| Basic Information | |
|---|---|
| Family ID | F091812 |
| Family Type | Metagenome |
| Number of Sequences | 107 |
| Average Sequence Length | 43 residues |
| Representative Sequence | APAPETQKEPGLGPRPLSPEDPIFHRALDLLKTPAKKAA |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 16.82 % |
| % of genes from short scaffolds (< 2000 bps) | 15.89 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (83.178 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (41.121 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.187 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.860 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.42% β-sheet: 0.00% Coil/Unstructured: 83.58% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF04748 | Polysacc_deac_2 | 52.34 |
| PF02517 | Rce1-like | 4.67 |
| PF00701 | DHDPS | 0.93 |
| PF16491 | Peptidase_M48_N | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG2861 | Uncharacterized conserved protein YibQ, putative polysaccharide deacetylase 2 family | Carbohydrate transport and metabolism [G] | 52.34 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 4.67 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 4.67 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.87 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 83.18 % |
| All Organisms | root | All Organisms | 16.82 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300009038|Ga0099829_10151039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1854 | Open in IMG/M |
| 3300009143|Ga0099792_10590102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300010320|Ga0134109_10354756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300010322|Ga0134084_10252977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300012096|Ga0137389_10904453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300012096|Ga0137389_11360545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300012200|Ga0137382_10730050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300012203|Ga0137399_10578194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
| 3300012206|Ga0137380_11590217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300012206|Ga0137380_11607826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300012362|Ga0137361_11126057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300012363|Ga0137390_11843307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300012582|Ga0137358_10092501 | All Organisms → cellular organisms → Bacteria | 2045 | Open in IMG/M |
| 3300018433|Ga0066667_10970944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300020580|Ga0210403_10353204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1203 | Open in IMG/M |
