| Basic Information | |
|---|---|
| Family ID | F091936 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MNDGLDRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 46.67 % |
| % of genes near scaffold ends (potentially truncated) | 41.12 % |
| % of genes from short scaffolds (< 2000 bps) | 68.22 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (67.290 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (20.561 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.991 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (45.794 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.30% β-sheet: 0.00% Coil/Unstructured: 61.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF04973 | NMN_transporter | 20.56 |
| PF00166 | Cpn10 | 10.28 |
| PF02675 | AdoMet_dc | 8.41 |
| PF13640 | 2OG-FeII_Oxy_3 | 3.74 |
| PF00085 | Thioredoxin | 3.74 |
| PF09834 | DUF2061 | 1.87 |
| PF08241 | Methyltransf_11 | 0.93 |
| PF08007 | JmjC_2 | 0.93 |
| PF07739 | TipAS | 0.93 |
| PF14579 | HHH_6 | 0.93 |
| PF00082 | Peptidase_S8 | 0.93 |
| PF01844 | HNH | 0.93 |
| PF06067 | DUF932 | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 20.56 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 10.28 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 8.41 |
| COG2850 | Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain | Translation, ribosomal structure and biogenesis [J] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.57 % |
| Unclassified | root | N/A | 22.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000736|JGI12547J11936_1010779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2365 | Open in IMG/M |
| 3300000736|JGI12547J11936_1043283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
| 3300000756|JGI12421J11937_10017199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2706 | Open in IMG/M |
| 3300000756|JGI12421J11937_10022208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2329 | Open in IMG/M |
| 3300000756|JGI12421J11937_10042023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1546 | Open in IMG/M |
| 3300000756|JGI12421J11937_10061531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1164 | Open in IMG/M |
| 3300002835|B570J40625_100059272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5275 | Open in IMG/M |
| 3300003490|JGI25926J51410_1038296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 866 | Open in IMG/M |
| 3300003499|JGI25930J51415_1021988 | Not Available | 1193 | Open in IMG/M |
| 3300004054|Ga0063232_10222298 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300004112|Ga0065166_10015057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2176 | Open in IMG/M |
| 3300005517|Ga0070374_10087816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1621 | Open in IMG/M |
| 3300005527|Ga0068876_10651501 | Not Available | 566 | Open in IMG/M |
| 3300005662|Ga0078894_10006587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9005 | Open in IMG/M |
| 3300005941|Ga0070743_10072702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1162 | Open in IMG/M |
| 3300005941|Ga0070743_10137765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
| 3300006639|Ga0079301_1087472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 966 | Open in IMG/M |
| 3300006917|Ga0075472_10156859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1118 | Open in IMG/M |
| 3300007545|Ga0102873_1000193 | Not Available | 22969 | Open in IMG/M |
| 3300007546|Ga0102874_1282323 | Not Available | 500 | Open in IMG/M |
| 3300007547|Ga0102875_1148894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 735 | Open in IMG/M |
| 3300007547|Ga0102875_1232437 | Not Available | 566 | Open in IMG/M |
| 3300007551|Ga0102881_1043152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1266 | Open in IMG/M |
| 3300007557|Ga0102821_1000167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 27894 | Open in IMG/M |
| 3300007559|Ga0102828_1039203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1081 | Open in IMG/M |
| 3300007606|Ga0102923_1253615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300007629|Ga0102895_1139665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300007634|Ga0102901_1226905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300007658|Ga0102898_1006835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2565 | Open in IMG/M |
