| Basic Information | |
|---|---|
| Family ID | F091930 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MSADELVLHKDYEDFASYLGVDYEDYVELVGDFELSEDEIEYALSI |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 71.70 % |
| % of genes near scaffold ends (potentially truncated) | 35.51 % |
| % of genes from short scaffolds (< 2000 bps) | 76.64 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.140 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (25.234 % of family members) |
| Environment Ontology (ENVO) | Unclassified (74.766 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (77.570 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.35% β-sheet: 0.00% Coil/Unstructured: 45.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13392 | HNH_3 | 7.48 |
| PF05315 | ICEA | 3.74 |
| PF04965 | GPW_gp25 | 1.87 |
| PF04851 | ResIII | 1.87 |
| PF16724 | T4-gp15_tss | 0.93 |
| PF00004 | AAA | 0.93 |
| PF02675 | AdoMet_dc | 0.93 |
| PF13469 | Sulfotransfer_3 | 0.93 |
| PF01844 | HNH | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.14 % |
| All Organisms | root | All Organisms | 44.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 25.23% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 22.43% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.95% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.48% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 6.54% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.74% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.74% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 3.74% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.87% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.93% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.93% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.93% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.93% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.93% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.93% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.93% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.93% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.93% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300003488 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN | Environmental | Open in IMG/M |
| 3300003616 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
| 3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007625 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 | Environmental | Open in IMG/M |
| 3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
| 3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022149 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300027547 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028044 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15m | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300028167 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_120m | Environmental | Open in IMG/M |
