NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F091993

Metagenome / Metatranscriptome Family F091993

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091993
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 48 residues
Representative Sequence RRGITVYLRERTPSLGDPVDPRVTYPYRAITIARSSKPVYVKLQGRP
Number of Associated Samples 96
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.20 %
% of genes from short scaffolds (< 2000 bps) 92.52 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(24.299 % of family members)
Environment Ontology (ENVO) Unclassified
(31.776 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.402 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 20.00%    Coil/Unstructured: 80.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF01817CM_2 61.68
PF02577BFN_dom 27.10
PF14343PrcB_C 2.80
PF11706zf-CGNR 0.93
PF00873ACR_tran 0.93
PF04087DUF389 0.93
PF01740STAS 0.93
PF00571CBS 0.93
PF02195ParBc 0.93
PF03372Exo_endo_phos 0.93
PF00156Pribosyltran 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG1605Chorismate mutaseAmino acid transport and metabolism [E] 61.68
COG1259Bifunctional DNase/RNaseGeneral function prediction only [R] 27.10
COG1808Uncharacterized membrane protein AF0785, contains DUF389 domainFunction unknown [S] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459019|G14TP7Y01EHKDWAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria648Open in IMG/M
3300005093|Ga0062594_103412047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300005160|Ga0066820_1002950All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300005172|Ga0066683_10190358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1265Open in IMG/M
3300005328|Ga0070676_10603833All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300005336|Ga0070680_100688478All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300005364|Ga0070673_100678732All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300005366|Ga0070659_101499160All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300005441|Ga0070700_101948997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300005457|Ga0070662_100094825All Organisms → cellular organisms → Bacteria2248Open in IMG/M
3300005530|Ga0070679_101934575All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300005547|Ga0070693_100565666All Organisms → cellular organisms → Bacteria816Open in IMG/M
3300005547|Ga0070693_101585820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300005569|Ga0066705_10601032All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300005577|Ga0068857_100646773All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300005578|Ga0068854_102233190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300005614|Ga0068856_102531103All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300005713|Ga0066905_101539491All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300005713|Ga0066905_102067002All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300005834|Ga0068851_11053635All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300006031|Ga0066651_10659017All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300006031|Ga0066651_10840183All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300006046|Ga0066652_100273175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1489Open in IMG/M
3300006579|Ga0074054_12041240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300006794|Ga0066658_10439890All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300006797|Ga0066659_11085083All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300006804|Ga0079221_11519307All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300006845|Ga0075421_102160765All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300006954|Ga0079219_10071930All Organisms → cellular organisms → Bacteria1586Open in IMG/M