| 3300007658|Ga0102898_1010689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2027 | Open in IMG/M |
| 3300007992|Ga0105748_10267638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
| 3300008055|Ga0108970_10588879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300008108|Ga0114341_10221060 | All Organisms → Viruses → Predicted Viral | 1649 | Open in IMG/M |
| 3300008116|Ga0114350_1111937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
| 3300008117|Ga0114351_1426466 | Not Available | 548 | Open in IMG/M |
| 3300008120|Ga0114355_1095056 | All Organisms → Viruses → Predicted Viral | 1187 | Open in IMG/M |
| 3300008120|Ga0114355_1098605 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1155 | Open in IMG/M |
| 3300008120|Ga0114355_1107622 | All Organisms → Viruses → Predicted Viral | 1080 | Open in IMG/M |
| 3300008262|Ga0114337_1251072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
| 3300008266|Ga0114363_1002210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11066 | Open in IMG/M |
| 3300008964|Ga0102889_1014008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2585 | Open in IMG/M |
| 3300008964|Ga0102889_1246211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300008996|Ga0102831_1046631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1455 | Open in IMG/M |
| 3300009024|Ga0102811_1146326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
| 3300009419|Ga0114982_1229293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300010309|Ga0102890_1048083 | Not Available | 842 | Open in IMG/M |
| 3300010354|Ga0129333_10858468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
| 3300011268|Ga0151620_1032480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1773 | Open in IMG/M |
| 3300012666|Ga0157498_1006015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1983 | Open in IMG/M |
| 3300013004|Ga0164293_10021809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5347 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10055489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3755 | Open in IMG/M |
| 3300013372|Ga0177922_11274766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1880 | Open in IMG/M |
| 3300014050|Ga0119952_1047225 | Not Available | 1190 | Open in IMG/M |
| 3300017761|Ga0181356_1013851 | All Organisms → Viruses → Predicted Viral | 3032 | Open in IMG/M |
| 3300017788|Ga0169931_10028580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6707 | Open in IMG/M |
| 3300019784|Ga0181359_1004933 | All Organisms → Viruses → Predicted Viral | 4289 | Open in IMG/M |
| 3300020074|Ga0194113_10218037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1510 | Open in IMG/M |
| 3300020109|Ga0194112_10985071 | Not Available | 535 | Open in IMG/M |
| 3300020197|Ga0194128_10146217 | Not Available | 1356 | Open in IMG/M |
| 3300020511|Ga0208593_1037104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300020533|Ga0208364_1001571 | All Organisms → Viruses → Predicted Viral | 4569 | Open in IMG/M |
| 3300020548|Ga0208856_1011137 | All Organisms → Viruses → Predicted Viral | 1467 | Open in IMG/M |
| 3300021962|Ga0222713_10009969 | Not Available | 8605 | Open in IMG/M |
| 3300021962|Ga0222713_10127308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1789 | Open in IMG/M |
| 3300021963|Ga0222712_10023207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5093 | Open in IMG/M |
| 3300024343|Ga0244777_10063475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2369 | Open in IMG/M |
| 3300024346|Ga0244775_10551799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 938 | Open in IMG/M |
| 3300024346|Ga0244775_10821521 | Not Available | 742 | Open in IMG/M |
| 3300027114|Ga0208009_1001183 | Not Available | 7418 | Open in IMG/M |
| 3300027121|Ga0255074_1039877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300027131|Ga0255066_1017645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1047 | Open in IMG/M |
| 3300027131|Ga0255066_1026529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
| 3300027247|Ga0208679_1084613 | Not Available | 554 | Open in IMG/M |
| 3300027278|Ga0208439_1025302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1209 | Open in IMG/M |
