| Basic Information | |
|---|---|
| Family ID | F091961 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MIQVFQYPHETLLQTSTPWTETDSIQGYDDREKFESDMIR |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 89.72 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 96.26 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.766 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (20.561 % of family members) |
| Environment Ontology (ENVO) | Unclassified (59.813 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.654 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.59% β-sheet: 2.94% Coil/Unstructured: 76.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF01556 | DnaJ_C | 80.37 |
| PF06945 | DUF1289 | 2.80 |
| PF07087 | DUF1353 | 1.87 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.93 |
| PF00565 | SNase | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0484 | DnaJ-class molecular chaperone with C-terminal Zn finger domain | Posttranslational modification, protein turnover, chaperones [O] | 80.37 |
| COG3313 | Predicted Fe-S protein YdhL, DUF1289 family | General function prediction only [R] | 2.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.72 % |
| Unclassified | root | N/A | 10.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001344|JGI20152J14361_10073189 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300001349|JGI20160J14292_10073818 | All Organisms → Viruses → Predicted Viral | 1354 | Open in IMG/M |
| 3300001460|JGI24003J15210_10035713 | All Organisms → Viruses → Predicted Viral | 1773 | Open in IMG/M |
| 3300001460|JGI24003J15210_10073649 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300001460|JGI24003J15210_10105292 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300002483|JGI25132J35274_1090411 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300005430|Ga0066849_10109150 | All Organisms → Viruses → Predicted Viral | 1098 | Open in IMG/M |
| 3300006027|Ga0075462_10037723 | All Organisms → Viruses → Predicted Viral | 1549 | Open in IMG/M |
| 3300006027|Ga0075462_10171265 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300006637|Ga0075461_10132401 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300006735|Ga0098038_1079637 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300006921|Ga0098060_1074107 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300007234|Ga0075460_10219491 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300007276|Ga0070747_1319489 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300007609|Ga0102945_1068355 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300008097|Ga0111541_10354883 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300009001|Ga0102963_1411022 | Not Available | 531 | Open in IMG/M |
| 3300009433|Ga0115545_1041751 | All Organisms → Viruses → Predicted Viral | 1797 | Open in IMG/M |
| 3300009437|Ga0115556_1269985 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300009498|Ga0115568_10487246 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300009786|Ga0114999_10558879 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300010299|Ga0129342_1233895 | Not Available | 644 | Open in IMG/M |
| 3300010300|Ga0129351_1294125 | Not Available | 615 | Open in IMG/M |
| 3300010318|Ga0136656_1259899 | Not Available | 570 | Open in IMG/M |