| 3300027562|Ga0209735_1100598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300027875|Ga0209283_10909616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300031720|Ga0307469_11834678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 41.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.35% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.54% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.87% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.87% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.93% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.93% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.93% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_100649924 | 3300001593 | Forest Soil | SSTAKEAPAGPRPLSPEDPIFHKALDLLKTPAKKAA* |
| JGI12635J15846_104642262 | 3300001593 | Forest Soil | AAAAEEVDTGDEDVAAPETQKEPLAGPRPLSPEDPVYHKALELLKSPAKKAA* |
| JGIcombinedJ26739_1007023582 | 3300002245 | Forest Soil | ATNTAKEAPAGPRPLSPEDPIFRKALELLKTPAKKAA* |
| JGI25616J43925_100351081 | 3300002917 | Grasslands Soil | SDTPDEEAAPAPQTQKEPGLGPRPLSPEDPIFHRALDLLKATVKKAA* |
| Ga0066673_100692403 | 3300005175 | Soil | EDTAPASVPEKGAAPAPQTQKEPGLGPRPLSPEDPIFHRALDLLKEPVKKAA* |
| Ga0070694_1014583081 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | DVDDDGGKNTPAKVTPSGPRPLSPEDPIFRKALELLKNSAKKAA* |
| Ga0070731_105080292 | 3300005538 | Surface Soil | PTDNSKEPGLGPRPLSPEDPIYHKALYMLKSPAKKAA* |
| Ga0070733_100178656 | 3300005541 | Surface Soil | TKKEPLAGPRPLSPEDPVYRKALELLKTPAKKAA* |
| Ga0066700_108051011 | 3300005559 | Soil | DSDTTEEEAAPPPETQKEPGLGPRPLSPEDPIFHRALDLLKAPVKKAA* |
| Ga0066699_103992762 | 3300005561 | Soil | EAAPPPETQKEPGLGPRPLSPEDPIFHRALDLLKAPVKKAA* |
| Ga0066705_103337491 | 3300005569 | Soil | KGAAPAPQTQKEPGLGPRPLSPEDPIFHRALDLLKAPVKKAA* |
| Ga0066706_102130901 | 3300005598 | Soil | APAPQTQKEPGLGPRPLSPEDPIFHRALDLLKAAVKKAA* |
| Ga0080026_102879111 | 3300005952 | Permafrost Soil | ANSTNKSKVAPTGPRPLSPEDPIFRKALELLKAPPAKKAA* |
| Ga0075029_1010676272 | 3300006052 | Watersheds | AQKEPQAGPRPLSPEDPVYRKALELLKTPAKKAA* |
| Ga0079222_111974161 | 3300006755 | Agricultural Soil | PPETQKEPGLGPRPLSPEDPIFHRALDLLKAPVKKAA* |
| Ga0066659_105357032 | 3300006797 | Soil | EEEAAPAPQTQKEPGLGPRPLSPEDPIFHRALDLLKALAKKAA* |
| Ga0079219_123607521 | 3300006954 | Agricultural Soil | TPEAQKEPGLGPRPLSPEDAIFHRALDLLKTPAKKAA* |
| Ga0099791_101195092 | 3300007255 | Vadose Zone Soil | APAPETQKEPGLGPRPLSPEDPIFHRALDLLKTPAKKAA* |
| Ga0099791_105838352 | 3300007255 | Vadose Zone Soil | SDSTDEEAAPAPETRKEPGLGPRPLSPEDPIFHRALDLLKTPAKKAA* |
| Ga0099791_106644251 | 3300007255 | Vadose Zone Soil | PQKEPGLGPRPLSPEDPIFHRALDLLKTPAKKAA* |
| Ga0066710_1026644341 | 3300009012 | Grasslands Soil | ASVPEKGAAPAPQTQKEPGLGPRPLSPEDPIFHRALDLLKEPVKKAA |
| Ga0099829_101510393 | 3300009038 | Vadose Zone Soil | DDNNSGGSKETLSGPRPLSPEDPVFHKAVDLLKAPAKKAA* |
| Ga0099830_101388601 | 3300009088 | Vadose Zone Soil | APETQKEPGLGPRPLSPEDPIFHRALDLLRAPAKKAA* |
