| Basic Information | |
|---|---|
| Family ID | F091991 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VSSEFEVQVTEDFEVAQATAETVRIEHSSPDRARARELFERL |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.28 % |
| % of genes near scaffold ends (potentially truncated) | 97.20 % |
| % of genes from short scaffolds (< 2000 bps) | 96.26 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.27 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.065 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.168 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.364 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.467 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF09055 | Sod_Ni | 12.15 |
| PF13581 | HATPase_c_2 | 6.54 |
| PF00717 | Peptidase_S24 | 2.80 |
| PF10009 | DUF2252 | 0.93 |
| PF12323 | HTH_OrfB_IS605 | 0.93 |
| PF13520 | AA_permease_2 | 0.93 |
| PF04542 | Sigma70_r2 | 0.93 |
| PF07336 | ABATE | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.93 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.93 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.93 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.93 |
| COG5516 | Uncharacterized conserved protein containing a Zn-ribbon-like motif, possibly RNA-binding | General function prediction only [R] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.07 % |
| Unclassified | root | N/A | 0.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001084|JGI12648J13191_1026921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300001356|JGI12269J14319_10038117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 3059 | Open in IMG/M |
| 3300001593|JGI12635J15846_10579583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300001593|JGI12635J15846_10755736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
| 3300003219|JGI26341J46601_10069186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1070 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10107405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1113 | Open in IMG/M |
| 3300004156|Ga0062589_102770845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 511 | Open in IMG/M |
| 3300004477|Ga0068971_1566625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 934 | Open in IMG/M |
| 3300004605|Ga0068952_1290161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 629 | Open in IMG/M |
| 3300005164|Ga0066815_10042869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis | 723 | Open in IMG/M |
| 3300005178|Ga0066688_10859241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
| 3300005180|Ga0066685_10847682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 615 | Open in IMG/M |
| 3300005363|Ga0008090_15598745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 747 | Open in IMG/M |
| 3300005458|Ga0070681_11378291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300005602|Ga0070762_10102591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1658 | Open in IMG/M |
| 3300005764|Ga0066903_104510332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae | 743 | Open in IMG/M |
| 3300006028|Ga0070717_11117970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis | 717 | Open in IMG/M |
| 3300006580|Ga0074049_13147073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 728 | Open in IMG/M |
| 3300006804|Ga0079221_10104373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1400 | Open in IMG/M |
| 3300006954|Ga0079219_10550846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 826 | Open in IMG/M |
| 3300009098|Ga0105245_13031228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300009700|Ga0116217_10523000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 744 | Open in IMG/M |
| 3300010339|Ga0074046_10253231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1092 | Open in IMG/M |
| 3300010359|Ga0126376_10591400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1048 | Open in IMG/M |
| 3300010866|Ga0126344_1259707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
