| Basic Information | |
|---|---|
| Family ID | F091993 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 48 residues |
| Representative Sequence | RRGITVYLRERTPSLGDPVDPRVTYPYRAITIARSSKPVYVKLQGRP |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.20 % |
| % of genes from short scaffolds (< 2000 bps) | 92.52 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (24.299 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.776 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.402 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 20.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF01817 | CM_2 | 61.68 |
| PF02577 | BFN_dom | 27.10 |
| PF14343 | PrcB_C | 2.80 |
| PF11706 | zf-CGNR | 0.93 |
| PF00873 | ACR_tran | 0.93 |
| PF04087 | DUF389 | 0.93 |
| PF01740 | STAS | 0.93 |
| PF00571 | CBS | 0.93 |
| PF02195 | ParBc | 0.93 |
| PF03372 | Exo_endo_phos | 0.93 |
| PF00156 | Pribosyltran | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG1605 | Chorismate mutase | Amino acid transport and metabolism [E] | 61.68 |
| COG1259 | Bifunctional DNase/RNase | General function prediction only [R] | 27.10 |
| COG1808 | Uncharacterized membrane protein AF0785, contains DUF389 domain | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459019|G14TP7Y01EHKDW | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
| 3300005093|Ga0062594_103412047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300005160|Ga0066820_1002950 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300005172|Ga0066683_10190358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1265 | Open in IMG/M |
| 3300005328|Ga0070676_10603833 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300005336|Ga0070680_100688478 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300005364|Ga0070673_100678732 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300005366|Ga0070659_101499160 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005441|Ga0070700_101948997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
| 3300005457|Ga0070662_100094825 | All Organisms → cellular organisms → Bacteria | 2248 | Open in IMG/M |
| 3300005530|Ga0070679_101934575 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005547|Ga0070693_100565666 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300005547|Ga0070693_101585820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
| 3300005569|Ga0066705_10601032 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300005577|Ga0068857_100646773 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300005578|Ga0068854_102233190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
| 3300005614|Ga0068856_102531103 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300005713|Ga0066905_101539491 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005713|Ga0066905_102067002 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005834|Ga0068851_11053635 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300006031|Ga0066651_10659017 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300006031|Ga0066651_10840183 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300006046|Ga0066652_100273175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1489 | Open in IMG/M |