| 3300012520|Ga0129344_1070729 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300012928|Ga0163110_11296101 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300012954|Ga0163111_11337856 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300016737|Ga0182047_1061424 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300016745|Ga0182093_1543966 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300017713|Ga0181391_1093761 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300017727|Ga0181401_1070136 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300017742|Ga0181399_1070186 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300017745|Ga0181427_1060205 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300017746|Ga0181389_1198071 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300017750|Ga0181405_1173169 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300017755|Ga0181411_1050723 | All Organisms → Viruses → Predicted Viral | 1279 | Open in IMG/M |
| 3300017763|Ga0181410_1219466 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300017776|Ga0181394_1210520 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300017781|Ga0181423_1068343 | All Organisms → Viruses → Predicted Viral | 1407 | Open in IMG/M |
| 3300017782|Ga0181380_1064641 | All Organisms → Viruses → Predicted Viral | 1293 | Open in IMG/M |
| 3300017952|Ga0181583_10534561 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300017962|Ga0181581_10701869 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56 | 608 | Open in IMG/M |
| 3300017969|Ga0181585_10769708 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300018039|Ga0181579_10187121 | All Organisms → cellular organisms → Bacteria | 1224 | Open in IMG/M |
| 3300018410|Ga0181561_10070648 | All Organisms → Viruses → Predicted Viral | 2035 | Open in IMG/M |
| 3300018413|Ga0181560_10053900 | All Organisms → Viruses → Predicted Viral | 2381 | Open in IMG/M |
| 3300018415|Ga0181559_10658121 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300018417|Ga0181558_10538261 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300018421|Ga0181592_10722292 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56 | 663 | Open in IMG/M |
| 3300019459|Ga0181562_10358911 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300019765|Ga0194024_1092333 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300020056|Ga0181574_10507927 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300020169|Ga0206127_1084148 | All Organisms → Viruses → Predicted Viral | 1410 | Open in IMG/M |
| 3300020178|Ga0181599_1119573 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300020189|Ga0181578_10255448 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300020276|Ga0211509_1077858 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300020281|Ga0211483_10128874 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56 | 837 | Open in IMG/M |
| 3300020339|Ga0211605_1042804 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300020401|Ga0211617_10251149 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300020402|Ga0211499_10193641 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300020403|Ga0211532_10109558 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300020404|Ga0211659_10022653 | All Organisms → Viruses | 3077 | Open in IMG/M |
| 3300020408|Ga0211651_10162221 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300020414|Ga0211523_10184777 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300020420|Ga0211580_10298422 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300020428|Ga0211521_10360037 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300020428|Ga0211521_10500055 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56 | 522 | Open in IMG/M |