| Ga0099830_102651841 | 3300009088 | Vadose Zone Soil | EDDSDTPDEEAAPPPQTQKEPGLGPRPLSPEDPIFHRALDLLKAPAKKAA* |
| Ga0099830_105493572 | 3300009088 | Vadose Zone Soil | GDEDTAPAPETQKEPGLGPRPLSPEDPIFHRALDLLRAPAKKAA* |
| Ga0066709_1006251831 | 3300009137 | Grasslands Soil | EEDTAPASVPEKGAAPAPQTQKEPGLGPRPLSPEDPIFHRALDLLKAPVKKAA* |
| Ga0066709_1011179122 | 3300009137 | Grasslands Soil | EEDTAPASVPEKGAAPAPQTQKEPGLGPRPLSPEDPIFHRALDLLKEPVKKAA* |
| Ga0066709_1018252472 | 3300009137 | Grasslands Soil | TSGTPKESPSGPRPLSPEDPIFRKALDLLKTPAKKAA* |
| Ga0099792_105901021 | 3300009143 | Vadose Zone Soil | ETTDEEAAPPAPETQKEPELGPRPLSPEDPIFHRALDLLRATAKKAA* |
| Ga0134082_104292422 | 3300010303 | Grasslands Soil | PAPEARKEPGQGPRPLSPEDPIFHRALDLLKTPAKKAA* |
| Ga0134109_103547561 | 3300010320 | Grasslands Soil | EESDAADEEAAPTPQTQKEPGLGPRPLSPEDSIFHRALDLLKVPAKKAA* |
| Ga0134084_102529771 | 3300010322 | Grasslands Soil | EAAPTPQTQKEPGLGPRPLSPEDSIFHRALDLLKVPAKKAA* |
| Ga0137392_107802811 | 3300011269 | Vadose Zone Soil | DSSASAKEAPSGPRPLSPEDPVFHKALDLLKAPAKKAA* |
| Ga0137389_103515021 | 3300012096 | Vadose Zone Soil | DSGDDDAAPAPEPQKEPGLGPRPLSPEDPIFHRALDLLKTPAKKAA* |
| Ga0137389_104258941 | 3300012096 | Vadose Zone Soil | PQAQKEPGLGPRPLSPEDPIFHRALDLLKTPAKKAA* |
| Ga0137389_106176662 | 3300012096 | Vadose Zone Soil | DDSETTDEEAAPPAPETQKEPGLGPRPLSPEDPIFHRALDLLRATAKKAA* |
| Ga0137389_109044531 | 3300012096 | Vadose Zone Soil | DDSDTPDEEAAPPPQTQKEPGLGPRPLSPEDPIFHRALDLLKAPAKKAA* |
| Ga0137389_113605451 | 3300012096 | Vadose Zone Soil | QTQKEPGLGPRPLSPEDPIFHRALDLLKAPAPAKKAA* |
| Ga0137388_113105612 | 3300012189 | Vadose Zone Soil | DDDAAPAPEPQKEPGLGPRPLSPEDPIFHRALDLLKTPAKKAA* |
| Ga0137383_105681271 | 3300012199 | Vadose Zone Soil | ETQKGPGLGPRPLSPEDPIFHRALDLLKAPMKKAA* |
| Ga0137382_107300501 | 3300012200 | Vadose Zone Soil | TQKEPGLGPRPLSPEDAIFHRALDLLKVPAKKAA* |
| Ga0137399_100611684 | 3300012203 | Vadose Zone Soil | PDDSDSGDDDAAPVPETQKEPGLGPRPLSPEDPIFHRALDRLRTPAKKAA* |
| Ga0137399_105781941 | 3300012203 | Vadose Zone Soil | PEDDSDSTDEDAAPAPETQKEPGLGPRPLSPEDPIFHRALDLLKAPVKKAA* |
| Ga0137362_103354461 | 3300012205 | Vadose Zone Soil | TDEEAAPPAPETQKEPGLGPRPLSPEDPIFHRALDLLRATAKKAA* |
| Ga0137380_115902171 | 3300012206 | Vadose Zone Soil | EEVAPAPETQKGPGLGPRPLSPEDPIFHRALDLLKAPMKKAA* |
| Ga0137380_116078261 | 3300012206 | Vadose Zone Soil | TQKGPGLGPRPLSPEDPIFHRALDLLKAPMKKAA* |
| Ga0137370_102133271 | 3300012285 | Vadose Zone Soil | EAAPTPQTQKEPGLGPRPLSPEDAIFHRALDLLKVPAKKAA* |
| Ga0137361_111260571 | 3300012362 | Vadose Zone Soil | APAPQTQKEPGLGPRPLSPEDPIFHRALDLLKSPVKKAA* |
| Ga0137390_101320851 | 3300012363 | Vadose Zone Soil | QAPESQKEPGLGPRPLSPEDPIFHRALDLLKAPAKKAA* |
| Ga0137390_107634181 | 3300012363 | Vadose Zone Soil | ETQKEPGLGPRPLSPEDPIFHRALDLLKTPAKKAA* |