| 3300006579|Ga0074054_12041240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300006794|Ga0066658_10439890 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300006797|Ga0066659_11085083 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300006804|Ga0079221_11519307 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300006845|Ga0075421_102160765 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300006954|Ga0079219_10071930 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300006954|Ga0079219_10559981 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300009093|Ga0105240_12752183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
| 3300009094|Ga0111539_12083262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 658 | Open in IMG/M |
| 3300009148|Ga0105243_10654213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1019 | Open in IMG/M |
| 3300010321|Ga0134067_10287572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
| 3300010321|Ga0134067_10362782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
| 3300010398|Ga0126383_10277974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1660 | Open in IMG/M |
| 3300011107|Ga0151490_1615479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1273 | Open in IMG/M |
| 3300011119|Ga0105246_10335358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 1234 | Open in IMG/M |
| 3300012496|Ga0157353_1014333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 698 | Open in IMG/M |
| 3300012895|Ga0157309_10054769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1000 | Open in IMG/M |
| 3300012915|Ga0157302_10406510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
| 3300012937|Ga0162653_100008118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1205 | Open in IMG/M |
| 3300012939|Ga0162650_100076906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 574 | Open in IMG/M |
| 3300012948|Ga0126375_11798160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300012951|Ga0164300_10313260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 826 | Open in IMG/M |
| 3300012957|Ga0164303_10487567 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300012958|Ga0164299_10661179 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300012960|Ga0164301_10047328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2189 | Open in IMG/M |
| 3300012987|Ga0164307_10346821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1076 | Open in IMG/M |
| 3300013102|Ga0157371_10647844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 788 | Open in IMG/M |
| 3300013297|Ga0157378_12525303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
| 3300013306|Ga0163162_10564729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1265 | Open in IMG/M |
| 3300013765|Ga0120172_1015219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2348 | Open in IMG/M |
| 3300014166|Ga0134079_10423141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
| 3300014820|Ga0120160_1038861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 869 | Open in IMG/M |
| 3300014823|Ga0120170_1125771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300015371|Ga0132258_10201371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4829 | Open in IMG/M |
| 3300015372|Ga0132256_101587254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 764 | Open in IMG/M |
| 3300015373|Ga0132257_100647914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1309 | Open in IMG/M |