| 3300020436|Ga0211708_10483660 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300020440|Ga0211518_10473641 | Not Available | 568 | Open in IMG/M |
| 3300020451|Ga0211473_10283345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 851 | Open in IMG/M |
| 3300020454|Ga0211548_10328799 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300021347|Ga0213862_10262154 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300021389|Ga0213868_10697037 | Not Available | 519 | Open in IMG/M |
| 3300021957|Ga0222717_10547304 | Not Available | 616 | Open in IMG/M |
| 3300021958|Ga0222718_10329597 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300021958|Ga0222718_10550724 | Not Available | 549 | Open in IMG/M |
| 3300021959|Ga0222716_10212226 | All Organisms → Viruses → Predicted Viral | 1218 | Open in IMG/M |
| 3300021961|Ga0222714_10422316 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300022922|Ga0255779_1325234 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300022925|Ga0255773_10091076 | All Organisms → Viruses → Predicted Viral | 1637 | Open in IMG/M |
| 3300023117|Ga0255757_10105068 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1682 | Open in IMG/M |
| 3300023119|Ga0255762_10472665 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300023170|Ga0255761_10224257 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300023176|Ga0255772_10590562 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300023180|Ga0255768_10297210 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300025120|Ga0209535_1183295 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56 | 613 | Open in IMG/M |
| 3300025620|Ga0209405_1186893 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300025632|Ga0209194_1037628 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300025653|Ga0208428_1089397 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300025707|Ga0209667_1216002 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300025712|Ga0209305_1180468 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300025769|Ga0208767_1003437 | Not Available | 11525 | Open in IMG/M |
| 3300025771|Ga0208427_1259592 | Not Available | 531 | Open in IMG/M |
| 3300025815|Ga0208785_1122839 | Not Available | 619 | Open in IMG/M |
| 3300025889|Ga0208644_1267311 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300025892|Ga0209630_10327117 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300027704|Ga0209816_1278920 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56 | 514 | Open in IMG/M |
| 3300027714|Ga0209815_1224098 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300028008|Ga0228674_1039183 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
| 3300028008|Ga0228674_1120995 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300031519|Ga0307488_10306367 | All Organisms → Viruses → Predicted Viral | 1020 | Open in IMG/M |
| 3300031519|Ga0307488_10607674 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56 | 633 | Open in IMG/M |
| 3300031689|Ga0308017_1048036 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300031785|Ga0310343_11312263 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300031848|Ga0308000_10378175 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56 | 539 | Open in IMG/M |