| 3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
| 3300028191 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_50m | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300029286 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25908J49247_100200378 | 3300003277 | Freshwater Lake | MSSNEFVLHKDYENFASYLRIDYEDYVELLSDFEFDEDEIEYALSI* |
| JGI25908J49247_100336103 | 3300003277 | Freshwater Lake | MSTDELVLHKDYEEFASSYLGVEYEDYVELMGDFELDEDEIEYALSI* |
| JGI25910J50241_100150592 | 3300003388 | Freshwater Lake | MSADELVLHKDYEEFASSYLGVEYEDYVELMGDFELDEDEYVLIK* |
| JGI25909J50240_10501024 | 3300003393 | Freshwater Lake | MSSNEFVLHKDYENFASYLRIDYEDXVELLSDFEFDEDEIEYALSI* |
| JGI25907J50239_100225111 | 3300003394 | Freshwater Lake | MSADELVLHKDYEEFASSYLGVEYEDYVELMGDFELDEDEYALSI* |
| JGI25911J50253_100589222 | 3300003411 | Freshwater Lake | MSTDELVLHKDYEEFASSYLGVEYEDYVELMGDFELDEDEYALSI* |
| JGI25912J50252_100087319 | 3300003412 | Freshwater Lake | MSXDXLVLHKDYEEFASSYLGVEYEDYVELMGDFELDEDEYALSI* |
| JGI25919J51413_10204132 | 3300003488 | Freshwater Lake | MSSNEFVLHKDYENFASYLRIDYEDYVELLSDFEFDEDEIEYAL |
| JGI25928J51866_11130871 | 3300003616 | Freshwater Lake | MSSNEFVLHKDYENFASYLRIDYEDYVELLSDFEFDEDEIEYALS |
| Ga0066223_11666504 | 3300004461 | Marine | MSVDELVRHDDYEFFASYLGVDYDDYVELVGDFELSDDEIEIEYALSI* |
| Ga0074648_100252824 | 3300005512 | Saline Water And Sediment | MSSNEMVLHDDYESFASYLGVDYDDYYEMINDLNLESEEIEIEYSLTI* |
| Ga0070374_105645851 | 3300005517 | Freshwater Lake | MSSNELMLHKDYEDFASYLHVEYEDYVELVGDFELDEDEYALSI* |
| Ga0049080_100626026 | 3300005582 | Freshwater Lentic | MSADELVLHKDYEDFASSYLGVEYEDYVELVGDFELYEDEIEYALSI* |
| Ga0049080_101182464 | 3300005582 | Freshwater Lentic | LHKDYEDFASSYLGVEYEDYVELVGDFELYEDEYALSI* |
| Ga0049085_100527671 | 3300005583 | Freshwater Lentic | DELVLHKDYEEFASSYLGVEYEDYVELMGDFELDEDEYVLIK* |
| Ga0049084_101965313 | 3300005585 | Freshwater Lentic | MSADELVLHKDYEDFASSYLGVEYEDYVELMGDFELYEDEYAL |
| Ga0074649_11114922 | 3300005613 | Saline Water And Sediment | MISKDELNLHDDYETFASYLGIDYDDYVELLGDFNTDLDEIEIEYSMSV* |
| Ga0079301_11830271 | 3300006639 | Deep Subsurface | MSADELVLHKDYEDFASSYLGVEYEDYVELMGDFELYEDEYALSI* |
| Ga0079302_10868141 | 3300007165 | Deep Subsurface | MSADELVLHKDYEDFASSYLGVEYEDYVELMGDFELYEDEIEYALSI* |
| Ga0103959_11695057 | 3300007214 | Freshwater Lake | MFEKEILRHDDYENFAKYLGVDYEDYVELLGEFYEEEDDVEIEYPVFA* |
| Ga0099851_100001311 | 3300007538 | Aqueous | MSVNEMVLHDDYESFASYLGVDYDDYYEMINDLNLESEEIEIEYSLTI* |
| Ga0099849_11037833 | 3300007539 | Aqueous | MSVNEMVLHDDYESFASYLGVDYEDYYEMINDLNLESEEIEIEYSLTI* |
| Ga0099849_13495561 | 3300007539 | Aqueous | DDYESFASYLGVDYEDYYEMINDLNLESEEIEIEYSLTI* |
| Ga0102863_12386033 | 3300007622 | Estuarine | SNEFVLHKDYENFASYLRIDYEDYVELLSDFEFDEDEIEYALSI* |
