Ga0137405_1356146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1955Open in IMG/M
3300015077|Ga0173483_10425020All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300017654|Ga0134069_1271864All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300018051|Ga0184620_10193484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria673Open in IMG/M
3300018054|Ga0184621_10042713All Organisms → cellular organisms → Bacteria1490Open in IMG/M
3300018056|Ga0184623_10187476All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300018061|Ga0184619_10128654All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300018066|Ga0184617_1274184Not Available507Open in IMG/M
3300018920|Ga0190273_12274551All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300019279|Ga0184642_1327947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria573Open in IMG/M
3300019867|Ga0193704_1049802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium821Open in IMG/M
3300019886|Ga0193727_1000395All Organisms → cellular organisms → Bacteria16654Open in IMG/M
3300020002|Ga0193730_1012583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2406Open in IMG/M
3300020002|Ga0193730_1066063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1034Open in IMG/M
3300021445|Ga0182009_10281471All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300022756|Ga0222622_10308828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1091Open in IMG/M
3300025904|Ga0207647_10210530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1123Open in IMG/M
3300025912|Ga0207707_10800763All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300025927|Ga0207687_10366838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1177Open in IMG/M
3300026326|Ga0209801_1001937All Organisms → cellular organisms → Bacteria12391Open in IMG/M
3300026326|Ga0209801_1273770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria617Open in IMG/M
3300026552|Ga0209577_10023761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes5394Open in IMG/M
3300027882|Ga0209590_10013717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3900Open in IMG/M
3300028705|Ga0307276_10002001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Carbonactinosporaceae → Carbonactinospora → Carbonactinospora thermoautotrophica2951Open in IMG/M
3300028705|Ga0307276_10002654All Organisms → cellular organisms → Bacteria2658Open in IMG/M
3300028711|Ga0307293_10000111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria19967Open in IMG/M
3300028713|Ga0307303_10004788All Organisms → cellular organisms → Bacteria2205Open in IMG/M
3300028717|Ga0307298_10052206Not Available1121Open in IMG/M
3300028718|Ga0307307_10121835All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300028721|Ga0307315_10020914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1697Open in IMG/M
3300028721|Ga0307315_10224067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300028768|Ga0307280_10033287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1550Open in IMG/M