| 3300032073|Ga0315315_10712623 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300032373|Ga0316204_10795927 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 20.56% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 16.82% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.28% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 10.28% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 9.35% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.61% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.67% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.74% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.80% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.80% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.87% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.87% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.87% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.87% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.93% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.93% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.93% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.93% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.93% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
| 3300008097 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (version 2) | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300012520 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300016737 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016745 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041411BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017750 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020056 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101410AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020178 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041405US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020189 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020276 | Marine microbial communities from Tara Oceans - TARA_E500000075 (ERX289007-ERR315858) | Environmental | Open in IMG/M |
| 3300020281 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116) | Environmental | Open in IMG/M |
| 3300020339 | Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX555929-ERR599080) | Environmental | Open in IMG/M |
| 3300020401 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139) | Environmental | Open in IMG/M |
| 3300020402 | Marine microbial communities from Tara Oceans - TARA_B000000609 (ERX555971-ERR599057) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020408 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022922 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG | Environmental | Open in IMG/M |
| 3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
| 3300023117 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG | Environmental | Open in IMG/M |
| 3300023119 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025620 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025707 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025712 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031689 | Marine microbial communities from water near the shore, Antarctic Ocean - #280 | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| 3300031848 | Marine microbial communities from water near the shore, Antarctic Ocean - #3 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20152J14361_100731891 | 3300001344 | Pelagic Marine | MIQVFQYPHETLLQTSTVWKEDDSIDGYNDVERFESDVIKLMLDERGM |