| 3300015374|Ga0132255_101200109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1143 | Open in IMG/M |
| 3300017657|Ga0134074_1125040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 892 | Open in IMG/M |
| 3300018066|Ga0184617_1270988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300019362|Ga0173479_10163972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 902 | Open in IMG/M |
| 3300019362|Ga0173479_10409814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 657 | Open in IMG/M |
| 3300019362|Ga0173479_10443704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
| 3300021445|Ga0182009_10314473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
| 3300022889|Ga0247785_1009419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 998 | Open in IMG/M |
| 3300023071|Ga0247752_1001572 | All Organisms → cellular organisms → Bacteria | 2944 | Open in IMG/M |
| 3300024232|Ga0247664_1083548 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300024245|Ga0247677_1041298 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300025899|Ga0207642_10454800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 776 | Open in IMG/M |
| 3300025904|Ga0207647_10504778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 674 | Open in IMG/M |
| 3300025912|Ga0207707_10928641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 718 | Open in IMG/M |
| 3300025917|Ga0207660_10600021 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300025928|Ga0207700_10106523 | All Organisms → cellular organisms → Bacteria | 2247 | Open in IMG/M |
| 3300025960|Ga0207651_10553482 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300025972|Ga0207668_11182558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
| 3300026023|Ga0207677_10280679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1367 | Open in IMG/M |
| 3300026121|Ga0207683_10906707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
| 3300026295|Ga0209234_1045856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1663 | Open in IMG/M |
| 3300027873|Ga0209814_10217653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 826 | Open in IMG/M |
| 3300028717|Ga0307298_10089714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 867 | Open in IMG/M |
| 3300028722|Ga0307319_10075320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1070 | Open in IMG/M |
| 3300028744|Ga0307318_10017316 | All Organisms → cellular organisms → Bacteria | 2315 | Open in IMG/M |
| 3300028744|Ga0307318_10201624 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300028755|Ga0307316_10282186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
| 3300028768|Ga0307280_10175072 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300028791|Ga0307290_10107748 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300028793|Ga0307299_10098988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1089 | Open in IMG/M |
| 3300028793|Ga0307299_10303765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300028807|Ga0307305_10437260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
| 3300028809|Ga0247824_10439437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 760 | Open in IMG/M |
| 3300028814|Ga0307302_10301149 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300028814|Ga0307302_10490993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
| 3300028814|Ga0307302_10598429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