3300006954|Ga0079219_10559981All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300009093|Ga0105240_12752183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300009094|Ga0111539_12083262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria658Open in IMG/M
3300009148|Ga0105243_10654213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1019Open in IMG/M
3300010321|Ga0134067_10287572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300010321|Ga0134067_10362782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria573Open in IMG/M
3300010398|Ga0126383_10277974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1660Open in IMG/M
3300011107|Ga0151490_1615479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1273Open in IMG/M
3300011119|Ga0105246_10335358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1234Open in IMG/M
3300012496|Ga0157353_1014333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria698Open in IMG/M
3300012895|Ga0157309_10054769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1000Open in IMG/M
3300012915|Ga0157302_10406510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria563Open in IMG/M
3300012937|Ga0162653_100008118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1205Open in IMG/M
3300012939|Ga0162650_100076906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria574Open in IMG/M
3300012948|Ga0126375_11798160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300012951|Ga0164300_10313260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria826Open in IMG/M
3300012957|Ga0164303_10487567All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300012958|Ga0164299_10661179All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300012960|Ga0164301_10047328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2189Open in IMG/M
3300012987|Ga0164307_10346821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1076Open in IMG/M
3300013102|Ga0157371_10647844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria788Open in IMG/M
3300013297|Ga0157378_12525303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300013306|Ga0163162_10564729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1265Open in IMG/M
3300013765|Ga0120172_1015219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2348Open in IMG/M
3300014166|Ga0134079_10423141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria625Open in IMG/M
3300014820|Ga0120160_1038861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria869Open in IMG/M
3300014823|Ga0120170_1125771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300015371|Ga0132258_10201371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4829Open in IMG/M
3300015372|Ga0132256_101587254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria764Open in IMG/M
3300015373|Ga0132257_100647914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1309Open in IMG/M
3300015374|Ga0132255_101200109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1143Open in IMG/M
3300017657|Ga0134074_1125040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria892Open in IMG/M
3300018066|Ga0184617_1270988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300019362|Ga0173479_10163972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria902Open in IMG/M
3300019362|Ga0173479_10409814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria657Open in IMG/M
3300019362|Ga0173479_10443704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300021445|Ga0182009_10314473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria792Open in IMG/M
3300022889|Ga0247785_1009419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria998Open in IMG/M
3300023071|Ga0247752_1001572All Organisms → cellular organisms → Bacteria2944Open in IMG/M