3300028768|Ga0307280_10356263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M
3300028771|Ga0307320_10095873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1125Open in IMG/M
3300028791|Ga0307290_10061679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1357Open in IMG/M
3300028793|Ga0307299_10130347Not Available944Open in IMG/M
3300028807|Ga0307305_10007073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4832Open in IMG/M
3300028807|Ga0307305_10017553All Organisms → cellular organisms → Bacteria3198Open in IMG/M
3300028824|Ga0307310_10185562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium976Open in IMG/M
3300028828|Ga0307312_10007278All Organisms → cellular organisms → Bacteria6022Open in IMG/M
3300028828|Ga0307312_10014125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales4461Open in IMG/M
3300028828|Ga0307312_10115070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1680Open in IMG/M
3300028876|Ga0307286_10062354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1277Open in IMG/M
3300028878|Ga0307278_10012802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3910Open in IMG/M
3300028878|Ga0307278_10018564All Organisms → cellular organisms → Bacteria3224Open in IMG/M
3300028881|Ga0307277_10042199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1842Open in IMG/M
3300028884|Ga0307308_10015941All Organisms → cellular organisms → Bacteria3406Open in IMG/M
3300028885|Ga0307304_10000912All Organisms → cellular organisms → Bacteria7565Open in IMG/M
3300028885|Ga0307304_10127661Not Available1042Open in IMG/M
3300028885|Ga0307304_10585354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil30.84%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil19.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil14.02%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost5.61%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.87%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.93%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.93%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.93%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300005103Soil and rhizosphere microbial communities from Laval, Canada - mgLAAEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011991Permafrost microbial communities from Nunavut, Canada - A34_65cm_12MEnvironmentalOpen in IMG/M
3300012001Permafrost microbial communities from Nunavut, Canada - A24_80cm_12MEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012374Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012398Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014827Permafrost microbial communities from Nunavut, Canada - A3_80cm_18MEnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10872982423300000956SoilMFPSRPPFFGFRLEARAAEIAADSEEEERGNLPVSPFAPSTAHVRRIRT*
JGI10216J12902_11137538723300000956SoilVGETMFPPRAPFFKDRLSPRAAEIAASAEEKKRGNLTVSPFAPSLALEVAA*
A10PFW1_1024229313300001538PermafrostFFRDRLSAHGVATAAACAEEEEGGNLPVSPYAPSTAHRPKISR*