| JGI20160J14292_100738183 | 3300001349 | Pelagic Marine | MIQVFQYPHETLLQTSTVWKEDDSIDGYNDVERFESDVIKLMLDERGMGLA |
| JGI24003J15210_100357131 | 3300001460 | Marine | MIQVFQYPHETLLQTSTQWTATDSIQGYNDVEQFESDVIKLMLEERGM |
| JGI24003J15210_100736491 | 3300001460 | Marine | MIQVFQYPHETLSQTSTQWTATDSIQGYNDVEQFESDVIKLMLEERGM |
| JGI24003J15210_101052922 | 3300001460 | Marine | MIQVFQFPHETLLQTSTAWKEGDSIDGYDDLEKFE |
| JGI25132J35274_10904112 | 3300002483 | Marine | MIQVFQYPHETLLQTSTAWSHGDSIEGYDDLEKFENEYVNLMLNE |
| Ga0066849_101091501 | 3300005430 | Marine | MIQVFQYPHETLMQVSSEWKHDDTIQGYDDIEKFESDYIKLML |
| Ga0075462_100377231 | 3300006027 | Aqueous | MIKVYQYPHETLLQTSTPWTPDDRIEGYDDIEQFERDMI |
| Ga0075462_101712651 | 3300006027 | Aqueous | MIQVFQYPHETLMQVSTEWKSEDSIVGYDDVERFE |
| Ga0075461_101324013 | 3300006637 | Aqueous | MIQVFQYPHETLMQVSTEWKSEDSIVGYDDVERFETDMIKLMLDERGMG |
| Ga0098038_10796373 | 3300006735 | Marine | MIQVFQYPHETLLQTSTPWTETDTIQGYDDVEKFETDMIKLMLDERG |
| Ga0098060_10741071 | 3300006921 | Marine | MIQVFQYPHKTLMQTSTSWTQNDSINGYNDLEKFESDMIKLMLDE |
| Ga0075460_102194911 | 3300007234 | Aqueous | MIKVYQYPHETLLQTSTPWTENDRIEGYDDIEQFERDMIRLMLDEKGM |
| Ga0070747_13194891 | 3300007276 | Aqueous | MIQVFQYPHETLLQTSTAWKEGDSIDGYDDLEKFESDMIKLMLDERGMG |
| Ga0102945_10683554 | 3300007609 | Pond Water | MIKVYQYPHETLLQTSTHWTADDSIDGYNDLERFETDMIKL |
| Ga0111541_103548831 | 3300008097 | Marine | MIQLFQYPHETLLQVSTPWTKDDGIDGYSDIERFESDMLM |
| Ga0102963_14110223 | 3300009001 | Pond Water | MIKVYQYPHETLLRTSTPWTKDDRIEGYDDLERFETDIIKLML |
| Ga0115545_10417511 | 3300009433 | Pelagic Marine | MIQVFQYPHETLLQTSTSWTQDDSIIGYDDIEKFEED |
| Ga0115556_12699853 | 3300009437 | Pelagic Marine | MIQVFQYPHETLLQTSTSWTQDDSIIGYDDIEKFEEDMIKLMLNERG |
| Ga0115568_104872463 | 3300009498 | Pelagic Marine | MIQVFQYPHETLLQTSTVWKEDDSIDGYNDVERFESDVIKLMLDERGMGL |
| Ga0114999_105588793 | 3300009786 | Marine | MIQVFQYPHETLLQTSTSWTKTDNIQGYNDVEQFESDMIK |
| Ga0129342_12338953 | 3300010299 | Freshwater To Marine Saline Gradient | MIKVYQYPHETLLQTSTPWIADDRIEGYDDLERFESDMIRLMLDEKGMGLA |
| Ga0129351_12941252 | 3300010300 | Freshwater To Marine Saline Gradient | MIKVYQYPHETLLQTSTPWTEGDRIDGYDDLERFET |
| Ga0136656_12598991 | 3300010318 | Freshwater To Marine Saline Gradient | MIKVYQYPHETLLQTSTPWTENDRIEGYDDIEQFERDMVRLMLDEKG |
| Ga0129344_10707294 | 3300012520 | Aqueous | MIKVYQYPHETLLQTSTPWTEHDRIEGYDDIEQFERDMIRLMLDE |
| Ga0163110_112961012 | 3300012928 | Surface Seawater | MIQLFQYPHETLLQTSTEWSHDDSIEGYDDLQKFENDYIKLMLDEKGMGLAAN |
| Ga0163111_113378563 | 3300012954 | Surface Seawater | MIKLFQYPHETLLQTSTPWTDKDVIHGYDDKEKFQYDMIKLMLDEKGMGLA |
| Ga0182047_10614241 | 3300016737 | Salt Marsh | MIQVFQYPHETLMQVSTEWKSEDSIVGYADVERFETDV |
| Ga0182093_15439663 | 3300016745 | Salt Marsh | MIKVYQYPHETLLQTSTPWTENDRIEGYDDIEQFERDMIKLMLDEKGMGL |
| Ga0181391_10937611 | 3300017713 | Seawater | MIQLFQYPHDTLLKTSTAWSHDDTIEGYDDIEKFENDYVKLM |
| Ga0181401_10701361 | 3300017727 | Seawater | MIQVFQYPHETLLQTSTAWTEGDSIDGYDDKEQFEHDMIRLMLDEKGMGLAAN |
| Ga0181399_10701863 | 3300017742 | Seawater | MIQVFQYPHETLLQTSTPWTETDNIQGYDDREKFESDMIRLMLD |
| Ga0181427_10602053 | 3300017745 | Seawater | MIQLFQYPHETLLQTSTAWTKQDSIQGYDDLEKFERDMIKLMLAE |
| Ga0181389_11980711 | 3300017746 | Seawater | MIKVFQYPHESLLQTSTAWADGDRIQGYADIEQFEQDMIKLMLDERGISF |