3300024232|Ga0247664_1083548All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300024245|Ga0247677_1041298All Organisms → cellular organisms → Bacteria669Open in IMG/M
3300025899|Ga0207642_10454800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria776Open in IMG/M
3300025904|Ga0207647_10504778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria674Open in IMG/M
3300025912|Ga0207707_10928641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria718Open in IMG/M
3300025917|Ga0207660_10600021All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300025928|Ga0207700_10106523All Organisms → cellular organisms → Bacteria2247Open in IMG/M
3300025960|Ga0207651_10553482All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300025972|Ga0207668_11182558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300026023|Ga0207677_10280679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1367Open in IMG/M
3300026121|Ga0207683_10906707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria818Open in IMG/M
3300026295|Ga0209234_1045856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1663Open in IMG/M
3300027873|Ga0209814_10217653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria826Open in IMG/M
3300028717|Ga0307298_10089714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria867Open in IMG/M
3300028722|Ga0307319_10075320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1070Open in IMG/M
3300028744|Ga0307318_10017316All Organisms → cellular organisms → Bacteria2315Open in IMG/M
3300028744|Ga0307318_10201624All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300028755|Ga0307316_10282186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria606Open in IMG/M
3300028768|Ga0307280_10175072All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300028791|Ga0307290_10107748All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300028793|Ga0307299_10098988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1089Open in IMG/M
3300028793|Ga0307299_10303765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300028807|Ga0307305_10437260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria589Open in IMG/M
3300028809|Ga0247824_10439437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium760Open in IMG/M
3300028814|Ga0307302_10301149All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300028814|Ga0307302_10490993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300028814|Ga0307302_10598429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300030496|Ga0268240_10069171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria787Open in IMG/M
3300031093|Ga0308197_10061321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1007Open in IMG/M
3300031152|Ga0307501_10123540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria678Open in IMG/M
3300031421|Ga0308194_10387377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300031731|Ga0307405_10571743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria918Open in IMG/M
3300031903|Ga0307407_10613838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium811Open in IMG/M
3300031908|Ga0310900_10779635All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300031939|Ga0308174_11530614All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300031996|Ga0308176_10044826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3580Open in IMG/M
3300032074|Ga0308173_10752740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria894Open in IMG/M
3300032180|Ga0307471_101265162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium901Open in IMG/M