| Ga0102870_12387311 | 3300007625 | Estuarine | MSTDELVLHKDYEEFASSYLGVEYEDYVELMGDFELDEDEY |
| Ga0102869_11281932 | 3300007627 | Estuarine | MSADELVLHKDYEDFASYLHVEYEDYVELVGDFELDEDEYVLIK* |
| Ga0104242_10265424 | 3300008962 | Freshwater | FMRSQMSVDELVRHDDYEFFASYLGVDYDDYVELVGDFELSDDEIEIEYALSI* |
| Ga0102860_12124252 | 3300009056 | Estuarine | MSSNEFVLHKDYENFASYLRIDYEDYVELLSDFEFDEDEI |
| Ga0114962_100509044 | 3300009151 | Freshwater Lake | MSVDELVRHDDYEFFASYLGVDYDDYVELVGDFELSDDEIEIEYALSV* |
| Ga0114963_104940043 | 3300009154 | Freshwater Lake | FSAILVAYKFMRSQMSVDELVRHDDYEFFASYLGVDYDDYVELVGDFELSDDEIEIEYSLIA* |
| Ga0114963_106460462 | 3300009154 | Freshwater Lake | FSAILVAYKFMRSQMSVDELVRHDDYEFFASYLGVDYDDYVELIGDFELSEDEIEIEYSLIA* |
| Ga0114968_1000958627 | 3300009155 | Freshwater Lake | MSVDELVRHDDYEFFASYLGVDYDDYVELIGDFELSEDEIEIEYALSV* |
| Ga0114968_1007328510 | 3300009155 | Freshwater Lake | MSADELVLHKDYEDFASSYLGVEYEDYVELVGDFELYEDEIEIEYSLSV* |
| Ga0114977_103850603 | 3300009158 | Freshwater Lake | MSADELVLHKDYEDFASSYLGVEYEYYVELVGYYELYEDEYALSI* |
| Ga0114978_1005535710 | 3300009159 | Freshwater Lake | MSADELVLHKDYEDFASSYLGVEYEDYVELVGDYELYEDEYALSI* |
| Ga0114981_106689771 | 3300009160 | Freshwater Lake | YKFMRSQMSVDELVRHDDYEFFASYLGVDYDDYVELVGDFELSEDEIEIEYALSI* |
| Ga0114981_106723052 | 3300009160 | Freshwater Lake | FFASYLGVDYDDYVELVGDFELSDDEIEIEYSLIA* |
| Ga0114959_101431622 | 3300009182 | Freshwater Lake | MRSQMSVDELVRHDDYEFFASYLGVDYDDYVELVGDFELSDDEIEIEYALSI* |
| Ga0114974_102725143 | 3300009183 | Freshwater Lake | MSVDELVRHDDYEFFASYLGVDYDDYVELVGDFELSDDEIEIEYSLIA* |
| Ga0114958_101531016 | 3300009684 | Freshwater Lake | FSAILVAYKFMRSQMSVDELVRHDDYEFFASYLGVDYDDYVELVGDFELSDDEIEIEYALSV* |
| Ga0129342_12181742 | 3300010299 | Freshwater To Marine Saline Gradient | DDYESFASYLGVDYDDYYEMINDLNLESEEIEIEYSLTI* |
| Ga0136644_101381942 | 3300010334 | Freshwater Lake | MSVDELVRHDDYEFFASYLGVDYDDYVELVGDFELSEDEIEIEYSLIA* |
| Ga0139557_10248236 | 3300011010 | Freshwater | VLHKDYENFASYLRIDYEDYVELLSDFEFDEDEIEYALSI* |
| Ga0139556_10642362 | 3300011011 | Freshwater | MSTDELVLHKDYEEFASSYLGVEYEDYVELMGDFELDEDEYVLIK* |
| Ga0151515_1048943 | 3300011114 | Freshwater | MFVDEFVRHDDYEFFASYLGVDYEDYVELIGEFELSEEEIEIEYALSI* |
| Ga0151516_1037337 | 3300011116 | Freshwater | MSVDELVRHDDYEFFASYLGVDYDDYVELIGDFELSEEEIEIEYALSI* |
| Ga0153799_10006785 | 3300012012 | Freshwater | MIDDEMKSHDDYESFAKYLGVDYEDYAEMIGDFELCEDEIEIEYALSI* |
| Ga0177922_103404866 | 3300013372 | Freshwater | MSADELVLHKDYEDFASSYLGVEYEDYVELMGDFELDEDEYVLIK* |
| Ga0177922_110815925 | 3300013372 | Freshwater | MSSNEFVLHNDYENFASYLRIDYEDYVELLSDFEFDEDEIEYALSI* |
| Ga0119954_100003438 | 3300014819 | Freshwater | MSADELVLHKDYEDFASYLGVDYEDYVELVGDFELSEDEIEYALSI* |
| Ga0181364_10160244 | 3300017701 | Freshwater Lake | MSADELVLHKDYEDFASSYLGVEYEDYVELVGDFELDEDEYVLIK |
| Ga0181365_10788971 | 3300017736 | Freshwater Lake | MSTDELVLHKDYEEFASSYLGVEYEDYVELMGDFELDED |