| 3300011069|Ga0138592_1130596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
| 3300011072|Ga0138563_1106975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300012209|Ga0137379_10687357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 929 | Open in IMG/M |
| 3300012357|Ga0137384_11476774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
| 3300012505|Ga0157339_1002395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1262 | Open in IMG/M |
| 3300012683|Ga0137398_10864262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → environmental samples → uncultured Frankineae bacterium | 631 | Open in IMG/M |
| 3300012984|Ga0164309_11127056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300016387|Ga0182040_11672470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300017822|Ga0187802_10467446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300017955|Ga0187817_10358227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 931 | Open in IMG/M |
| 3300017970|Ga0187783_10362260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1055 | Open in IMG/M |
| 3300017973|Ga0187780_10662159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 751 | Open in IMG/M |
| 3300018006|Ga0187804_10285479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 717 | Open in IMG/M |
| 3300018062|Ga0187784_10595924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 888 | Open in IMG/M |
| 3300018431|Ga0066655_11166690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300018468|Ga0066662_10335750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales | 1291 | Open in IMG/M |
| 3300019181|Ga0184594_103153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
| 3300021388|Ga0213875_10239284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 855 | Open in IMG/M |
| 3300022709|Ga0222756_1055517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300022722|Ga0242657_1141107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 628 | Open in IMG/M |
| 3300022724|Ga0242665_10202371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → environmental samples → uncultured Frankineae bacterium | 655 | Open in IMG/M |
| 3300025320|Ga0209171_10547384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
| 3300025922|Ga0207646_11027075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 728 | Open in IMG/M |
| 3300025928|Ga0207700_11560727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 585 | Open in IMG/M |
| 3300026295|Ga0209234_1176002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 747 | Open in IMG/M |
| 3300026551|Ga0209648_10742169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 536 | Open in IMG/M |
| 3300027031|Ga0208986_1011217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 870 | Open in IMG/M |
| 3300027096|Ga0208099_1058622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
| 3300027110|Ga0208488_1033094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 946 | Open in IMG/M |
| 3300027165|Ga0208608_110192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
| 3300027504|Ga0209114_1029983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 913 | Open in IMG/M |
| 3300027651|Ga0209217_1172517 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300027652|Ga0209007_1166448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 545 | Open in IMG/M |
| 3300027676|Ga0209333_1047569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1186 | Open in IMG/M |
| 3300027680|Ga0207826_1105691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 773 | Open in IMG/M |
| 3300027692|Ga0209530_1122992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
| 3300027908|Ga0209006_10293098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1390 | Open in IMG/M |
| 3300028708|Ga0307295_10231522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
| 3300029944|Ga0311352_10476910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1012 | Open in IMG/M |
| 3300029951|Ga0311371_12618099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