| Ga0181405_11731691 | 3300017750 | Seawater | MIQLFQYPHETLLQTSTCWKDDDSIDGYDDLERFESDVIK |
| Ga0181411_10507231 | 3300017755 | Seawater | MIQVFQYPHETLTRVSTEWNKDDSIEGYNDIEKFEHDYVQLMLNEHGMG |
| Ga0181410_12194663 | 3300017763 | Seawater | MIQVFQYPHETLLQTSTAWTEGDSIDGYDDKEQFEHDMIRL |
| Ga0181394_12105202 | 3300017776 | Seawater | MIKVFQYPHETLLQTSTPWTQDDSIAGYNDIERFETGMIKLMLDEKGMG |
| Ga0181423_10683433 | 3300017781 | Seawater | MIQLFQYPHETLLQTSTAWKEDDSIDGYDDLERFESDVIKLMLDE |
| Ga0181380_10646411 | 3300017782 | Seawater | MIQVFQYPHETLLQTSTPWTETDSIQGYDDREKFESDMIR |
| Ga0181583_105345611 | 3300017952 | Salt Marsh | VIEVFQYPHETLLQTSTPWTEQDRIEGYDDIEQFERDMI |
| Ga0181581_107018693 | 3300017962 | Salt Marsh | MIKVYQYPHETLLQTSTPWTADDHIEGYDDVEQFER |
| Ga0181585_107697083 | 3300017969 | Salt Marsh | MIKVYQYPHETLLQTSIPWTENDRIEGYDDIEQFERDMIKLMLDERGMGLA |
| Ga0181579_101871211 | 3300018039 | Salt Marsh | MIKVYQYPHETLLQKSTEWKKTDTIDGYDDLERFEHDA |
| Ga0181561_100706481 | 3300018410 | Salt Marsh | MMQVFQYPHETLLQTSTPWTETDSIQGYNDKEKFESDMIK |
| Ga0181560_100539006 | 3300018413 | Salt Marsh | MIQVFQYPHETLLQTSTPWTEADTIQGYEDKERFERDMVK |
| Ga0181559_106581211 | 3300018415 | Salt Marsh | MIQVFQYPHETLLQTSTAWTDEDSIQGYDDKEKFESDMIKVMLDERGMG |
| Ga0181558_105382613 | 3300018417 | Salt Marsh | MIQVFQYPHETLMQASTAWTNSDTIKGYDDKEKFE |
| Ga0181592_107222923 | 3300018421 | Salt Marsh | MIKVYQYPHETLLQTSTPWTADDHIEGYDDVEQFERDMIKVMLAEK |
| Ga0181562_103589112 | 3300019459 | Salt Marsh | MIKVYQYPHEALLQKSTEWKKTDTIDGYDDIERFEQDAVKLMLDEKGMGLAA |
| Ga0194024_10923331 | 3300019765 | Freshwater | MIQLFQYPHETLLQTSTPWTENDRIEGYDDIEKFETDMIKLMLD |
| Ga0181574_105079271 | 3300020056 | Salt Marsh | MIQVFQYPHETLMQASTAWTDTDSIQGYADLEKFEDDMIKLMLDEKGMG |
| Ga0206127_10841481 | 3300020169 | Seawater | MIQLFQYPHETLLQTSTVWKEDDSIDGYDDLERFESD |
| Ga0181599_11195731 | 3300020178 | Salt Marsh | MIKVYQYPHETLLQTSTPWTENDRIEGYDDIEQFERDMI |
| Ga0181578_102554481 | 3300020189 | Salt Marsh | MIKVYQYPHETLLQTSTPWMADDSIDGYDDLERFETDMI |
| Ga0211509_10778581 | 3300020276 | Marine | MIKVYQYPHETLLQTSTAWSHDDTIEGYDDIENFENEYIKLML |
| Ga0211483_101288743 | 3300020281 | Marine | MMQVFQYPHETLLQASTEWNHTDTIEEYDDMEKFENDYIKL |
| Ga0211605_10428041 | 3300020339 | Marine | MEIFQYPHDTLSKESSVWTHEDSISGYDDIEKFEKDYIQLMLDAK |
| Ga0211617_102511494 | 3300020401 | Marine | MMQIFQYPYETLTQVSTEWKSDDSIQGYSDIEKFEQ |
| Ga0211499_101936411 | 3300020402 | Marine | MIQIFQYPHETLLQKSSEWKHGDTIEGYSDIEKFEKDYIKLMLD |
| Ga0211532_101095581 | 3300020403 | Marine | MIQVFQYPHETLLQSSTEWTKNDSIQGYNDIEKFEVDMIKSM |
| Ga0211659_100226538 | 3300020404 | Marine | MIQVFQYPYETLTQVSTNWGKEDSIEGYNDIAKFEHDYIKLMVD |
| Ga0211651_101622211 | 3300020408 | Marine | MIQVFQYPHETLMQVSSEWKHEDTIQGYDDIEKFE |
| Ga0211523_101847773 | 3300020414 | Marine | MIQVFQYPHETLLQTSTAWTDQDSIQGYDDKENFEHDMIKVMLEEKG |
| Ga0211580_102984221 | 3300020420 | Marine | VIQLFQYPHETLLQTSTEWNHNDKIEGYDDIENFES |
| Ga0211521_103600372 | 3300020428 | Marine | MIQLFQYPHETLLQTSTVWKEDDSIDGYDDVERFESDVIKLMLDEH |
| Ga0211521_105000552 | 3300020428 | Marine | MIQLFQYPHLTLMQTSTPWTQDDSINGYDDIEKFENDFI |
| Ga0211708_104836602 | 3300020436 | Marine | MMQVFQYPHETLMQVSSDWKSEDTIQGYSDIEKFENDFIKLM |
| Ga0211518_104736412 | 3300020440 | Marine | MIKVYQYPYETLLQTSTPWTKTDTIEGYDDQEKFES |
| Ga0211473_102833451 | 3300020451 | Marine | VIQVFQYPHETLMQISTEWKTEDSIEGYDDIEKFENDYIKLMIDEKGMGL |
| Ga0211548_103287991 | 3300020454 | Marine | MIQIFQYPHETLMQISSHWTKNDSIEGYNDIEKFEHDYIKLMKDNFGMG |