| Ga0137390_110876832 | 3300012363 | Vadose Zone Soil | TDEEAAPAPETRKEPGLGPRPLSPEDPIFHRALDLLRTPAKKAA* |
| Ga0137390_118433071 | 3300012363 | Vadose Zone Soil | PDEEAAPPPQTQKEPGLGPRPLSPEDPIFHRALDLLKAPAKKAA* |
| Ga0137358_100925013 | 3300012582 | Vadose Zone Soil | AVPEDSDSGDDDAAPAPEPQKEPGLGPRPLSPEDPIFHRALDLLKTPAKKAA* |
| Ga0137358_110952151 | 3300012582 | Vadose Zone Soil | SDSGDDDAAPPPETQKEPGLGPRPLSPEDPIFHRALDLMRTPAKKAA* |
| Ga0137394_111655651 | 3300012922 | Vadose Zone Soil | LPEDSDSGDDDAAPVPEAQKEPGLGPRPLSPEDPIFHRALDLLKTPVKKAA* |
| Ga0137419_100065201 | 3300012925 | Vadose Zone Soil | TQKEPGLGPRPLSPEDPIFHRALDLLKAPVKKAA* |
| Ga0137419_112662661 | 3300012925 | Vadose Zone Soil | PDTADEAVAPTPEKQKEPGLGPRPLSPEDPIFHRALDLLKLPAKKAA* |
| Ga0137407_112138421 | 3300012930 | Vadose Zone Soil | PETQKEPGLGPRPLSPEDPIFHRALDLLKTPVKKAA* |
| Ga0137407_119666102 | 3300012930 | Vadose Zone Soil | DDAAPAPEPQKEPGLGPRPLSPEDPIFRRALDLLKTPAKKAA* |
| Ga0157379_119448491 | 3300014968 | Switchgrass Rhizosphere | KNTPAKVTPSGPRPLSPEDPIFRKALELLKNSAKKAA* |
| Ga0137418_104535042 | 3300015241 | Vadose Zone Soil | TVTQEPSKDPGLGPRPLSPEDPIYHKAIELLKTPAKKAA* |
| Ga0137418_108925271 | 3300015241 | Vadose Zone Soil | KEPGLGPRPLSPEDPIFHRALDLLKAPAAAKKAA* |
| Ga0187802_100826681 | 3300017822 | Freshwater Sediment | TQQHEPGLGPRPLSPEDPIYRRALELLKTPAKKAA |
| Ga0187818_100240464 | 3300017823 | Freshwater Sediment | APPDTETQQHEPGLGPRPLSPEDPIYRRALELLKTPAKKAA |
| Ga0187780_108816362 | 3300017973 | Tropical Peatland | EDVAPTPESQKEPGLGPRPLSPEDPIFHRALDLLKSPAKKAA |
| Ga0187804_100109924 | 3300018006 | Freshwater Sediment | GDEDAAPPDTETQQHEPGLGPRPLSPEDPIYRRALELLKTPAKKAA |
| Ga0066667_101772891 | 3300018433 | Grasslands Soil | EEDTAPASVPEKGAAPAPQTQKEPGLGPRPLSPEDPIFHRALDLLKAPVKKAA |
| Ga0066667_109709441 | 3300018433 | Grasslands Soil | EEDTAPASVPEKGAAPAPQTQKEPGLGPRPLSPEDPIFHRALDLLKEPVKKAA |
| Ga0066662_100381994 | 3300018468 | Grasslands Soil | SDTTEEDAAPPPEVQKEPGLGPRPLSPEDPIFHRALDLLKAPVKKAA |
| Ga0193755_11077742 | 3300020004 | Soil | DSGDDDGAPAPEPQKEPGLGPRPLSPEDPIFHRALDLLKTPAKKAA |
| Ga0179594_101025142 | 3300020170 | Vadose Zone Soil | SDSGDDDAAPAPEPQKEPGLGPRPLSPEDPIFRRALDLLKTPAKKAA |
| Ga0179594_101462472 | 3300020170 | Vadose Zone Soil | PEDSDSGDDDAAPAPETQKEPGLGPRPLSPEDPIFHRALDLLKTPAKKAA |
| Ga0179592_104669581 | 3300020199 | Vadose Zone Soil | DEEAAPAPETQKEPGLGPRPLSPEDPIFHRALDLLKAPVKKAA |
| Ga0210407_106681481 | 3300020579 | Soil | ATAPATKKEPLAGPRPLSPEDPVYRKALELLKTPAKKAA |
| Ga0210403_103532042 | 3300020580 | Soil | RAVAQDESDTGDDESAAASNTEREPSLGPRPLSPEDPIYHKALELLKTPAKKAA |
| Ga0210399_103494352 | 3300020581 | Soil | DDSSGASKETVSGPRPLSPEDPVFHKAVDLLKAPAKKAA |
| Ga0210399_111872212 | 3300020581 | Soil | GDDESAAASNTEREPSLGPRPLSPEDPIYHKALELLKTPAKKAA |