| 3300030520|Ga0311372_10988217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1113 | Open in IMG/M |
| 3300030545|Ga0210271_10036888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 809 | Open in IMG/M |
| 3300030588|Ga0210283_1409415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 764 | Open in IMG/M |
| 3300030597|Ga0210286_1145058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Nocardiopsis | 674 | Open in IMG/M |
| 3300030629|Ga0210268_1206876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
| 3300030629|Ga0210268_1334604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300030730|Ga0307482_1094028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
| 3300030836|Ga0265767_110609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 618 | Open in IMG/M |
| 3300030969|Ga0075394_12097742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
| 3300031027|Ga0302308_10029073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4148 | Open in IMG/M |
| 3300031128|Ga0170823_10500327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300031233|Ga0302307_10333929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 773 | Open in IMG/M |
| 3300031543|Ga0318516_10887243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300031546|Ga0318538_10408579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
| 3300031561|Ga0318528_10769570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300031564|Ga0318573_10282933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 887 | Open in IMG/M |
| 3300031668|Ga0318542_10245554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 910 | Open in IMG/M |
| 3300031681|Ga0318572_10681965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
| 3300031719|Ga0306917_11001618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 652 | Open in IMG/M |
| 3300031736|Ga0318501_10457177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
| 3300031781|Ga0318547_10663923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
| 3300031799|Ga0318565_10340484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 728 | Open in IMG/M |
| 3300031805|Ga0318497_10690133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
| 3300031831|Ga0318564_10410260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300031846|Ga0318512_10689603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300031910|Ga0306923_10676323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1151 | Open in IMG/M |
| 3300031912|Ga0306921_11869323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
| 3300031941|Ga0310912_10260723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1336 | Open in IMG/M |
| 3300031954|Ga0306926_11229269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → environmental samples → uncultured Frankineae bacterium | 878 | Open in IMG/M |
| 3300031959|Ga0318530_10135987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 993 | Open in IMG/M |
| 3300032035|Ga0310911_10522754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
| 3300032055|Ga0318575_10458732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 647 | Open in IMG/M |
| 3300032059|Ga0318533_10742908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 720 | Open in IMG/M |
| 3300032065|Ga0318513_10272502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 821 | Open in IMG/M |
| 3300032067|Ga0318524_10427879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 691 | Open in IMG/M |
| 3300032174|Ga0307470_11189500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 618 | Open in IMG/M |
| 3300032770|Ga0335085_10559994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1293 | Open in IMG/M |
| 3300032783|Ga0335079_10304440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1738 | Open in IMG/M |
| 3300033158|Ga0335077_11277143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 714 | Open in IMG/M |
| 3300034124|Ga0370483_0018830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2022 | Open in IMG/M |