| 3300030496|Ga0268240_10069171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 787 | Open in IMG/M |
| 3300031093|Ga0308197_10061321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1007 | Open in IMG/M |
| 3300031152|Ga0307501_10123540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
| 3300031421|Ga0308194_10387377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
| 3300031731|Ga0307405_10571743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 918 | Open in IMG/M |
| 3300031903|Ga0307407_10613838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 811 | Open in IMG/M |
| 3300031908|Ga0310900_10779635 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300031939|Ga0308174_11530614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
| 3300031996|Ga0308176_10044826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3580 | Open in IMG/M |
| 3300032074|Ga0308173_10752740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 894 | Open in IMG/M |
| 3300032180|Ga0307471_101265162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 901 | Open in IMG/M |
| 3300034817|Ga0373948_0212158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 24.30% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.67% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.67% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.74% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.80% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.87% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.87% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.87% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.93% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005160 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMB | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012496 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610 | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014820 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_0.25M | Environmental | Open in IMG/M |
| 3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022889 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4 | Environmental | Open in IMG/M |
| 3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4MG_04155300 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | NRGIYVYARERTPSLGEPVTPRITYPYRVLSMHGKAKPVYVKLEGR |
| Ga0062594_1034120472 | 3300005093 | Soil | LTLRERTPTLGEPVDPHVTYPYRALAIHGTAKPVYVKLQGR* |
| Ga0066820_10029503 | 3300005160 | Soil | YSLRAQRVVERRRGITVYLRERTPSLGDPVDPRVTYPYRAIAIARSSKPVYVKLQGRP* |
| Ga0066683_101903585 | 3300005172 | Soil | LRERAPLLGDPVEPRVTYPYRAITIARSSKPVSVKLQGRP* |
| Ga0070676_106038333 | 3300005328 | Miscanthus Rhizosphere | RRGITVYLRERTPSLGDPVDPRVTYPYRAITIARSSKPVYVKLQGRP* |
| Ga0070680_1006884783 | 3300005336 | Corn Rhizosphere | RGIDVYLRERTPGLGDPVDPRVTYPYRALALASSSKPVYVKLQGRP* |
| Ga0070673_1006787321 | 3300005364 | Switchgrass Rhizosphere | RVVERRRGITVYLRERTPSLGDPVDPNVTYPYRAITIARSSKPVYVKLQGRP* |
| Ga0070659_1014991601 | 3300005366 | Corn Rhizosphere | TGYTLVIDRVLERRRGIYVYAHEQTPALGEPVDARVTYVYRVLTMHGRAKPVYVKLRGR* |
| Ga0070700_1019489971 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VRLVERRRGIYLTLRERTPTLGEPVDPHVTYPYRALAIHGTAKPVYVKLQGR* |
| Ga0070662_1000948251 | 3300005457 | Corn Rhizosphere | IYVYAHEQTPALGEPVDARVTYVYRVLTMHGRAKPVYVKLRGR* |