| Ga0181357_11033234 | 3300017777 | Freshwater Lake | SADELVLHKDYEEFASSYLGVEYEDYVELMGDFELDEDEYALSI |
| Ga0181357_12127141 | 3300017777 | Freshwater Lake | MSADELVLHKDYEEFASSYLGVEYEDYVELMGDFELDEDEY |
| Ga0181349_11232614 | 3300017778 | Freshwater Lake | MSADELVLHKDYEEFASSYLGVEYEDYVELMGDFELDEDEIEYSLSI |
| Ga0181349_11378793 | 3300017778 | Freshwater Lake | MSSNELMLHKDYEDFASYLHVEYEDYVELMGDFELDEDEYALSI |
| Ga0181349_11774634 | 3300017778 | Freshwater Lake | SADELVLHKDYEEFASSYLGVEYEDYVELMGDFELDEDEIEYALSI |
| Ga0181349_13181262 | 3300017778 | Freshwater Lake | MSSNELMLHKDYEDFASYLHVEYEDYVELVGDFELDDDEY |
| Ga0181346_10309662 | 3300017780 | Freshwater Lake | MSTDELVLHKDYEEFASSYLGVEYEDYVELMGDFELDEDEYALSI |
| Ga0181346_11954713 | 3300017780 | Freshwater Lake | MSSNEFVLHKDYENFASYLRIDYEDYVELLSDFEFDEDQIEYALSI |
| Ga0181553_102444431 | 3300018416 | Salt Marsh | MSADELVLHKDYEDFASYLGVDYEDYVELVGDFELSEDEIEYALSI |
| Ga0181359_10529877 | 3300019784 | Freshwater Lake | MSSNEFVLHKDYENFASYLRIDYEDYVELLSDFEFDEDEIEYALSI |
| Ga0181359_10951071 | 3300019784 | Freshwater Lake | DYEEFASSYLGVEYEDYVELMGDFELDEDEYALSI |
| Ga0181359_12111671 | 3300019784 | Freshwater Lake | MSADELVLHKDYEEFASSYLGVEYEDYVELMGDFELDEDEIEYALSI |
| Ga0213860_100000779 | 3300021368 | Seawater | MSVNEMVLHDDYESFASYLGVDYDDYYEMINDLNLESEEIEIEYSLTI |
| Ga0222713_103007503 | 3300021962 | Estuarine Water | MSADELVLHKDYEEFASSYLGVEYEDYVELMGDFELDEDEYALSI |
| Ga0196907_1108932 | 3300022149 | Aqueous | MSVNEMVLHDDYESFASYLGVDYEDYYEMINDLNLESEEIEIEYSLTI |
| Ga0181354_11611322 | 3300022190 | Freshwater Lake | MSSNELMLHKDYEDFASYLHVEYEDYVELVGDFELDEDEYALSI |
| Ga0214917_100083284 | 3300022752 | Freshwater | MSADELVLHKDYEDFASSYLGVEYEDYVELVGDFELYEDEIEYALSI |
| Ga0214917_100940697 | 3300022752 | Freshwater | MSVDELVRHDDYEFFASYLGVDYDDYVELIGDFELSEEEIEIEYALSI |
| Ga0214917_103089871 | 3300022752 | Freshwater | MSADELVLHKDYEEFASYLGVDYEDYVELVGDFELSEDEIEYALSI |
| Ga0214921_102127782 | 3300023174 | Freshwater | MSVDELVRHDDYEFFASYLGVDYDDYVELVGDFELSEDEIEIEYALSI |
| Ga0214921_103983012 | 3300023174 | Freshwater | MSVDELVRHDDYEFFASYLGVDYDDYVELVGDFELSDDEIEIEYALSV |
| Ga0214921_104422673 | 3300023174 | Freshwater | DELVRHDDYEFFASYLGVDYDDYVELIGDFELSEEEIEIEYALSI |
| Ga0209864_10080916 | 3300027547 | Sand | MSADELVLHKDYEDFASSYLGVEYEDYVELVGDFELYEDEI |
| Ga0209552_11277013 | 3300027563 | Freshwater Lake | MSADELVLHKDYEEFASSYLGVEYEDYVELLSDFEFDEDEIEYALSI |
| Ga0208966_10373081 | 3300027586 | Freshwater Lentic | MSSNELMLHKDYEDFASYLHVEYEDYVELVGDFELDEDEIEYALSI |
| Ga0208974_10969722 | 3300027608 | Freshwater Lentic | MIDDEMKSHDDYESFAKYLGVDYEDYAEMIGDFELCEDEIEIEYALSI |
| Ga0208942_11519462 | 3300027627 | Freshwater Lentic | MSTDELVLHKDYEEFASSYLGVEYEDYVELMGDFELDEDEYVLIK |
| Ga0209188_11845733 | 3300027708 | Freshwater Lake | MSVDELVRHDDYEFFASYLGVDYDDYVELVGDFELSDDEIEIEYALSI |