| 3300034818|Ga0373950_0049381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 823 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.17% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 13.08% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.67% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.87% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.87% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.93% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.93% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.93% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.93% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004477 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004605 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011069 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011072 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019181 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZI3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027031 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027110 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes) | Environmental | Open in IMG/M |
| 3300027165 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF035 (SPAdes) | Environmental | Open in IMG/M |
| 3300027504 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030545 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030588 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE011SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030597 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE046SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030629 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12648J13191_10269211 | 3300001084 | Forest Soil | VSSEFEVQVTEEFEVVRPPEPVLRVDTGSPDRARARELFERL |
| JGI12269J14319_100381171 | 3300001356 | Peatlands Soil | VSSEFEVQVTEEFEVAQATEELEVAQATTETVRIEHGSPDRARAR |
| JGI12635J15846_105795831 | 3300001593 | Forest Soil | VSSEFEVQVTEEFEIAEATEPSVRTERGSPDRARARELFE |
| JGI12635J15846_107557361 | 3300001593 | Forest Soil | VSSEFEVQVTEEFEVVRPPEPVLRVDTGSPDRARARELFERLS |
| JGI26341J46601_100691861 | 3300003219 | Bog Forest Soil | VSSEFEVQVTEDFEVAQATEDLEVAQATAETVRIEHGSPDR |
| JGIcombinedJ51221_101074051 | 3300003505 | Forest Soil | VSSEFEVQVTEELEVAQATAETVRIEHGSPDRARARELFERLA |
| Ga0062589_1027708451 | 3300004156 | Soil | VSSEFEVQVTEDYEVAQATAETVRIEHSSPDRARARELFERLAVLAPEDP |
| Ga0068971_15666252 | 3300004477 | Peatlands Soil | VSSEFEVQVTEDFEVAQATAETVRVEHGSPDRARARELFERLA* |
| Ga0068952_12901612 | 3300004605 | Peatlands Soil | VSSEFEVQVTEDFEVAQATAETVRIEHGSPDRARARELFERLAELP |
| Ga0066815_100428691 | 3300005164 | Soil | VSSEFEVQVTEDYEVAQATAETVRIEHGSPDRARARELFERLAGLP |
| Ga0066688_108592412 | 3300005178 | Soil | VSSEFEVQVTEDYEVAQATAETVRIEHSSPDRARARELFE |
| Ga0066685_108476821 | 3300005180 | Soil | VSSEFEVQVTEDVQVTEDYEVAQATAETVRIEHSSPDRARARELFERLAQ |
| Ga0008090_155987452 | 3300005363 | Tropical Rainforest Soil | VSSEFEVQVTEEFDVVQADAAMRVEPGSPDRGRARELFERLSEL |
| Ga0070681_113782911 | 3300005458 | Corn Rhizosphere | VSSEFEVQVTEDVQVTEDYEVAQATAETVRIEHSSPDRARAR |
| Ga0070762_101025911 | 3300005602 | Soil | VSGEFEVQVTEELEVVQAASETVRVEHGSPDRARAREMF |
| Ga0066903_1045103322 | 3300005764 | Tropical Forest Soil | VSSEFEVQVTEDFEVVQATAETMRIEHGSPDRARARELFERLAEL |
| Ga0070717_111179702 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGEFEVAQVADEFEVAQATAETVRIEHGSPDRARARELFERLAQLPPDDPE |
| Ga0074049_131470731 | 3300006580 | Soil | VSSEFEVQVTEELEVTQATAETVRIDHGSPDRARARELFERL |
| Ga0079221_101043733 | 3300006804 | Agricultural Soil | VSSEFEVQVTEDFEVAQATTETVRIEHSSPDRARARELFERLAVLA |
| Ga0079219_105508462 | 3300006954 | Agricultural Soil | VSSEFEVQVTEDFEVAQATAETVRIEHSSPDRARARELF |
| Ga0105245_130312282 | 3300009098 | Miscanthus Rhizosphere | VSSEFEVQVTEDYEVAQATAETVRIEHSSPDRARARELFERLAV |
| Ga0116217_105230001 | 3300009700 | Peatlands Soil | VSSEYELQVTDEFDVIQATEPPVRVEHGSPDRARAREMFERLAVHPAGDPERA |
| Ga0074046_102532311 | 3300010339 | Bog Forest Soil | VSSEFEVQVTEELEVIQATEELEVAQATAETVRIEHGSP |
| Ga0126376_105914001 | 3300010359 | Tropical Forest Soil | VSGEFEVAQVADEFEVAQATAETVRIEHGSPDRARARELFERLAQLPPEDP |