A10PFW1_1143006623300001538PermafrostRETMFPSRAPFFRDRLGPRAAEIAAWAEETKRGNLTVSPDAPSLAHWAGAQ*
Ga0066813_101249613300005103SoilMFPSRAPFFRDRLNPRAAEIAAWAEENKRGNLPVSPFAPS
Ga0066674_1044707523300005166SoilMFPPRAPFFRDRLNARGVATAATTAEEKERGNLPVSPYAPSTAHRP
Ga0066679_1012794233300005176SoilMFPSRAPFFRDRLSPRAAEIAACAEENKRGNRTVSPVAPSLVHGPGVGP*
Ga0066679_1040242923300005176SoilMSVARLWDPFFRDRLSPRAALIAASAEEKKRGNLTVSRRGPSLAHMPGTGL*
Ga0066678_1003984833300005181SoilMFPSRAPFFRDRLSPRAAEIAAWAEENKRGNRTVSPVAPSLAHGPGVGP*
Ga0066689_1058349723300005447SoilMFPSRAPSFRDRLDPRAAEIAAWAEEKARGNLPVFPYAPSTAHRPQVGL*
Ga0070706_10005328953300005467Corn, Switchgrass And Miscanthus RhizosphereMFPSRAPFFKDRLSPRAAEIAACAEDGDWGNLKVSPDAPSLDHGPGVGP*
Ga0070706_10047879123300005467Corn, Switchgrass And Miscanthus RhizosphereMFPLLDPFFPLRLSPRAAAIAARAEENKRGNLTVSPFAPSLAHWQRSRQ*
Ga0070699_10002922333300005518Corn, Switchgrass And Miscanthus RhizosphereMFPSRAPFLRDRLSARGVATAAANAEEKEWGNLPVSPYAPSTAHRPKAGR*
Ga0070696_10066123923300005546Corn, Switchgrass And Miscanthus RhizosphereMFPLLDPFFPLRLSARAAAIAARAEENKRGNLTVSPFAPSLAHWQRSRQ*
Ga0070665_10201380023300005548Switchgrass RhizosphereMFPSRAPFFRDRLSAHGVATAAVHAEEKEGGNLPVSPYAPSPTHRPEGVR*
Ga0066701_1001690923300005552SoilMFPSRAPFFRDRLSPRAAEIAACAEENNKGNLPAFPFAPSTAHRPENSR*
Ga0066695_1089260513300005553SoilMFPSRAPFFSDRLSARDVATAAANAEEKERGNLPVSPYAPSTAHRPE
Ga0066704_1081279023300005557SoilMFPSRAPFFSDRLSARDVATAAANAEEKERGNLPVSP
Ga0066708_1064989313300005576SoilETMFPSRAPFFRDRLSPRAAEIAAWAEENKRGNRTVSPVAPSLAHGPGVGT*
Ga0074054_1000978413300006579SoilMFPSRAPFFMDRLNPRAAEIAAWAEENDWGNLSVSPCAPSHVHRAETAR*
Ga0066665_1032423223300006796SoilMFPSRAPFFRDRLSPRAAEIAACAEENNKGNLPVSPYAPSTAHRPENSR*
Ga0075421_10033391433300006845Populus RhizosphereMFPSRPPFLGLRLEARAAEIAADSEEEERGNLPVSPFAPATAHVRRIRT*
Ga0075433_1169529123300006852Populus RhizosphereMFPSRPPFLGLRLEARAAEIAADSEEEERGKLPVSPFAPATAHVRRIRT*
Ga0066710_10301262213300009012Grasslands SoilMFPLSDPFFRYRLSPRAAEIAAWAEEKEGGNLTVSPDAPSLRHGPEICP
Ga0099829_1004938043300009038Vadose Zone SoilMFPSRAPFFRDRLSARGVATAAANAEEKERGNLPVSPYAPSTVHEPKSGP*
Ga0099829_1020122113300009038Vadose Zone SoilMSVARLWLARFFRDRLSARGVATAAANTEEKERGNLPVSPY
Ga0066709_10000987263300009137Grasslands SoilMFPSRAPSFRDRLDPRAAEIAAWAEEQEGGNLTVSPDAPSTAHRPQVGL*
Ga0066709_10301349523300009137Grasslands SoilMFPSRAPFFRCRLRPRAAEIAASAEEQEGGNLTVSPDAPSPA
Ga0075423_1113126123300009162Populus RhizosphereMFPSRPPVFGLRLEARAAEIAADSEEEERGNLPVSPFAPATAHVRRIRT*
Ga0126308_1008488223300010040Serpentine SoilMFPSRAPFFKDRLSARAVAIAACAEEKKRGNLTVSPAAPSLAHRSKNDR*
Ga0134123_1122923313300010403Terrestrial SoilMFPLLDPFFTLRLSTRAAAIAARAEENKRGNLTVSPFAPSLAH
Ga0137392_1160104223300011269Vadose Zone SoilMFPSRALFFRDRLSPRGAEIAAWAEETEGGNLTVSPDAPSLAHWAEAD
Ga0137391_1010744343300011270Vadose Zone SoilMFPSRAPFFRNRLSPRAAEIAAWAEENERGNLPVSPYAPSLAHRLKGSR*
Ga0120153_100801523300011991PermafrostMFPSRAPFFRGRLSPRAAEIAARAEEKEWGNLSVSPMAPSLDHGPKVGP*
Ga0120167_104844723300012001PermafrostMFPSRAPFFRDRLSARGVATAAAYTEEKERGNLPVFP
Ga0137383_1113553413300012199Vadose Zone SoilMFPPRAPFFRDRLNPRAAEIAAWAEEKERGNLPVSPYAPSTAHRPKDGR