| 3300027281|Ga0208440_1077292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 694 | Open in IMG/M |
| 3300027571|Ga0208897_1089827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
| 3300027581|Ga0209651_1086973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
| 3300027644|Ga0209356_1130440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300027697|Ga0209033_1086221 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1051 | Open in IMG/M |
| 3300027720|Ga0209617_10064274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1521 | Open in IMG/M |
| 3300027753|Ga0208305_10101828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1075 | Open in IMG/M |
| 3300027797|Ga0209107_10002736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium | 9783 | Open in IMG/M |
| 3300027797|Ga0209107_10034401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2899 | Open in IMG/M |
| 3300027804|Ga0209358_10037883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2921 | Open in IMG/M |
| 3300027804|Ga0209358_10319049 | Not Available | 757 | Open in IMG/M |
| 3300031857|Ga0315909_10345710 | Not Available | 1089 | Open in IMG/M |
| 3300031857|Ga0315909_10530666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
| 3300031951|Ga0315904_11010080 | Not Available | 658 | Open in IMG/M |
| 3300032050|Ga0315906_10580113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 928 | Open in IMG/M |
| 3300032116|Ga0315903_11126165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
| 3300033978|Ga0334977_0405110 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
| 3300033981|Ga0334982_0368663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300033992|Ga0334992_0000229 | Not Available | 48211 | Open in IMG/M |
| 3300033992|Ga0334992_0032927 | All Organisms → Viruses → Predicted Viral | 3076 | Open in IMG/M |
| 3300034013|Ga0334991_0067594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1803 | Open in IMG/M |
| 3300034013|Ga0334991_0168416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 980 | Open in IMG/M |
| 3300034020|Ga0335002_0080771 | Not Available | 2259 | Open in IMG/M |
| 3300034060|Ga0334983_0581743 | Not Available | 614 | Open in IMG/M |
| 3300034068|Ga0334990_0002101 | Not Available | 11475 | Open in IMG/M |
| 3300034082|Ga0335020_0435254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300034093|Ga0335012_0579556 | Not Available | 521 | Open in IMG/M |
| 3300034102|Ga0335029_0041793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3404 | Open in IMG/M |
| 3300034166|Ga0335016_0046610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3408 | Open in IMG/M |
| 3300034168|Ga0335061_0001160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13295 | Open in IMG/M |
| 3300034200|Ga0335065_0641396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 20.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 16.82% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.95% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.48% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 5.61% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.67% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 4.67% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.80% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 2.80% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.80% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.80% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.80% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.87% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.93% |
| Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.93% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.93% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.93% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.93% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007551 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 | Environmental | Open in IMG/M |
| 3300007557 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300007629 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 | Environmental | Open in IMG/M |
| 3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