3300034817|Ga0373948_0212158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil24.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.67%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.74%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.74%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.80%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.80%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.87%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.87%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.87%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.87%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.87%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.87%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.93%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.93%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.93%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.93%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.93%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005160Soil and rhizosphere microbial communities from Laval, Canada - mgLMBEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012496Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012937Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015EnvironmentalOpen in IMG/M
3300012939Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014820Permafrost microbial communities from Nunavut, Canada - A15_80cm_0.25MEnvironmentalOpen in IMG/M
3300014823Permafrost microbial communities from Nunavut, Canada - A3_80cm_0MEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022889Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024245Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300030496Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4MG_041553002170459019Switchgrass, Maize And Mischanthus LitterNRGIYVYARERTPSLGEPVTPRITYPYRVLSMHGKAKPVYVKLEGR
Ga0062594_10341204723300005093SoilLTLRERTPTLGEPVDPHVTYPYRALAIHGTAKPVYVKLQGR*
Ga0066820_100295033300005160SoilYSLRAQRVVERRRGITVYLRERTPSLGDPVDPRVTYPYRAIAIARSSKPVYVKLQGRP*
Ga0066683_1019035853300005172SoilLRERAPLLGDPVEPRVTYPYRAITIARSSKPVSVKLQGRP*
Ga0070676_1060383333300005328Miscanthus RhizosphereRRGITVYLRERTPSLGDPVDPRVTYPYRAITIARSSKPVYVKLQGRP*
Ga0070680_10068847833300005336Corn RhizosphereRGIDVYLRERTPGLGDPVDPRVTYPYRALALASSSKPVYVKLQGRP*
Ga0070673_10067873213300005364Switchgrass RhizosphereRVVERRRGITVYLRERTPSLGDPVDPNVTYPYRAITIARSSKPVYVKLQGRP*
Ga0070659_10149916013300005366Corn RhizosphereTGYTLVIDRVLERRRGIYVYAHEQTPALGEPVDARVTYVYRVLTMHGRAKPVYVKLRGR*
Ga0070700_10194899713300005441Corn, Switchgrass And Miscanthus RhizosphereVRLVERRRGIYLTLRERTPTLGEPVDPHVTYPYRALAIHGTAKPVYVKLQGR*
Ga0070662_10009482513300005457Corn RhizosphereIYVYAHEQTPALGEPVDARVTYVYRVLTMHGRAKPVYVKLRGR*
Ga0070679_10193457533300005530Corn RhizosphereITVYLRERTPSLGDPVDPRVTYPYRAITIARSSKPVYVKLQGRP*
Ga0070693_10056566633300005547Corn, Switchgrass And Miscanthus RhizosphereGPRSSTGYELVVDRVLERRRGIYVYAHEQTPALGEPVDARVTYVYRVLTMHGRAKPVYVKLRGR*
Ga0070693_10158582013300005547Corn, Switchgrass And Miscanthus RhizosphereRVVRLVERRRGIYLTLRERTPTLGEPVDPHVTYPYRALAIHGTAKPVYVKLQGR*
Ga0066705_1060103213300005569SoilIYVYAHEQTPSLGEPVELHVTYVYRVLAMHGRAKPVYVKLQGR*
Ga0068857_10064677333300005577Corn RhizosphereYVYLREQTPDLGHPVDPRVTYPYRALALASSSKPVYVKLQGRP*
Ga0068854_10223319013300005578Corn RhizosphereVQRVVERRRGITVYLRERTPSLGDPVDPRVTYPYRAITIARSSKPVYVKLQGRP*
Ga0068856_10253110333300005614Corn RhizospherePTLGEPVEPHVTYPYRALAMRSSTKPVYVKLQRR*
Ga0066905_10153949133300005713Tropical Forest SoilTGYSLRIVRVVQRRRGVDVIVRERTPSLGDPVEPRVTYPYRAIAIRSTKTPVYVKLQGRP
Ga0066905_10206700233300005713Tropical Forest SoilVIVRERTPSLGDPVAARVTYPYRAVAIRSTKRPVYVKLQGRP*
Ga0068851_1105363533300005834Corn RhizosphereERTPSLGDPVDPRVTYPYRAITIARSSKPVYVKLQGRP*
Ga0066651_1065901713300006031SoilNRGIYVYAREQTPSLGEPVTPRVTYPYRVLSMHGKAKPVYVKLEGR*
Ga0066651_1084018313300006031SoilYSLRILSVVERRRGIYVDAREKTPSLGESVTARVTYVYRLLSMPGKAKPVYVKLQGR*
Ga0066652_10027317563300006046SoilYAHEQTPSLGEPVELHVTYVYRVLAMHGRAKPVYVKLRGR*