| Ga0126344_12597071 | 3300010866 | Boreal Forest Soil | VSSEFEVQVTEDFEVAQATAETVRIEHGSPDRARARELFERLTALPADE |
| Ga0138592_11305961 | 3300011069 | Peatlands Soil | VSSEFEVQVTEHFEVAQATAETVRIEHGSPDRARARELFER |
| Ga0138563_11069751 | 3300011072 | Peatlands Soil | VSSEFEVQVTEDFEVAQATAETVRVEHGSPDRARARELFERLA |
| Ga0137379_106873571 | 3300012209 | Vadose Zone Soil | VSSEFEVQVTEDFEVAQATTETVRIEHSSPDRARARE |
| Ga0137384_114767742 | 3300012357 | Vadose Zone Soil | VSSEFEVQVTEDYEVAQATAETVRIEHSSPDRARARELF |
| Ga0157339_10023953 | 3300012505 | Arabidopsis Rhizosphere | VSSEFEVQVTEDYEVAQATAETVRIEHSSPDRARARE |
| Ga0137398_108642621 | 3300012683 | Vadose Zone Soil | VSSEFEIQVTEEFEVAQVTAEAVRVEHGSPDRARARELFERLAQL |
| Ga0164309_111270561 | 3300012984 | Soil | VSGEFEVAQVADEFEVAQATAETVRIEHGSPDRARARELFERLAQLPPD |
| Ga0182040_116724702 | 3300016387 | Soil | VSSEFEVQVTEEFEVAQATAETVRIETGSPDRARARELFERL |
| Ga0187802_104674462 | 3300017822 | Freshwater Sediment | VSSEFEVQVTEEFEVVQAEAAQAETAQAEVVLRIEHSSPDRARARELFERLAELP |
| Ga0187817_103582273 | 3300017955 | Freshwater Sediment | VSSEFEVQVTEDLEVAQATAETVRIEHGSPDRARARELFERLAELPADDP |
| Ga0187783_103622603 | 3300017970 | Tropical Peatland | VSSEFEVQVTEEFEVVQAETVIRIEHESPPDRARARELFERLPELPADDPGRARIRGY |
| Ga0187780_106621591 | 3300017973 | Tropical Peatland | VSSEFEVRVSSEFEVQVTEEFEVVQAAAEMRIEHGSPDRARARELFERL |
| Ga0187804_102854792 | 3300018006 | Freshwater Sediment | VSSEFEVQVTEEFEVQVTEELEVAQATAETVRIEHGSPDRARARELFER |
| Ga0187784_105959241 | 3300018062 | Tropical Peatland | VSSEFEVQVTEEFEVVQAEAVRAEAALRIEHSSPDRARAR |
| Ga0066655_111666902 | 3300018431 | Grasslands Soil | VSSEFEVQVTEDYEVAQATAETVRIEHSSPDRARA |
| Ga0066662_103357501 | 3300018468 | Grasslands Soil | VSSEFEAQVTEDVDVTEDYEVAQATPEAGRIEDCSHAAGPASDVFERLAQVPA |
| Ga0184594_1031532 | 3300019181 | Soil | VSSEFEVQVTEDFEVAQTTAETVRIEHGSPDRARAR |
| Ga0213875_102392841 | 3300021388 | Plant Roots | VSGEFEVAQVAEELELAHDPEVAQATAETARIERGSPDRARARELFERLT |
| Ga0222756_10555171 | 3300022709 | Soil | VSSEFEVQVTEEFEVTLPPVRAESGSPDRARAREMFERLATLPKEDPERA |
| Ga0242657_11411071 | 3300022722 | Soil | VSSEFEVQVTEDFEVAQATAETVRIEHGSPDRARA |
| Ga0242665_102023711 | 3300022724 | Soil | VSSEFEVQVTEELEVAQATAEAVRIEHGSPDRARARELFER |
| Ga0209171_105473842 | 3300025320 | Iron-Sulfur Acid Spring | VSSEFEVQVTEEFEVARAAEPVLRIEGGSPDRARAR |
| Ga0207646_110270752 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSEFEVQVTEDVQVTEDYEVAQATAETVRIEHSSPDRARA |
| Ga0207700_115607271 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VSSEFEVQVTEDFEVAQATAETVRIEHSSPDRARARELFER |
| Ga0209234_11760022 | 3300026295 | Grasslands Soil | VSGEFEVQVTEDYEVAQATAETVRIEHSSPDRARARELFERLAVL |
| Ga0209648_107421691 | 3300026551 | Grasslands Soil | VSSEFEVQVTEEFEVAQTTAETVRIEHGSPDRARARELFERL |
| Ga0208986_10112172 | 3300027031 | Forest Soil | VSSEFEVQVTEDYEVARATAETVRIEHSSPDRARARELFERL |
| Ga0208099_10586222 | 3300027096 | Forest Soil | VSSEFEVQVTEDFEVAQTAAETVRIEHGSPDRARARELFERLAE |
| Ga0208488_10330942 | 3300027110 | Forest Soil | VSSEFEVQVTEEFEVAQATDHTVRIEHGSPDRARARELFERL |
| Ga0208608_1101922 | 3300027165 | Forest Soil | VSSEFEVQVTEEFEVAQATDQTVRIEHGSPDRARARE |
| Ga0209114_10299833 | 3300027504 | Forest Soil | VSSEYEVQVTEDPEVAQATAETARMERSSPDRARAR |
| Ga0209217_11725172 | 3300027651 | Forest Soil | VSSEFEVQVTEDFEVAQATAETVRIEHGSPDRARARELFERLAE |
| Ga0209007_11664482 | 3300027652 | Forest Soil | VSSEFEVQVTEEFEVEAPVMRAESSGSPDRARAREMFE |
| Ga0209333_10475691 | 3300027676 | Forest Soil | VSSEYEAQMTEDPEVIQATAEIRIDHGSPDRARARELFERLAVLPP |
| Ga0207826_11056911 | 3300027680 | Tropical Forest Soil | VSNEFEVQVTEEFDVVQAEAAMRVEHSPPDRGRARELFERL |
| Ga0209530_11229921 | 3300027692 | Forest Soil | VSSEFEVQVTEEFEIAEATEPSVRTERGSPDRARARELFERL |
| Ga0209006_102930981 | 3300027908 | Forest Soil | VSGEFEVQVTEELEVVQAASETVRVEHGSPDRARAREMFERLAVLPA |
| Ga0307295_102315222 | 3300028708 | Soil | VSSEFEVQVTEDYEVAQATAETVRIEHSSPDRARARELFERLAVLPP |
| Ga0311352_104769103 | 3300029944 | Palsa | VSSEFEVQVTEDPDVAQATAEVVRVERGSPDRARARELFERLAVLPAD |