| 3300007658 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008964 | Estuarine microbial communities from the Columbia River estuary - metaG 1551A-02 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010309 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020511 | Freshwater microbial communities from Lake Mendota, WI - 15JUL2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020548 | Freshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027131 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027247 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027278 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes) | Environmental | Open in IMG/M |
| 3300027281 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12547J11936_10107792 | 3300000736 | Freshwater And Sediment | MNDGLDRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND* |
| JGI12547J11936_10432832 | 3300000736 | Freshwater And Sediment | MSEMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND* |
| JGI12421J11937_1001719911 | 3300000756 | Freshwater And Sediment | MNDGLDRSMRLKLVIEEMLKDIDLSGEEWNDRDKDGVAYWEKWNKND* |
| JGI12421J11937_100222081 | 3300000756 | Freshwater And Sediment | DGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND* |
| JGI12421J11937_100420234 | 3300000756 | Freshwater And Sediment | MTNPDRDRSMRLKRVIEEMXKDIDMSGEEWNDRDKDGVAYWEKWHKADDR* |
| JGI12421J11937_100615313 | 3300000756 | Freshwater And Sediment | MTEMTSLGDDFDRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGIPYWEKWHKADD* |
| B570J40625_10005927210 | 3300002835 | Freshwater | MTNPDRNRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGIPYWEKWHKADD* |
| JGI25926J51410_10382963 | 3300003490 | Freshwater Lake | MSEMNDGLDRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND* |
| JGI25930J51415_10219883 | 3300003499 | Freshwater Lake | MTSDRNRSMRLKLAIEEMLKDIDMSGEEWNDRDKDGVAYWEKWDKADDR* |
| Ga0063232_102222981 | 3300004054 | Freshwater Lake | MSEMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEK |
| Ga0066177_105228662 | 3300004096 | Freshwater Lake | MTNPDRDRSMRLKLAIEDMLKDIDMSGEEWNDRDKNGIAYWEKYSEEGTN* |
| Ga0065166_100150574 | 3300004112 | Freshwater Lake | MTNLDRDRSMRLKLAIEELLKDVDMSGEEWDDYDKDGVPYWEKWDK* |
| Ga0070374_100878164 | 3300005517 | Freshwater Lake | MTEMTSVGDDFDRSMRLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND* |
| Ga0068876_106515012 | 3300005527 | Freshwater Lake | VTNPDRDRSMRLKLAIEEMLKDIDMSGEEWNDRDKDDVAYWEKWDK* |
| Ga0078894_1000658710 | 3300005662 | Freshwater Lake | MSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND* |
| Ga0070743_100727023 | 3300005941 | Estuarine | MSKMNEDFDRSMRLKLVIEDMLKDIDMSSEEWNDRDKDGVAYWEKWNKND* |
| Ga0070743_101377651 | 3300005941 | Estuarine | QMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNNND* |
| Ga0079301_10874724 | 3300006639 | Deep Subsurface | MRLKLVIEEMLKDIDMSGEEWNDRDKDGIPYWEKWHKADD* |
| Ga0075472_101568595 | 3300006917 | Aqueous | MNDRDRSMRLKLAIEELLKDVDMSGEEWDDYDKDGVPYWEKWDK* |
| Ga0102873_100019343 | 3300007545 | Estuarine | MNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND* |
| Ga0102874_12823232 | 3300007546 | Estuarine | IKTESLHGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNNND* |
| Ga0102875_11488944 | 3300007547 | Estuarine | EDFDRSMRLKLVIEDMLKDIDMSSEEWNDRDKDGVAYWEKWNKND* |
| Ga0102875_12324371 | 3300007547 | Estuarine | LHGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNNND* |
| Ga0102881_10431524 | 3300007551 | Estuarine | IKMESLHGKRIQMSKMNEDFDRSMRLKLVIEDMLKDIDMSSEEWNDRDKDGVAYWEKWNKND* |
| Ga0102821_10001671 | 3300007557 | Estuarine | DRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND* |
| Ga0102828_10392034 | 3300007559 | Estuarine | MESLHGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND |
| Ga0102923_12536151 | 3300007606 | Estuarine | EMTSVGDDFDRSMRLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND* |
| Ga0102895_11396652 | 3300007629 | Estuarine | MNDGLDRSMRLKLVIEDMLKDIDMSGVEWNDRDKDGVAYWEKWNNND* |
| Ga0102901_12269053 | 3300007634 | Estuarine | LKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND* |
| Ga0102898_10068351 | 3300007658 | Estuarine | SKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND* |
| Ga0102898_10106891 | 3300007658 | Estuarine | MESLHGKRIQMTEMTSVGDDFDRSMRLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKN |
| Ga0105748_102676381 | 3300007992 | Estuary Water | MRLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND* |
| Ga0108970_105888792 | 3300008055 | Estuary | MENLHGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND |
| Ga0114341_102210604 | 3300008108 | Freshwater, Plankton | MRLKLAIEEMLKDIDMSGEEWNDRDKDGVAYWEKWDK* |
| Ga0114350_11119372 | 3300008116 | Freshwater, Plankton | MRLKLVIEDMLKDIDMSGEEWNDRDKDGIPYWEKWHKADD* |
| Ga0114351_14264662 | 3300008117 | Freshwater, Plankton | MCLKLVIEEMLKDIDMSGEERNDRDKDGIPYWEKWHKADD* |
| Ga0114355_10950562 | 3300008120 | Freshwater, Plankton | MRLKLAIEEMLKDIDMSGEEWNDRDKDGVAYWEKWDKADDR* |
| Ga0114355_10986051 | 3300008120 | Freshwater, Plankton | MTEMTSVGDDRDRSMRLKLAIEEMLKDIDMSGEEWNDHDKDGKPYWEKY |
| Ga0114355_11076221 | 3300008120 | Freshwater, Plankton | MRLKLAIEEMLKDIDMSGEEWNDHDKDGKPYWEKY |
| Ga0114337_12510723 | 3300008262 | Freshwater, Plankton | MRLKIVIEEMLKDIDMSGEEWNDRDKNGVAYWEKWDKNG* |
| Ga0114363_100221025 | 3300008266 | Freshwater, Plankton | MTNLDQNRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGIPYWEKWHKADD* |
| Ga0102889_10140081 | 3300008964 | Estuarine | GKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND* |
| Ga0102889_12462112 | 3300008964 | Estuarine | MNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNNND* |
| Ga0102831_10466312 | 3300008996 | Estuarine | MNEDFDRSMRLKLVIEDMLKDIDMSSEEWNDRDKDGVAYWEKWNKND* |
| Ga0102811_11463263 | 3300009024 | Estuarine | MNDGLDRSMRLKLVIEDMLKDIYMSGEEWNDRDKDGVAYWEKWNNND* |
| Ga0114982_12292933 | 3300009419 | Deep Subsurface | SIKMESLHGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKNGVAYWEKWDKND* |
| Ga0102890_10480834 | 3300010309 | Estuarine | SLHGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND* |
| Ga0129333_108584681 | 3300010354 | Freshwater To Marine Saline Gradient | DRNRSMRLKLAIEEMLKDIDMSGEEWNDRDKDGVAYWEKWDKGGRSESDAR* |
| Ga0151620_10324801 | 3300011268 | Freshwater | MNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKNDLIG* |
| Ga0157498_10060155 | 3300012666 | Freshwater, Surface Ice | MTSVGDDFDRSMRLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND* |
| Ga0164293_100218098 | 3300013004 | Freshwater | MRLKLAIEDMLKDIDMSGEEWNDRDKNGIAYWEKYSEEETN* |
| (restricted) Ga0172372_100554893 | 3300013132 | Freshwater | MMDRSERLKMVIEELLKDIDMSGEEWNDYDKEGIPYWEKWDKND* |
| Ga0177922_112747661 | 3300013372 | Freshwater | MESLHGKRIQMTEMTSVGDDFDRSMRLKRVIEEMLKDIDMSGEEWNDRDKDGV |
| Ga0119952_10472253 | 3300014050 | Freshwater | MRLKLAIEELLKDIDMSGEEWNDYDKDGVPYWEKWDK* |
| Ga0181356_10138511 | 3300017761 | Freshwater Lake | IGLSIKMESLHGKRIQMTEMTSVGDDFDRSMRLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND |
| Ga0169931_1002858011 | 3300017788 | Freshwater | MMDRSERLKMVIEELLKDIDMSGEEWNDYDKEGIPYWEKWDKND |
| Ga0181359_10049337 | 3300019784 | Freshwater Lake | MTEMTSVGDDFDRSMRLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND |
| Ga0194113_102180372 | 3300020074 | Freshwater Lake | MMDRSERLKMVIEELLKDIDMSGEEWNDYDKDGIPYWEKWDKND |
| Ga0194112_109850712 | 3300020109 | Freshwater Lake | MDRSERLKMVIEELLKDIDMSGEEWNDYDKDGIPYWEKWDKND |
| Ga0194128_101462171 | 3300020197 | Freshwater Lake | MMDRSERLKMVIEELLKDIDMSGEEWNDYDKDGIPYWEKWD |
| Ga0208593_10371041 | 3300020511 | Freshwater | MSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNNND |
| Ga0208364_100157115 | 3300020533 | Freshwater | MTNPDRDRSMRLKLAIEEMLKDIDMSGEEWNDRDKDGIPYWEKWHKAD |
| Ga0208856_10111376 | 3300020548 | Freshwater | MRLKLVIEEMLKDIDMSGEEWNDRDKDGIPYWEKWHKADD |
| Ga0222713_1000996911 | 3300021962 | Estuarine Water | MSEMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKNGVAYWEKWDKND |
| Ga0222713_101273087 | 3300021962 | Estuarine Water | QMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND |
| Ga0222712_100232071 | 3300021963 | Estuarine Water | DGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKNGVAYWEKWDKND |
| Ga0244777_100634758 | 3300024343 | Estuarine | MSKMNEDFDRSMRLKLVIEDMLKDIDMSSEEWNDRDKDGVAYWEKWNKND |
| Ga0244775_105517991 | 3300024346 | Estuarine | VIEEMLKDIDMSGEEWNDRDKDGVAYWEKWHKADDR |
| Ga0244775_108215212 | 3300024346 | Estuarine | LKIVIEELLKDIDMSGEEWNDRDKDGVAYWEKWDK |
| Ga0208009_100118319 | 3300027114 | Deep Subsurface | MTNPDRDRSMRLKLAIEDMLKDIDMSGEEWNDRDKNGIAYWEKYSEEGTN |