Ga0074054_1204124013300006579SoilRVVERRRGIYVYAREQTPSLGQPVQARVTYPYRVLSMHGSAKPVYVKLQGRP*
Ga0066658_1043989033300006794SoilVYRRERTPSLGDPVTARVTYPYRAIAIARSTKPVYVKLQGRP*
Ga0066659_1108508313300006797SoilRSSTGYSLRIDRVVERRRGIYVYAHEQTPSLGEPVELHVTYVYRVLAMHGRAKPVYVKLRGR*
Ga0079221_1151930713300006804Agricultural SoilSTGYSLRILRVVERRRGIYIDAREETPSLGEPVTARVTYVYRLLSMPGKAKPVYVKLQGR
Ga0075421_10216076533300006845Populus RhizosphereSLRVERVVERRREIDVYLRERAPSLGDPVEPRVTYPYRAITIARTSKPLSVKLQGRP*
Ga0079219_1007193063300006954Agricultural SoilEETPSLGEPVTARVTYVYRLLSMPGKAKPVYVKLQGR*
Ga0079219_1055998133300006954Agricultural SoilVERRRGVYLTLRERTPSLGEPVEARVTYPYLALAVRRSAKPVYVKLQGRP*
Ga0105240_1275218313300009093Corn RhizosphereGIYVYVREQTPTLGEPVTARVTYPYRVLSMHGSAKPVYVKLEGRP*
Ga0111539_1208326233300009094Populus RhizosphereSLGDPVEARVTYPYRAVAIRSTKRPVYVKLQGRP*
Ga0105243_1065421333300009148Miscanthus RhizosphereRVQRVVERRREIDIYVRERTPSLGDPVEPRVTYPYRAITIERSSKPVYVKLLGRP*
Ga0134067_1028757213300010321Grasslands SoilRVVERRRGIYVYAHEQTPSLGEPVELHVTYVYRVLAMHGRAKPVYVKLRGR*
Ga0134067_1036278233300010321Grasslands SoilSTGYSLRILSVVERRRGIYIDAREQTPSLGQSLKARVTFVYRLLSMHGRAKPVYVKLQGR
Ga0126383_1027797413300010398Tropical Forest SoilLVERRRGVYLTLRERTPTLGEPVDPHVTYPYRALAIPGTAKPVYVKLQGR*
Ga0151490_161547913300011107SoilRRGINVYVREQTPSLGDPVDPHVTYPYLAITIARSSKPVYVKLQGR*
Ga0105246_1033535813300011119Miscanthus RhizosphereLYLRERAPSLGDPVDPRVTYPYRAITIARSSKPVYVKLQGRP*
Ga0157353_101433313300012496Unplanted SoilVVERRRGIYVYAREVTPSLGEPVQPLITYPYRVLSMHGSAKPVYVKLEGRP*
Ga0157309_1005476913300012895SoilRRRGIYVYLRELPPSLGDPVEPRVTYPYLAIAIAHSSKPIYVKLQGRP*
Ga0157302_1040651013300012915SoilRRRGIYVYAREVTPSLGESVQPLITYPYRVLSMHGSAKSVYVKLEGRP*
Ga0162653_10000811843300012937SoilQTPTLGEPVKARVTYPYRVLSMHGSAKPVYVKLEGRP*
Ga0162650_10007690613300012939SoilLRVLERHRGINVYAREQTPSLGDPVTARITYPYRALAIRRSGKRVSVKLQGRP*
Ga0126375_1179816033300012948Tropical Forest SoilQRVVERRRGIDVIVRERTPSLGDPVEARVTYPYRAVAIRSTKRPVYVKLQGRP*
Ga0164300_1031326033300012951SoilYSLVIDRVLERRRGIYVYAHERTPSLGEPVEARVTYVYRVLAMHGRAKPVYVKLRGR*
Ga0164303_1048756733300012957SoilQRVVEQRRGIYVYLRERTPSLRDPVDPRVTYPYRAIAIARSTKPVYVKLQGRP*
Ga0164299_1066117933300012958SoilVVVRRRGITSKLSERILSLIDPVDPTKSYPYRAITIARSSKPVYVKLQGRP*
Ga0164301_1004732813300012960SoilAHEQTPALGEPVESRVTYVYRLLTRHGRAKPVYVNLRGR*
Ga0164307_1034682113300012987SoilERRRGITDYLRERTPSLSDPVDPRVTYPYRAITIARSSKPVYVKLQGRP*
Ga0157371_1064784433300013102Corn RhizosphereSLVVDRVVEQHRGIYVYAHERTPALGEPVEARVTYVYRVLSMHGRAKPVYVKLRGR*
Ga0157378_1252530313300013297Miscanthus RhizosphereGITVYLRERTPSLGDPVDPRVTYPYRAITIARSSKPVYVKLQGRP*
Ga0163162_1056472933300013306Switchgrass RhizosphereMRRISLGPRSSTGYELVVDRVLERRRGIYVFAHEQTPALGEPVDARVTYVYRVLTMHGRAKPVYVKLRGR*
Ga0120172_101521973300013765PermafrostRVVERHRGIYVYAREETPSLGDPVKPRITYPYRVLSMHGSAKPVYVKLEGRP*
Ga0134079_1042314133300014166Grasslands SoilGIYIYARERTPSLGEPVTPRVTYPFRVLSMHGKAKPVYVKLEGR*
Ga0120160_103886133300014820PermafrostLRVVERRRGIYVYAREETPSLGDPVKPRITYPYRLLSMHGSAKPVYVKLEGRP*
Ga0120170_112577133300014823PermafrostRRGIYVYAREETPALGDPVQPRVTYPYRVLSMHGSAKPVYVKLEGRP*
Ga0132258_10201371113300015371Arabidopsis RhizosphereVERRRGNYVYLRERTPGLGDPVDAHVTYPYRALTIARSSKPVYVKLQGRP*
Ga0132256_10158725433300015372Arabidopsis RhizosphereTLRERTPTLGEPVDPHVTYPYRALAIHGTAKPVYVKLQGR*
Ga0132257_10064791453300015373Arabidopsis RhizosphereTPSLGEPVMARVTYPYRAIAISRTGKPVYVKLQGRP*
Ga0132255_10120010943300015374Arabidopsis RhizosphereRRGIYVYLRERTPGLGDPVDAHVTYPYRALTIARSSKPVYVKLQGRP*
Ga0134074_112504033300017657Grasslands SoilDAREQAPSLGEPVTARVTYVYRLLSMPGKAKPVYVKLDGR
Ga0184617_127098823300018066Groundwater SedimentYVLRILRVFEQRRGIYIYAREQTPALGDPVEPRITYPYRVLSMHGSAKPVYVKLEGRP
Ga0173479_1016397233300019362SoilRSSTGYQLVIDRVLERRRGIYVYAHERTPALGEPVEARVTYVYRVLAMHGRAKPVYVKLRGR