| Ga0213862_102621541 | 3300021347 | Seawater | MIQVFQYPHETLMQVSTEWRADDSIEGYDDKEKFESDMIKLMLDERGMG |
| Ga0213868_106970373 | 3300021389 | Seawater | MIKVYQYPHETLLQTSTPWTADDRIDGYDDIEQFERDMIRLMLDE |
| Ga0222717_105473043 | 3300021957 | Estuarine Water | MIKVYQYPHETLLQTSTPWTADDRIDGYDDLDKFETDMIKLMLDEKGMGL |
| Ga0222718_103295971 | 3300021958 | Estuarine Water | MIKVYQYPHETLLQTSTPWTEDDHIEGYDDIEQFERDMIKVMLDEKGMG |
| Ga0222718_105507243 | 3300021958 | Estuarine Water | MIKVYQYPHETLLQTSTPWTEGDRINGYDDIERFESDMIRLMLDEKGM |
| Ga0222716_102122261 | 3300021959 | Estuarine Water | MIQVFQYPHETLLQTSTAWTDTDTIEGYDDQEKFESD |
| Ga0222714_104223161 | 3300021961 | Estuarine Water | MIKVYQYPHETLLQTSTPWTENDRIEGYDDIEQFERDMIKVM |
| Ga0255779_13252341 | 3300022922 | Salt Marsh | MIQVFQYPHETLLQKSTGWKKTDKIQGYDDLEKFEHDMIKLMLVEKG |
| Ga0255773_100910764 | 3300022925 | Salt Marsh | MIQVFQYPHETLMQVSTEWKSEDSIVGYDDVEKFET |
| Ga0255757_101050685 | 3300023117 | Salt Marsh | MIKVYQYPHETLLQTSTPWTEADRIEGYDDIERFE |
| Ga0255762_104726651 | 3300023119 | Salt Marsh | MIQVFQYPHETLLQVSTTWSDTDSIKGYDDKEKFEQDMIKVM |
| Ga0255761_102242571 | 3300023170 | Salt Marsh | MIQLFQYPHETLLQTSTPWTENDRIEEYDDIEKFETDMIKL |
| Ga0255772_105905621 | 3300023176 | Salt Marsh | MIKVYQYPHETLLQTSTPWMANDHIKGYDDIERFERDMIHLMLDE |
| Ga0255768_102972101 | 3300023180 | Salt Marsh | MIQVFQYPHETLLQTSTPWTEADTIQGYEDKERFEK |
| Ga0209535_11832952 | 3300025120 | Marine | MIELFQYPHETLLQTSTSWTETDSIQGYNDVEQFESDMIKLMLEE |
| Ga0209405_11868931 | 3300025620 | Pelagic Marine | MIQVFQYPHETLLQTSTVWKEDDSIDGYDDLERFE |
| Ga0209194_10376284 | 3300025632 | Pelagic Marine | MIQVFQYPHETLLQTSTPWTQDDSIAGYDDKDKFETDMIKLMLKERGMGLAA |
| Ga0208428_10893971 | 3300025653 | Aqueous | MIQVFQYPYETLMQTSTPWTDHDSIQGYDDKEKFES |
| Ga0209667_12160021 | 3300025707 | Marine | MIQVFQYPHETLMQVSTEWKSEDSIDGYDDIEKFEHDYIKLMLAQYGMG |
| Ga0209305_11804683 | 3300025712 | Pelagic Marine | MIQVFQYPHETLLQTSTSWTQDDSIIGYDDIEKFEEDMIKLMLNER |
| Ga0208767_10034371 | 3300025769 | Aqueous | MIKVYQYPHETLLQTSTSWTADDRINGYDDIEQFEQD |
| Ga0208427_12595923 | 3300025771 | Aqueous | MIKVYQYPHETLLQTSTPWTEVDRIEGYDDVEQFER |
| Ga0208785_11228393 | 3300025815 | Aqueous | MIKVYQYPHETLLQTSTPWTPDDRIEGYDDIEQFER |
| Ga0208644_12673113 | 3300025889 | Aqueous | VIEVFQYPHETLLQTSTPWTKEDNIKGYDDIERFESD |
| Ga0209630_103271171 | 3300025892 | Pelagic Marine | MIQVFQYPHDTLLQTSTPWTEADEIQGYDDKEKFEKDMVQLMLDEN |
| Ga0209816_12789201 | 3300027704 | Marine | MIQVFQYPHETLTQMSSAWGESDTIQGYDDIEKFEKDMIQLMVDERALG |
| Ga0209815_12240982 | 3300027714 | Marine | MINLKHYPHEALLQTSTEWTQNDSITGYDDIEKFGADM |
| Ga0228674_10391835 | 3300028008 | Seawater | MIQVFQYPHETLLQTSTPWTETDTIQGYDDVEKFETDM |
| Ga0228674_11209951 | 3300028008 | Seawater | MIQVFQYPHETLLQTSTPWTQDDSIAGYDDKEKFETDMIKLMLE |
| Ga0307488_103063671 | 3300031519 | Sackhole Brine | MIQLFQYPHETLLQTSTPWTETDTIQGYDDQEKFESDMI |
| Ga0307488_106076741 | 3300031519 | Sackhole Brine | MIELFQYPHETLLQTSTSWTETDSIQGYNDVEQFES |
| Ga0308017_10480361 | 3300031689 | Marine | MIQVFQYPHETLTQMSSAWGESDTIQGYDDIEKFEKD |
| Ga0310343_113122631 | 3300031785 | Seawater | MIQLFQYPHQTLMQVSTEWTSGDSIDGYSDIEKFEYDYIK |
| Ga0308000_103781751 | 3300031848 | Marine | MIQVFQYPHETLTQMSSAWGESDTIQGYDDIEKFEKDMIQL |
| Ga0315315_107126233 | 3300032073 | Seawater | MIQLFQYPHETLLQTSTAWTKQDSIQGYDDLEKFERDMIKLMLAEKGM |
| Ga0316204_107959271 | 3300032373 | Microbial Mat | MIQVFQYPHETLLQTSTPWTDTDSIQGYDDRERFESDMIRLMLDEKG |
| ⦗Top⦘ |