| Ga0255074_10398771 | 3300027121 | Freshwater | MSNMNDGLDRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND |
| Ga0255066_10176453 | 3300027131 | Freshwater | SIKMESLHGKRIQMSKMNDGLDRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND |
| Ga0255066_10265291 | 3300027131 | Freshwater | LHGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNNND |
| Ga0208679_10846133 | 3300027247 | Estuarine | AIGLSIKMESLHGKRIQMTEMTSVGDDFDRSMRLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND |
| Ga0208439_10253023 | 3300027278 | Estuarine | MSKMNEDFDRSMRLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND |
| Ga0208440_10772921 | 3300027281 | Estuarine | EDFDRSMRLKLVIEDMLKDIDMSSEEWNDRDKDGVAYWEKWNKND |
| Ga0208897_10898273 | 3300027571 | Estuarine | DRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNNND |
| Ga0209651_10869731 | 3300027581 | Freshwater Lake | MSEMNDGLDRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWNKND |
| Ga0209356_11304403 | 3300027644 | Freshwater Lake | MSEMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND |
| Ga0209033_10862211 | 3300027697 | Freshwater Lake | RLKLAIEEMLKDIDMSGEEWNDRDKDGVAYWEKWDKADDR |
| Ga0209617_100642744 | 3300027720 | Freshwater And Sediment | MTEMTSVGDDFDRSMRLKRVIEEMLKDIDMSGEEWNDRDKDGVAYWEKWHKADDR |
| Ga0208305_101018285 | 3300027753 | Estuarine | RLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNNND |
| Ga0209107_100027363 | 3300027797 | Freshwater And Sediment | MTEMTSLGDDFDRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGIPYWEKWHKADD |
| Ga0209107_100344011 | 3300027797 | Freshwater And Sediment | MSEMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVA |
| Ga0209358_100378831 | 3300027804 | Freshwater Lake | MRLKLAIEEMLKDIDMSGEEWNDRDKDGVAYWEKWDKADDR |
| Ga0209358_103190491 | 3300027804 | Freshwater Lake | VTNPDRDRSMRLKLAIEEMLKDIDMSGEEWNDRDKDDVAYWEKWDK |
| Ga0209550_107085201 | 3300027892 | Freshwater Lake | PDRSMRLKLVIEEMLKDIDMSGEEWNDRDKNGIPYWEKGGEA |
| Ga0315909_103457101 | 3300031857 | Freshwater | MTNPDRNRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGIPYWEKWHKADD |
| Ga0315909_105306661 | 3300031857 | Freshwater | KIVIEEMLKDIDMSGEEWNDRDKNGVAYWEKWDKNG |
| Ga0315904_110100802 | 3300031951 | Freshwater | MTNLDQNRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGIPYWEKWHKADDR |
| Ga0315906_105801133 | 3300032050 | Freshwater | MTNPDRNRSMRLKLVIEEMLKDIDMSGEEWNDRDKDGIPYWEKWHKADD |
| Ga0315903_111261653 | 3300032116 | Freshwater | MNDRDRSMRLKLAIEEMLKDIDMSGEEWNDYDKDGVPYWKKWHTNGRSESDSK |
| Ga0334977_0405110_1_165 | 3300033978 | Freshwater | MESLHGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEK |
| Ga0334982_0368663_448_573 | 3300033981 | Freshwater | MRLKLAIEDMLKDIDMSGEEWNDRDKNGIAYWEKYSEEETN |
| Ga0334992_0000229_46135_46278 | 3300033992 | Freshwater | MSDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND |
| Ga0334992_0032927_1743_1925 | 3300033992 | Freshwater | MESLHGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWDKND |
| Ga0334991_0067594_1_120 | 3300034013 | Freshwater | MSDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYW |
| Ga0334991_0168416_23_142 | 3300034013 | Freshwater | MRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWDKND |
| Ga0335002_0080771_207_389 | 3300034020 | Freshwater | MENLRGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND |
| Ga0334983_0581743_483_602 | 3300034060 | Freshwater | MRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND |
| Ga0334990_0002101_7940_8122 | 3300034068 | Freshwater | MESLHGKRIQMSKMNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNNND |
| Ga0335020_0435254_227_370 | 3300034082 | Freshwater | MNDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND |
| Ga0335012_0579556_1_117 | 3300034093 | Freshwater | MRLKLAIEDMLKDIDMSGEEWNDRDKNGIAYWEKYSEEE |
| Ga0335029_0041793_1400_1582 | 3300034102 | Freshwater | MESLHGKRIQMSKINDGLDRSMRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNKND |
| Ga0335016_0046610_3294_3407 | 3300034166 | Freshwater | KLVIEEMLKDIDMSGEEWNDRDKDGIPYWEKWHKADD |
| Ga0335061_0001160_13154_13273 | 3300034168 | Freshwater | MRLKLVIEDMLKDIDMSGEEWNDRDKDGVAYWEKWNNND |
| Ga0335065_0641396_131_250 | 3300034200 | Freshwater | MRLKLVIEEMLKDIDMSGEKWNDRDKNGIPYWEKERGDK |
| ⦗Top⦘ |