Ga0173479_1040981413300019362SoilREIDVYLQERTPSLGDPVEPRVTYPYRAITIKRSGKPVYVKLQGRP
Ga0173479_1044370433300019362SoilREQAPSLGDPVEARVTYPYRAVAIRSTKRPVYVKLQGRP
Ga0182009_1031447313300021445SoilRTPALGEPVEARVTYVYRVLAMHGRAKPVYVKLRGR
Ga0247785_100941933300022889SoilVVERRRGVDVIVREQAPSLGDPVEARVTYPYRAVAIRSTKRPVYVKLQGRP
Ga0247752_100157213300023071SoilVRVVERRRGVDVIVREQAPSLGDPVEARVTYPYRAVAIRSTKRPVYVKLQGRP
Ga0247664_108354813300024232SoilPDLGHPVDPRVTYPYRALALASSSKPVYVKLQGRP
Ga0247677_104129813300024245SoilLVERRRGIYLTLRERTPTLGEPVDPHVTYPYRALAIHGTAKPVYVKLQGR
Ga0207642_1045480013300025899Miscanthus RhizosphereVLRVVERRRGIYVYVREQTPTLGEPDKAHVTYPYRVLSMHGSAKPVYVKLEGRP
Ga0207647_1050477813300025904Corn RhizosphereTPSLGDPVDPRVTYPYRAITIARSSKPVYVKLQGRP
Ga0207707_1092864133300025912Corn RhizosphereYVYAHEQTPALGEPVDTRVTYVYRVLTMHGRAKPVYVKLRGR
Ga0207660_1060002113300025917Corn RhizosphereERTPTLGEPVDPHVTYPYRALAIHGTAKPVYVKLQGR
Ga0207700_1010652313300025928Corn, Switchgrass And Miscanthus RhizosphereVERRRGIYLTLRERTPTLGEPVDPHVTYPYRALAIHGTAKPVYVKLQGR
Ga0207651_1055348233300025960Switchgrass RhizosphereRVQRVVERRRGITVYLRERTPSLGDPVDPNVTYPYRAITIARSSKPVYVKLQGRP
Ga0207668_1118255813300025972Switchgrass RhizosphereVQRVVERRRGITVCLRERTPSLGDPVDPRVTYPYRAITIARSSKPVYVKLQGRP
Ga0207677_1028067913300026023Miscanthus RhizosphereYELVVDRVLERRRGIYVYAHEQTPALGEPVDARVTYVYRVLTMHGRAKPVYVKLRGR
Ga0207683_1090670733300026121Miscanthus RhizosphereVYLRERTPGLGDPVDPRVTYPYRALALASSSKPVYVKLQGRP
Ga0209234_104585663300026295Grasslands SoilVYARERTPSLGDPVTAEVTYPYRVIAIRHSHKPVYVKLHGR
Ga0209814_1021765313300027873Populus RhizosphereREKTPSLGEPVTARVTYVYRLLSMPGKAKPVYVKLQGRP
Ga0307298_1008971433300028717SoilERRREIDVYLRERTPSLGDPVAPSVTYPYRAITIPRTSKPVYVKLQGRP
Ga0307319_1007532013300028722SoilVVEQRRGIYIYAREQTPALGDPVEPRITYPYRVLSMHGSAKPVYVKLEGRP
Ga0307318_1001731673300028744SoilYAREQTPSLGDPVTPGVTYPYRLLATPTTAKPVYVKLQGRP
Ga0307318_1020162433300028744SoilREETPALDDPVRPRITYPYRVLSMHGNAKPVYVKLEGRP
Ga0307316_1028218613300028755SoilRERTPALGDPVDPRVTYPYRAITIARTSKPVYVKLQGRP
Ga0307280_1017507233300028768SoilILRVVERRRGVYVYAREQTPSLGDPVTPGVTYPYRLLATPTTAKPVYVKLQGRP
Ga0307290_1010774833300028791SoilLRILHVAERRRGIDVYAREQTPSLGDPVTARITYPYRALAIRRSGKRVSVKLQGRP
Ga0307299_1009898843300028793SoilREQTPSLGDPVTPRITYPYRALAIRRSGKRVSVKLQGRP
Ga0307299_1030376533300028793SoilVERRRGIYVYVREQTPSLRDPVDPRVTYPYRALTIARSSKPVYVKLQGRP
Ga0307305_1043726013300028807SoilERHRGIDVYAREQTPSLGDPVTARITYPYRALAIRRSGKRVSVKLQGRP
Ga0247824_1043943733300028809SoilHDTHDPVEARVTYPYRAVAIRSTKRPVYVKLQGRP
Ga0307302_1030114933300028814SoilIYIYAREQTPALGDPVQPQITYPYRVLSMHGSAKPVYVKLEGRP
Ga0307302_1049099313300028814SoilYSLRIVHVAERRRGIDVYAREQTPSLGDPVTARITYPYRALAIRRSGKRVSVKLQGRP
Ga0307302_1059842913300028814SoilYAREQTPSLGDPVTARITYPYRALAIRRSGKRVSVKLQGRP
Ga0268240_1006917113300030496SoilEVTPSLGEPVGARVTYPYRAIAIARTGKTVYVKLQGRP
Ga0308197_1006132113300031093SoilYSLRILSVVERRRGIYVDAREETPSLGEPVTAGVTYVYRLLSMHGSAKPVYVKLEGRP
Ga0307501_1012354033300031152SoilRERTPSLRDPVAPRVTYPYRAITIARTAKPVYVKLQGRP
Ga0308194_1038737723300031421SoilPRSSTGYSLQIRRVVERRRGIYIDARERTPSLGESVTARVTYVYRLLSMPGKAKPVYVKLQGR
Ga0307405_1057174333300031731RhizosphereSTGHSLRTLRVVERRRGLTVYAREQTPALGDPVEPRVTYPYRLLALPRTSKPVSVKLEGR
Ga0307407_1061383813300031903RhizosphereLTVYAREQTPALGDPVEPRVTYPYRLLALPRTSKPVSVKLEGRP
Ga0310900_1077963513300031908SoilYSLRIVRVVERRRGVDVIVREQAPSLGDPVEARVTYPYRAVAIRSTKRPVYVKLQGRP
Ga0308174_1153061433300031939SoilVYLGERTPALGDPVEPRVTYPYRAITIPRTSKPVYVKLQGRP
Ga0308176_1004482673300031996SoilYVYVREVTPSLGDPVQARVTYPYRVLSMHGSAKPVYVKLEGRP
Ga0308173_1075274033300032074SoilRGIYVYLRERTPSLGDPVTARVTYPYRAIAIARTTKPVYVKLQGRP
Ga0307471_10126516213300032180Hardwood Forest SoilTPSLGDPVDPRVTYPYRAITIAHSSKPVYVKLQGRP
Ga0373948_0212158_318_4763300034817Rhizosphere SoilVRLVERRRGIYLTLRERTPTLGEPVDPHVTYPYRALAIHGTAKPVYVKLQGR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.