| Ga0070679_1019345753 | 3300005530 | Corn Rhizosphere | ITVYLRERTPSLGDPVDPRVTYPYRAITIARSSKPVYVKLQGRP* |
| Ga0070693_1005656663 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | GPRSSTGYELVVDRVLERRRGIYVYAHEQTPALGEPVDARVTYVYRVLTMHGRAKPVYVKLRGR* |
| Ga0070693_1015858201 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | RVVRLVERRRGIYLTLRERTPTLGEPVDPHVTYPYRALAIHGTAKPVYVKLQGR* |
| Ga0066705_106010321 | 3300005569 | Soil | IYVYAHEQTPSLGEPVELHVTYVYRVLAMHGRAKPVYVKLQGR* |
| Ga0068857_1006467733 | 3300005577 | Corn Rhizosphere | YVYLREQTPDLGHPVDPRVTYPYRALALASSSKPVYVKLQGRP* |
| Ga0068854_1022331901 | 3300005578 | Corn Rhizosphere | VQRVVERRRGITVYLRERTPSLGDPVDPRVTYPYRAITIARSSKPVYVKLQGRP* |
| Ga0068856_1025311033 | 3300005614 | Corn Rhizosphere | PTLGEPVEPHVTYPYRALAMRSSTKPVYVKLQRR* |
| Ga0066905_1015394913 | 3300005713 | Tropical Forest Soil | TGYSLRIVRVVQRRRGVDVIVRERTPSLGDPVEPRVTYPYRAIAIRSTKTPVYVKLQGRP |
| Ga0066905_1020670023 | 3300005713 | Tropical Forest Soil | VIVRERTPSLGDPVAARVTYPYRAVAIRSTKRPVYVKLQGRP* |
| Ga0068851_110536353 | 3300005834 | Corn Rhizosphere | ERTPSLGDPVDPRVTYPYRAITIARSSKPVYVKLQGRP* |
| Ga0066651_106590171 | 3300006031 | Soil | NRGIYVYAREQTPSLGEPVTPRVTYPYRVLSMHGKAKPVYVKLEGR* |
| Ga0066651_108401831 | 3300006031 | Soil | YSLRILSVVERRRGIYVDAREKTPSLGESVTARVTYVYRLLSMPGKAKPVYVKLQGR* |
| Ga0066652_1002731756 | 3300006046 | Soil | YAHEQTPSLGEPVELHVTYVYRVLAMHGRAKPVYVKLRGR* |
| Ga0074054_120412401 | 3300006579 | Soil | RVVERRRGIYVYAREQTPSLGQPVQARVTYPYRVLSMHGSAKPVYVKLQGRP* |
| Ga0066658_104398903 | 3300006794 | Soil | VYRRERTPSLGDPVTARVTYPYRAIAIARSTKPVYVKLQGRP* |
| Ga0066659_110850831 | 3300006797 | Soil | RSSTGYSLRIDRVVERRRGIYVYAHEQTPSLGEPVELHVTYVYRVLAMHGRAKPVYVKLRGR* |
| Ga0079221_115193071 | 3300006804 | Agricultural Soil | STGYSLRILRVVERRRGIYIDAREETPSLGEPVTARVTYVYRLLSMPGKAKPVYVKLQGR |
| Ga0075421_1021607653 | 3300006845 | Populus Rhizosphere | SLRVERVVERRREIDVYLRERAPSLGDPVEPRVTYPYRAITIARTSKPLSVKLQGRP* |
| Ga0079219_100719306 | 3300006954 | Agricultural Soil | EETPSLGEPVTARVTYVYRLLSMPGKAKPVYVKLQGR* |
| Ga0079219_105599813 | 3300006954 | Agricultural Soil | VERRRGVYLTLRERTPSLGEPVEARVTYPYLALAVRRSAKPVYVKLQGRP* |
| Ga0105240_127521831 | 3300009093 | Corn Rhizosphere | GIYVYVREQTPTLGEPVTARVTYPYRVLSMHGSAKPVYVKLEGRP* |
| Ga0111539_120832623 | 3300009094 | Populus Rhizosphere | SLGDPVEARVTYPYRAVAIRSTKRPVYVKLQGRP* |
| Ga0105243_106542133 | 3300009148 | Miscanthus Rhizosphere | RVQRVVERRREIDIYVRERTPSLGDPVEPRVTYPYRAITIERSSKPVYVKLLGRP* |
| Ga0134067_102875721 | 3300010321 | Grasslands Soil | RVVERRRGIYVYAHEQTPSLGEPVELHVTYVYRVLAMHGRAKPVYVKLRGR* |
| Ga0134067_103627823 | 3300010321 | Grasslands Soil | STGYSLRILSVVERRRGIYIDAREQTPSLGQSLKARVTFVYRLLSMHGRAKPVYVKLQGR |
| Ga0126383_102779741 | 3300010398 | Tropical Forest Soil | LVERRRGVYLTLRERTPTLGEPVDPHVTYPYRALAIPGTAKPVYVKLQGR* |
| Ga0151490_16154791 | 3300011107 | Soil | RRGINVYVREQTPSLGDPVDPHVTYPYLAITIARSSKPVYVKLQGR* |
| Ga0105246_103353581 | 3300011119 | Miscanthus Rhizosphere | LYLRERAPSLGDPVDPRVTYPYRAITIARSSKPVYVKLQGRP* |
| Ga0157353_10143331 | 3300012496 | Unplanted Soil | VVERRRGIYVYAREVTPSLGEPVQPLITYPYRVLSMHGSAKPVYVKLEGRP* |
| Ga0157309_100547691 | 3300012895 | Soil | RRRGIYVYLRELPPSLGDPVEPRVTYPYLAIAIAHSSKPIYVKLQGRP* |
| Ga0157302_104065101 | 3300012915 | Soil | RRRGIYVYAREVTPSLGESVQPLITYPYRVLSMHGSAKSVYVKLEGRP* |