Ga0137374_1001077483300012204Vadose Zone SoilMFPSRAPFFRDRLSARDVATAAARTEEKERGNLPVSPYASSTTHRPEIGR*
Ga0137374_1003115743300012204Vadose Zone SoilMFPSRAPFFRGRLGPRAAEIAAWAEENAGGNLTVSPDAPSLAHGPGVGP*
Ga0137380_1002921463300012206Vadose Zone SoilMFPSRAPFFTFLLNPRAAEIAAWAEEKERGNLPVSPYAPSTAHGPEGGP*
Ga0137381_1139804313300012207Vadose Zone SoilSGETMFPLSDPFFRDRLSLRAAEIAAWAEEKERGNLTVSPEAPSLAHRPEGGR*
Ga0137379_1013688643300012209Vadose Zone SoilPFFRSRLSPRAAEIAAWAEEKDRGNRTVSPDAPSLAHGPGVGP*
Ga0137377_1091870013300012211Vadose Zone SoilMTVVRLRLAPFFRNRLSARDVTTAAANTEEKERGNLPVSPY
Ga0137377_1171104413300012211Vadose Zone SoilMFTSRAPFFRDRLSARAAEIAAWAEEDKRGNRPVSPFAPSTAHRPKSS
Ga0137370_1020578413300012285Vadose Zone SoilMFPPRAPFFRNRLAPRAAEIAARGEEKEPGNLPVSR
Ga0137372_1060359613300012350Vadose Zone SoilPFFKDRLSSRAAEIAACAEEQERGNLRVSPDAPSLAHGPKISR*
Ga0137369_10005920133300012355Vadose Zone SoilMFSSRAPFFRGRLSPRAAEIAAWAEENAGGNLTVSPDGPSLAHGPGVGP*
Ga0137369_1000664413300012355Vadose Zone SoilMFPSRAPFFRDRLSARDVATAAAGAEEKEGGNLPVSPYAPSPAH
Ga0137384_1140521013300012357Vadose Zone SoilMFPSRAPFFRCRFRPRAAEIAAWAEEQEGGNLTVSPDAPSLAQWAE
Ga0134039_124192633300012374Grasslands SoilMFPSRAPYFRERFGLRAAAIAARAEDEVGGNLTVSPEAP
Ga0134051_107024013300012398Grasslands SoilMFPSRAPFFRDRLGPRAAEIAACAEENERENLPVC
Ga0137404_1009583813300012929Vadose Zone SoilMFPPRAPFFRNRLRGVGDATAATTPEEKQRGNLPVSP
Ga0137407_1234420813300012930Vadose Zone SoilPFFRDRLSPRAAEIAAWAEENDWGNLPVSPFAPSTAHRPEVGL*
Ga0134077_1046819513300012972Grasslands SoilGETMFPPLAPFFRSRLNTRAAQIAACAEEQEGGNVRVSPDAPSLAHRPETGR*
Ga0157374_1148841833300013296Miscanthus RhizosphereLSAHGVATAAVHAEEKEGGNLPISPYAPSPTHRPEGVR*
Ga0157378_1325898523300013297Miscanthus RhizosphereRETMFPSRAPFFMGRLDPRAAEIAAWAEETERGNRTVSPEAPSLAHWAKAAQ*
Ga0120158_1000823023300013772PermafrostMFPPRAPFFRSGLSARADATAVARAEEKERGNLPVSPFAPSPAHQPEIGR*
Ga0120171_104203423300014827PermafrostMFPSRAPFFRDRLSARGVATAAARTEEKERGNLPVSPYAPS
Ga0137405_135614633300015053Vadose Zone SoilRDRLSAHGVTTAAARTEEKERGNLPVSPDAPSTAQRPKVGR*
Ga0173483_1042502013300015077SoilMFPSRAPFFRERLSAHGVATAAPRTEEKVRGNLPVSPYAPSPAHRP
Ga0134069_127186423300017654Grasslands SoilMFPSRAPFFRDRLKPRAAEIAAWAEENRRGNLPVSPFAPSTAQRP
Ga0184620_1019348423300018051Groundwater SedimentMFPSRAPFFRNRLSARAVATAAARTEEKARGNLPVSPY
Ga0184621_1004271343300018054Groundwater SedimentMFPSRAPFFRDRLSACGVATAAARTEERERGNLPVSPLAPS
Ga0184623_1018747623300018056Groundwater SedimentMFPPRAPFFKDRLDPRAAKIAAWGEEELGGNLTVSPDPPPT
Ga0184619_1012865423300018061Groundwater SedimentMFLARAPFFMDRLRARGVPTAAARTEEKKGGNLPVSPYAPLTAHRPQGAL
Ga0184617_127418413300018066Groundwater SedimentMFPSGAPFFRDRLSPRAAEIAAWAEENMRGNLPVSPYAP
Ga0190273_1227455123300018920SoilMFPSRAPFFRDRLSAHSVATAAAGTEEKEGGNLPVSPYAPS
Ga0184642_132794713300019279Groundwater SedimentMFPSRAPFFRDRLSARGITTAAATAEEKERGNLPVSPYAPSTAH
Ga0193704_104980213300019867SoilMFPSRAPVFRNRLSPRAAEIAAWAEENAGGNLPVSLTPL
Ga0193727_1000395103300019886SoilMFPSRAPFFRDRLNPRAAEIAAWAEENKRGNLPVSLFAPSPHGPEIGP
Ga0193730_101258313300020002SoilMFPSRAPFFRDRLSPRAAEIAAWAEENKRGNRTVS