| (restricted) Ga0247836_10623993 | 3300027728 | Freshwater | MIVDEMKSHDDYESFASYLGVEYEDYIELVGEFELGEDEIEYALSI |
| (restricted) Ga0247836_11361712 | 3300027728 | Freshwater | MTADDLKSHDDYESFASYLGVDYEDYIELVGEFEVGEDEVEYALTI |
| (restricted) Ga0247833_11038825 | 3300027730 | Freshwater | MSADEMKSHDDYESFAKYLGVDYEDYAEMIGDFELCENIIDVEYTLVNF |
| (restricted) Ga0247833_12534183 | 3300027730 | Freshwater | YKFNEVTMIVDEMKSHDDYESFASYLGVEYEDYIELVGEFELIELVGKFELGEDEIEGD |
| Ga0209442_12583361 | 3300027732 | Freshwater Lake | MSSNEFVLHKDYENFASYLRIDYEDYVELLSDFEFDE |
| Ga0209087_10695175 | 3300027734 | Freshwater Lake | MSADELVLHKDYEDFASSYLGVEYEDYVELVGDYELYEDEYALSI |
| Ga0209189_10655575 | 3300027747 | Freshwater Lake | MSVDELVRHDDYEFFASYLGVDYDDYVELVGDFELSEDEIEIEYSLIA |
| Ga0209189_13691661 | 3300027747 | Freshwater Lake | AILVAYKFMRSQMSVDELVRHDDYEFFASYLGVDYDDYVELVGDFELSDDEIEIEYALSI |
| Ga0209596_100034288 | 3300027754 | Freshwater Lake | MSVDELVRHDDYEFFASYLGVDYDDYVELIGDFELSEDEIEIEYALSV |
| Ga0209596_100292012 | 3300027754 | Freshwater Lake | MSADELVLHKDYEDFASSYLGVEYEDYVELVGDFELYEDEIEIEYSLSV |
| Ga0209088_100503813 | 3300027763 | Freshwater Lake | MSVDELVRHDDYEFFASYLGVDYDDYVELVGDFELSDDEIEIEYSLIA |
| Ga0209088_101300976 | 3300027763 | Freshwater Lake | SVDELVRHDDYEFFASYLGVDYDDYVELVGDFELSDDEIEIEYALSI |
| Ga0209246_101898942 | 3300027785 | Freshwater Lake | MSSNELMLHKDYEDFASYLHVEYEDYVELVGDFEFDEDEIEYALSI |
| (restricted) Ga0247837_12795293 | 3300027970 | Freshwater | YKFNEVTMIVDEMKSHDDYESFASYLGVEYEDYIELVGEFELGEDEIEYALSI |
| Ga0209298_102784863 | 3300027973 | Freshwater Lake | LFSAILVAYKFMRSQMSVDELVRHDDYEFFASYLGVDYDDYVELVGDFELSEDEIEIEYALSI |
| Ga0209299_10987825 | 3300027974 | Freshwater Lake | SVDELVRHDDYEFFASYLGVDYDDYVELVGDFELSDDEIEIEYSLIA |
| (restricted) Ga0247838_102677014 | 3300028044 | Freshwater | MIVDEMKSHDDYESFASYLGVEYEDYIELVGEFELIELVGKFELGEDEIEGD |
| (restricted) Ga0247838_11698661 | 3300028044 | Freshwater | DYESFASYLGVEYEDYIELVGEFELGEDEIEYALSI |
| (restricted) Ga0247835_11353695 | 3300028114 | Freshwater | EMKSHDDYESFAKYLGVDYEDYAEMIGDFELCENIIDVEYTLVNF |
| Ga0268285_10441212 | 3300028167 | Saline Water | MSSNEFVLHKDYENFASYLRIDYEDYVELLSDFELDEDEYALSI |
| Ga0265593_10678323 | 3300028178 | Saline Water | MSTDELVLHKDYEEFASSYLGVEYEDYVELMGDFELYEDEYALSI |
| Ga0265595_10565296 | 3300028191 | Saline Water | MSSNELMLHKDYEDFASYLHVEYEDYVELVGDFELDED |
| Ga0265595_10705274 | 3300028191 | Saline Water | MSADELVLHKDYEDFASSYLGVEYEDYVELMGDFELYEDEYALSI |
| Ga0304730_100559527 | 3300028394 | Freshwater Lake | MRSQMSVDELVRHDDYEFFASYLGVDYDDYVELIGDFELSEDEIEIEYALSV |
| (restricted) Ga0247844_10947404 | 3300028571 | Freshwater | MIVDEMKSHDDYESFAKYLGVDYEDYAEMIGDFELCENIIDVEYTLVNF |
| (restricted) Ga0247841_105211333 | 3300029286 | Freshwater | TMIVDEMKSHDDYESFASYLGVEYEDYIELVGEFELGEDEIEYALSI |
| Ga0315293_112003271 | 3300031746 | Sediment | MSADELVLHKDYEEFASSYLGVEYEDYVELMGDFELYEDEIEYALSI |
| ⦗Top⦘ |