| Ga0162653_1000081184 | 3300012937 | Soil | QTPTLGEPVKARVTYPYRVLSMHGSAKPVYVKLEGRP* |
| Ga0162650_1000769061 | 3300012939 | Soil | LRVLERHRGINVYAREQTPSLGDPVTARITYPYRALAIRRSGKRVSVKLQGRP* |
| Ga0126375_117981603 | 3300012948 | Tropical Forest Soil | QRVVERRRGIDVIVRERTPSLGDPVEARVTYPYRAVAIRSTKRPVYVKLQGRP* |
| Ga0164300_103132603 | 3300012951 | Soil | YSLVIDRVLERRRGIYVYAHERTPSLGEPVEARVTYVYRVLAMHGRAKPVYVKLRGR* |
| Ga0164303_104875673 | 3300012957 | Soil | QRVVEQRRGIYVYLRERTPSLRDPVDPRVTYPYRAIAIARSTKPVYVKLQGRP* |
| Ga0164299_106611793 | 3300012958 | Soil | VVVRRRGITSKLSERILSLIDPVDPTKSYPYRAITIARSSKPVYVKLQGRP* |
| Ga0164301_100473281 | 3300012960 | Soil | AHEQTPALGEPVESRVTYVYRLLTRHGRAKPVYVNLRGR* |
| Ga0164307_103468211 | 3300012987 | Soil | ERRRGITDYLRERTPSLSDPVDPRVTYPYRAITIARSSKPVYVKLQGRP* |
| Ga0157371_106478443 | 3300013102 | Corn Rhizosphere | SLVVDRVVEQHRGIYVYAHERTPALGEPVEARVTYVYRVLSMHGRAKPVYVKLRGR* |
| Ga0157378_125253031 | 3300013297 | Miscanthus Rhizosphere | GITVYLRERTPSLGDPVDPRVTYPYRAITIARSSKPVYVKLQGRP* |
| Ga0163162_105647293 | 3300013306 | Switchgrass Rhizosphere | MRRISLGPRSSTGYELVVDRVLERRRGIYVFAHEQTPALGEPVDARVTYVYRVLTMHGRAKPVYVKLRGR* |
| Ga0120172_10152197 | 3300013765 | Permafrost | RVVERHRGIYVYAREETPSLGDPVKPRITYPYRVLSMHGSAKPVYVKLEGRP* |
| Ga0134079_104231413 | 3300014166 | Grasslands Soil | GIYIYARERTPSLGEPVTPRVTYPFRVLSMHGKAKPVYVKLEGR* |
| Ga0120160_10388613 | 3300014820 | Permafrost | LRVVERRRGIYVYAREETPSLGDPVKPRITYPYRLLSMHGSAKPVYVKLEGRP* |
| Ga0120170_11257713 | 3300014823 | Permafrost | RRGIYVYAREETPALGDPVQPRVTYPYRVLSMHGSAKPVYVKLEGRP* |
| Ga0132258_1020137111 | 3300015371 | Arabidopsis Rhizosphere | VERRRGNYVYLRERTPGLGDPVDAHVTYPYRALTIARSSKPVYVKLQGRP* |
| Ga0132256_1015872543 | 3300015372 | Arabidopsis Rhizosphere | TLRERTPTLGEPVDPHVTYPYRALAIHGTAKPVYVKLQGR* |
| Ga0132257_1006479145 | 3300015373 | Arabidopsis Rhizosphere | TPSLGEPVMARVTYPYRAIAISRTGKPVYVKLQGRP* |
| Ga0132255_1012001094 | 3300015374 | Arabidopsis Rhizosphere | RRGIYVYLRERTPGLGDPVDAHVTYPYRALTIARSSKPVYVKLQGRP* |
| Ga0134074_11250403 | 3300017657 | Grasslands Soil | DAREQAPSLGEPVTARVTYVYRLLSMPGKAKPVYVKLDGR |
| Ga0184617_12709882 | 3300018066 | Groundwater Sediment | YVLRILRVFEQRRGIYIYAREQTPALGDPVEPRITYPYRVLSMHGSAKPVYVKLEGRP |
| Ga0173479_101639723 | 3300019362 | Soil | RSSTGYQLVIDRVLERRRGIYVYAHERTPALGEPVEARVTYVYRVLAMHGRAKPVYVKLRGR |
| Ga0173479_104098141 | 3300019362 | Soil | REIDVYLQERTPSLGDPVEPRVTYPYRAITIKRSGKPVYVKLQGRP |
| Ga0173479_104437043 | 3300019362 | Soil | REQAPSLGDPVEARVTYPYRAVAIRSTKRPVYVKLQGRP |
| Ga0182009_103144731 | 3300021445 | Soil | RTPALGEPVEARVTYVYRVLAMHGRAKPVYVKLRGR |
| Ga0247785_10094193 | 3300022889 | Soil | VVERRRGVDVIVREQAPSLGDPVEARVTYPYRAVAIRSTKRPVYVKLQGRP |
| Ga0247752_10015721 | 3300023071 | Soil | VRVVERRRGVDVIVREQAPSLGDPVEARVTYPYRAVAIRSTKRPVYVKLQGRP |
| Ga0247664_10835481 | 3300024232 | Soil | PDLGHPVDPRVTYPYRALALASSSKPVYVKLQGRP |
| Ga0247677_10412981 | 3300024245 | Soil | LVERRRGIYLTLRERTPTLGEPVDPHVTYPYRALAIHGTAKPVYVKLQGR |
| Ga0207642_104548001 | 3300025899 | Miscanthus Rhizosphere | VLRVVERRRGIYVYVREQTPTLGEPDKAHVTYPYRVLSMHGSAKPVYVKLEGRP |
| Ga0207647_105047781 | 3300025904 | Corn Rhizosphere | TPSLGDPVDPRVTYPYRAITIARSSKPVYVKLQGRP |
| Ga0207707_109286413 | 3300025912 | Corn Rhizosphere | YVYAHEQTPALGEPVDTRVTYVYRVLTMHGRAKPVYVKLRGR |
| Ga0207660_106000211 | 3300025917 | Corn Rhizosphere | ERTPTLGEPVDPHVTYPYRALAIHGTAKPVYVKLQGR |