Ga0193730_106606323300020002SoilMFPSRAPFFRNRLNPRAAEIAAWAEEKEGGNLPVSPYAPSTAHGPEG
Ga0182009_1028147123300021445SoilFPLLDAFFTPRLSPRAAAIAARAEENDRGNLTVSPGAPSLAHRPGPAR
Ga0222622_1030882813300022756Groundwater SedimentMFPSRASFFRSGLGPRAAEIAAWAEEKERGNLPVS
Ga0207647_1021053043300025904Corn RhizosphereMFPSRAPFFRDRLSPRATEIAACAEEDKRGNPRVSPKAPSLAH
Ga0207707_1080076333300025912Corn RhizosphereMFPSRAPFFRDRLSPRATEIAACAEEDKRGNPRVSPK
Ga0207687_1036683833300025927Miscanthus RhizosphereSRAPFFRDRLSAHGVATAAVHAEEKEGGNLPISPYAPSPTHRPEGVR
Ga0209801_100193753300026326SoilMFPSRAPFFRDRLSPRAAEIAACAEENNKGNLPAFPFAPSTAHRPENSR
Ga0209801_127377013300026326SoilMFPSRAPFFRDRLSPRAAEIAACAEEKMRGNLPVSPYA
Ga0209577_1002376133300026552SoilMTSLVFGSLPFFRSRLSPPAAEIAAKAEEKEGGNLTVSPFAPSLRHAPEIGA
Ga0209590_1001371743300027882Vadose Zone SoilMSARKSRAPFFTDRLSPRAAEIAAWAEESTRGNLPVSPYAPSPHRSEIDR
Ga0307276_1000200133300028705SoilMFPSRAPFFRDRLNPRAAEIAAWAEEKKRGNLPVSPYAPSTAPRPKS
Ga0307276_1000265443300028705SoilMFPSRAPFFRDRLSARAAQIAALAEENERGNRAVSPGAPSLR
Ga0307293_10000111243300028711SoilMFPSRAPVFRNRLSPRAAEIAAWAEENAGGNLPVSPYAP
Ga0307303_1000478843300028713SoilPFFRDRLNARSVATAAASAEEKERGNLPVSPYAPSTAHEPKVGS
Ga0307298_1005220613300028717SoilMFPSRAPFFRDRLNPRAAEIAAWAEEREWGNLSVSPGAP
Ga0307307_1012183523300028718SoilMFPSRAPFFRDRVNPRAAEIAAWAEENKRGNLPVSPFAPSPHGPEIGP
Ga0307315_1002091413300028721SoilMFPSRAPVFRNRLSPRAAEIAAWAEENAGGNLPVS
Ga0307315_1022406723300028721SoilMFPSRAPFFRDRLSSRAAEIAACAEEKERGNLSVS
Ga0307280_1003328713300028768SoilMFPSRAPFFRDRLSSRAAEIAACAEENEWGNLPVSPYAPS
Ga0307280_1035626323300028768SoilMFPRRAPFFRSRLDALAVATAAAGVEEKEGGNLPVS
Ga0307320_1009587333300028771SoilMFPSRAPFFKDRLSARDMATAAARTKEKERGNLAVSPYAPSPA
Ga0307290_1006167913300028791SoilMFPSQTPFFRDRLSARDGATAAARTVEKEWGNLPVSPYAP
Ga0307299_1013034723300028793SoilMFPPRAPFFRSRLDAHAVATAAAGVEEKEGGNLPVSPYAHSTAHRP
Ga0307305_1000707393300028807SoilMFPSRAPFFRDRLSARGITTAAATAEEKERGNLPISPYAPPT
Ga0307305_1001755323300028807SoilMFPSRASFFRSGLGPRAAEIAAWAEEKERGNLPVSPYAPSPLIGRTAADEL
Ga0307310_1018556213300028824SoilMFPSRAPFFRDRHNARAAEIAANAAEKGWGNLPVSP
Ga0307312_1000727873300028828SoilMFPSRAPFFKDRLSARDMATAAARTKEKERENLPVCPYAPSPAYRQESGR
Ga0307312_1001412543300028828SoilMFPSRVLFFRDRLSFRAAEIAACAEEKYGGSLPVPPGSPLPTHGPDGP
Ga0307312_1011507033300028828SoilAPVRETMFPSRAPFFRDRVNPRAAEIAAWAEENKRGNLPVSPFAPSPHGPEIGP
Ga0307286_1006235423300028876SoilMFPSRAPFFRDRLNVRGVTTVAARTEEKIRGNRPVSPEAPST
Ga0307278_1001280273300028878SoilMFPSRAPFFRGRLSPRAAEIAAWAEEKSRGNLTVSPDAPSLAHGPGVGP
Ga0307278_1001856453300028878SoilMSVAPFFRDRLSARDLATAAANAEEKKRGNLPVSPYAPSPAHRLKGSR
Ga0307277_1004219933300028881SoilMFPSRAPFFRDRLNPHAAAIAAWAEEKEGGNLPVSPYAP
Ga0307308_1001594143300028884SoilMFPSRAPFFRGRLSPRAAEIAAWAEENKRGNLPVSPDAPSLAHGPGVGP
Ga0307304_10000912113300028885SoilAPFFRDRLSPRAAEIAAWAEEKEWGNLPVSPYAPSTAHRPQVGV
Ga0307304_1012766113300028885SoilGETMFPPRAPFFGDRLSARGVATAAASAEEKEWGNLPVSPYAPSPAHRPKGSR
Ga0307304_1058535413300028885SoilMFPPRAPFFRDRLSARAVATAAARTEEKEGGNLPVSPYA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.