| Ga0311371_126180991 | 3300029951 | Palsa | VSSEFEVQVTEDPEVAQATAEVVRVERGSPDRARARELFERLSVLPADDPE |
| Ga0311372_109882173 | 3300030520 | Palsa | VSGEFEVQVTEEFEVAQATEQTVRIEHSSPDRARAREMFERLAVLPA |
| Ga0210271_100368883 | 3300030545 | Soil | VSGEFEVQVTEELEVVQAASETVRVEHGSPDRARAREMFERLAVLPAELIKTRFN |
| Ga0210283_14094152 | 3300030588 | Soil | VSGEFEVQVTEELEVVQAASETVRVEHGSPDRARAREMFERLAVLPADDP |
| Ga0210286_11450581 | 3300030597 | Soil | VSSEFGVQVTEDFEVAQATAETVRIEHGSPDRARARELFERLTQLPADDPE |
| Ga0210268_12068761 | 3300030629 | Soil | VSGEFEVQVTEELEVVQAASETVRVEHGSPDRARAREMFERLAVLP |
| Ga0210268_13346042 | 3300030629 | Soil | MSSEFEVQVTEDFEVAQATTETVRVERGSPDRARARELFQR |
| Ga0307482_10940281 | 3300030730 | Hardwood Forest Soil | VSSEFEVQVTEELEVAQATAETVRIEHGSPDRARARELFE |
| Ga0265767_1106091 | 3300030836 | Soil | VSSEFEVQVTEELEVAQATAETVRIEHGSPDRARARE |
| Ga0075394_120977421 | 3300030969 | Soil | VSSEFEVQVTEEFEVAQATAETVRIEHGSPDRARARELFERLAEL |
| Ga0302308_100290731 | 3300031027 | Palsa | VSSEFEVQVTEEFEMAQATEQTVRIEHSSPDRARAREMFERLAVLPADDPER |
| Ga0170823_105003272 | 3300031128 | Forest Soil | VSSEFEVQVTEDFEVAQATADVVRVERGSPDRARARELFERLA |
| Ga0302307_103339292 | 3300031233 | Palsa | VSSEFEVQVTEELEVVQATSETVRIEHGSPDRARARALF |
| Ga0318516_108872432 | 3300031543 | Soil | VSSEFEVQVTEEFEVNQATAETVRIEHSSPDRARAREL |
| Ga0318538_104085791 | 3300031546 | Soil | VSSEFEVQVTEEFEVAQATAETVRIEHSSPDRARARELFERLAQLAPDDP |
| Ga0318528_107695702 | 3300031561 | Soil | VSSEFEVQVTEELEVVQAGAAHAEAALRIEHSSPDRARARELFERLAGLP |
| Ga0318573_102829332 | 3300031564 | Soil | VSSEFEVQVTEEFEVVQAEAAQAEAALRIEHSSPDRA |
| Ga0318542_102455542 | 3300031668 | Soil | VSSEFEVQVTEEFDVVEVDAAMRAEHGSPDRGRARELFERLSE |
| Ga0318572_106819652 | 3300031681 | Soil | VSSEFEVQVTEELEVVQATAETVRIEHGSPDRARARELFERLAELPAG |
| Ga0306917_110016182 | 3300031719 | Soil | VSSEFEVQVTEDFEVAQATAETVRIEHSSPDRARARELFERLTEL |
| Ga0318501_104571771 | 3300031736 | Soil | VSSEFEVQVTEEFEVAQATPETVRIEHSSPDRARARELFERLAQLAPDD |
| Ga0318547_106639232 | 3300031781 | Soil | VSSEFEVQVTEEFEVAQATPETVRIEHSSPDRARARELFERLAQ |
| Ga0318565_103404842 | 3300031799 | Soil | VSSEFEVQVTEEFDVVEVDAAMRAEHGSPDRGRARE |
| Ga0318497_106901331 | 3300031805 | Soil | VSSEFEVQVTEDFEVAQATAETVRIEHSSPDRARARELFERLAGLAPGRARSA |
| Ga0318564_104102602 | 3300031831 | Soil | VSSEFEVQVTEEFEVAQATAETVRIEHSSPDRARARELFERLAQLAP |
| Ga0318512_106896031 | 3300031846 | Soil | VSSEFEVQVTEEFEVVQATAETVRLEHGSPDRARAR |
| Ga0306923_106763233 | 3300031910 | Soil | VSSEFEVQVTEEFEVAQATAETVRIEHSSPDRARARELFERLAQLA |
| Ga0306921_118693232 | 3300031912 | Soil | VSSEFEVQVTEDFEVAQATAETVRIEHSSPDRARARE |
| Ga0310912_102607233 | 3300031941 | Soil | VSSEFEVQVTEDFEVVQATAETVRLEHGSPDRARARELFERLAELPPDDP |
| Ga0306926_112292691 | 3300031954 | Soil | VSSEFEVQVTEDFEVVQATAETVRLEHGSPDRARARE |
| Ga0318530_101359871 | 3300031959 | Soil | VSSEFEVQVTEELEVVQPGAAHAEAALRIEHSSPDRARARELFERLA |
| Ga0310911_105227542 | 3300032035 | Soil | VSSEFEVQVTEEFEVVQAEAAQAEAALRIEHSSPDRARARELFGRLAELPP |
| Ga0318575_104587321 | 3300032055 | Soil | VSSEFEVQVTEELEVVQAGAAHAEAALRIEHSSPDRARAR |
| Ga0318533_107429081 | 3300032059 | Soil | VSSEFEVQVTEEFEVAQATAETVRIEHSSPDRARA |
| Ga0318513_102725023 | 3300032065 | Soil | VSSEFEVQVTEDFEVAQATAETVRIEHSSPDRARARELFG |
| Ga0318524_104278792 | 3300032067 | Soil | VSSEFEVQVTEDFEVAQATAETVRIEHSSPDRARARELFERLAVLAPDD |
| Ga0307470_111895001 | 3300032174 | Hardwood Forest Soil | VSSEFEVQVTEELEVAQATAEAVRIEHGSPDRARARELFERLAELPP |
| Ga0335085_105599941 | 3300032770 | Soil | VSSEFEVQVTEDFEVAQATAETVRIEHSSPDRARARELFERL |
| Ga0335079_103044404 | 3300032783 | Soil | VSSEFEVQVTEEFEVAQATAETVRIEHGSPDRARARELFE |
| Ga0335081_1002503513 | 3300032892 | Soil | VSSEFEVQVTEDVQVTEDVQVTEDFEVAQATAETVRIEHSSPDRARARELFERL |
| Ga0335077_112771432 | 3300033158 | Soil | VSNEYEVQVTEDLDVVQATAEIRIDQGSPDRARARELFER |
| Ga0370483_0018830_1889_2020 | 3300034124 | Untreated Peat Soil | VSSEFEVQVTEEFEVAQATSQTVRVENGSPDRARAREMFERLAI |
| Ga0373950_0049381_698_823 | 3300034818 | Rhizosphere Soil | VSSEFEVQVTEDYEVAQATAETVRIEHSSPDRARARELFERL |
| ⦗Top⦘ |