| Ga0207700_101065231 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VERRRGIYLTLRERTPTLGEPVDPHVTYPYRALAIHGTAKPVYVKLQGR |
| Ga0207651_105534823 | 3300025960 | Switchgrass Rhizosphere | RVQRVVERRRGITVYLRERTPSLGDPVDPNVTYPYRAITIARSSKPVYVKLQGRP |
| Ga0207668_111825581 | 3300025972 | Switchgrass Rhizosphere | VQRVVERRRGITVCLRERTPSLGDPVDPRVTYPYRAITIARSSKPVYVKLQGRP |
| Ga0207677_102806791 | 3300026023 | Miscanthus Rhizosphere | YELVVDRVLERRRGIYVYAHEQTPALGEPVDARVTYVYRVLTMHGRAKPVYVKLRGR |
| Ga0207683_109067073 | 3300026121 | Miscanthus Rhizosphere | VYLRERTPGLGDPVDPRVTYPYRALALASSSKPVYVKLQGRP |
| Ga0209234_10458566 | 3300026295 | Grasslands Soil | VYARERTPSLGDPVTAEVTYPYRVIAIRHSHKPVYVKLHGR |
| Ga0209814_102176531 | 3300027873 | Populus Rhizosphere | REKTPSLGEPVTARVTYVYRLLSMPGKAKPVYVKLQGRP |
| Ga0307298_100897143 | 3300028717 | Soil | ERRREIDVYLRERTPSLGDPVAPSVTYPYRAITIPRTSKPVYVKLQGRP |
| Ga0307319_100753201 | 3300028722 | Soil | VVEQRRGIYIYAREQTPALGDPVEPRITYPYRVLSMHGSAKPVYVKLEGRP |
| Ga0307318_100173167 | 3300028744 | Soil | YAREQTPSLGDPVTPGVTYPYRLLATPTTAKPVYVKLQGRP |
| Ga0307318_102016243 | 3300028744 | Soil | REETPALDDPVRPRITYPYRVLSMHGNAKPVYVKLEGRP |
| Ga0307316_102821861 | 3300028755 | Soil | RERTPALGDPVDPRVTYPYRAITIARTSKPVYVKLQGRP |
| Ga0307280_101750723 | 3300028768 | Soil | ILRVVERRRGVYVYAREQTPSLGDPVTPGVTYPYRLLATPTTAKPVYVKLQGRP |
| Ga0307290_101077483 | 3300028791 | Soil | LRILHVAERRRGIDVYAREQTPSLGDPVTARITYPYRALAIRRSGKRVSVKLQGRP |
| Ga0307299_100989884 | 3300028793 | Soil | REQTPSLGDPVTPRITYPYRALAIRRSGKRVSVKLQGRP |
| Ga0307299_103037653 | 3300028793 | Soil | VERRRGIYVYVREQTPSLRDPVDPRVTYPYRALTIARSSKPVYVKLQGRP |
| Ga0307305_104372601 | 3300028807 | Soil | ERHRGIDVYAREQTPSLGDPVTARITYPYRALAIRRSGKRVSVKLQGRP |
| Ga0247824_104394373 | 3300028809 | Soil | HDTHDPVEARVTYPYRAVAIRSTKRPVYVKLQGRP |
| Ga0307302_103011493 | 3300028814 | Soil | IYIYAREQTPALGDPVQPQITYPYRVLSMHGSAKPVYVKLEGRP |
| Ga0307302_104909931 | 3300028814 | Soil | YSLRIVHVAERRRGIDVYAREQTPSLGDPVTARITYPYRALAIRRSGKRVSVKLQGRP |
| Ga0307302_105984291 | 3300028814 | Soil | YAREQTPSLGDPVTARITYPYRALAIRRSGKRVSVKLQGRP |
| Ga0268240_100691711 | 3300030496 | Soil | EVTPSLGEPVGARVTYPYRAIAIARTGKTVYVKLQGRP |
| Ga0308197_100613211 | 3300031093 | Soil | YSLRILSVVERRRGIYVDAREETPSLGEPVTAGVTYVYRLLSMHGSAKPVYVKLEGRP |
| Ga0307501_101235403 | 3300031152 | Soil | RERTPSLRDPVAPRVTYPYRAITIARTAKPVYVKLQGRP |
| Ga0308194_103873772 | 3300031421 | Soil | PRSSTGYSLQIRRVVERRRGIYIDARERTPSLGESVTARVTYVYRLLSMPGKAKPVYVKLQGR |
| Ga0307405_105717433 | 3300031731 | Rhizosphere | STGHSLRTLRVVERRRGLTVYAREQTPALGDPVEPRVTYPYRLLALPRTSKPVSVKLEGR |
| Ga0307407_106138381 | 3300031903 | Rhizosphere | LTVYAREQTPALGDPVEPRVTYPYRLLALPRTSKPVSVKLEGRP |
| Ga0310900_107796351 | 3300031908 | Soil | YSLRIVRVVERRRGVDVIVREQAPSLGDPVEARVTYPYRAVAIRSTKRPVYVKLQGRP |
| Ga0308174_115306143 | 3300031939 | Soil | VYLGERTPALGDPVEPRVTYPYRAITIPRTSKPVYVKLQGRP |
| Ga0308176_100448267 | 3300031996 | Soil | YVYVREVTPSLGDPVQARVTYPYRVLSMHGSAKPVYVKLEGRP |
| Ga0308173_107527403 | 3300032074 | Soil | RGIYVYLRERTPSLGDPVTARVTYPYRAIAIARTTKPVYVKLQGRP |
| Ga0307471_1012651621 | 3300032180 | Hardwood Forest Soil | TPSLGDPVDPRVTYPYRAITIAHSSKPVYVKLQGRP |
| Ga0373948_0212158_318_476 | 3300034817 | Rhizosphere Soil | VRLVERRRGIYLTLRERTPTLGEPVDPHVTYPYRALAIHGTAKPVYVKLQGR |
| ⦗Top⦘ |