| Ga0210405_111707512 | 3300021171 | Soil | ESDTTEEEAAPAPETQKEPGLGPRPLSPEDPIFHRALDLLKAPPVKKAA |
| Ga0210408_113566781 | 3300021178 | Soil | EDVAAPDTQKEPLAGPRPLSPEDPVYRKALELLKTPAKKAA |
| Ga0210386_101555623 | 3300021406 | Soil | ATDSSKAEPSGPRPLSPEDPIYRKALELLKAPAKKAA |
| Ga0207700_114648652 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ATNKETPSGPRPLSPEDPVFHKALDLLRTPAKKAA |
| Ga0209155_11593071 | 3300026316 | Soil | ETQKEPGLGPRPLSPEDPIFHRALDLLKAPVKKAA |
| Ga0209473_11411183 | 3300026330 | Soil | TQREPGLGPRPLSPEDPIYHRALDLLKAAAPAKKAA |
| Ga0209807_11353222 | 3300026530 | Soil | KGAAPAPQTQKEPGLGPRPLSPEDPIFHRALDLLKAPVKKAA |
| Ga0209805_11685401 | 3300026542 | Soil | EAAPPPETQKEPGLGPRPLSPEDPIFHRALDLLKAPVKKAA |
| Ga0209161_100874631 | 3300026548 | Soil | VPEKGAAPAPQTQKEPGLGPRPLSPEDPIFHRALDLLKEPVKKAA |
| Ga0209577_106141441 | 3300026552 | Soil | PASVPEKGAAPAPQTQKEPGLGPRPLSPEDPIFHRALDLLKAPVKKAA |
| Ga0209734_11188911 | 3300027535 | Forest Soil | NTPSKVEPSGPRPLSPEDPIYRKALELLKNPTKKAA |
| Ga0209735_11005981 | 3300027562 | Forest Soil | SDTSDEEAAPAPQTQKEPGLGPRPLSPEDPIFHRALDLLKTPAKKAA |
| Ga0209220_10255523 | 3300027587 | Forest Soil | PPAAPQTQKEPGLGPRPLSPEDPIFHRALDLLKAPAKKAA |
| Ga0209217_11975301 | 3300027651 | Forest Soil | GSSAGANKETPSGPRPLSPEDPVYHKALDLLKAPAKKAA |
| Ga0208981_10887012 | 3300027669 | Forest Soil | APVPETQKEPGLGPRPLSPEDPIFHRALDLLRTPAKKAA |
| Ga0209073_105092571 | 3300027765 | Agricultural Soil | DDDAAPPPETQKEPGLGPRPLSPEDPIFHRALDLLRTPAKKAA |
| Ga0209074_100199331 | 3300027787 | Agricultural Soil | RAAPTEPGLGPRPLSPEDPIFHRALDLLKAPAPAKKAA |
| Ga0209701_102033082 | 3300027862 | Vadose Zone Soil | APAPQTQKEPGLGPRPLSPEDPIFHRALDLLKAPAKKAA |
| Ga0209283_109096162 | 3300027875 | Vadose Zone Soil | VPEDDSDSTDEDAAPAPETQKEPGLGPRPLSPEDPIFHRALDLLKAPVKKAA |
| Ga0209488_105490741 | 3300027903 | Vadose Zone Soil | ETTDEEAAPPAPETQKEPELGPRPLSPEDPIFHRALDLLRATAKKAA |
| Ga0137415_102184273 | 3300028536 | Vadose Zone Soil | ADEGDTGDEYATAPETQKEPSAGPRPLSPEDPIFRKALELLKTPAKKAA |
| Ga0302234_102336091 | 3300028773 | Palsa | SAGAKETPGPRPLSPDDAVYRKALELLKTPAKKAA |
| Ga0170820_151569841 | 3300031446 | Forest Soil | DGGDDGTVTQEPSKDPGLGPRPLSPEDPIYHKAIELLKTPAKKAA |
| Ga0310686_1102809474 | 3300031708 | Soil | SADAQKEPSLPRPLSPEDPIYRKALELLKAPQKKAA |
| Ga0307469_107765351 | 3300031720 | Hardwood Forest Soil | PAPEPQKEPGLGPRPLSPEDPIFHRALDLLKAPVKKAA |
| Ga0307469_118346782 | 3300031720 | Hardwood Forest Soil | RAVPDDADSGEDDAAPAPEPQKEPGLGPRPLSPEDPIFHRALDLLKTPAKKAA |
| Ga0307477_100862153 | 3300031753 | Hardwood Forest Soil | PEDDSDVADDDAAPAPQTQKEPGLGPRPLSPEDPIFHRALDLLKTPVKKAA |
| Ga0307471_1010207111 | 3300032180 | Hardwood Forest Soil | DDSDATDEEAAPAPETRKEPGLGPRPLSPEDPIFHRALDLLKTPAKKAA |
| Ga0307471_1026760922 | 3300032180 | Hardwood Forest Soil | PEPQKEPGLGPRPLSPEDPIFHRALDLLKTPAKKAA |
| Ga0307472_1008116421 | 3300032205 | Hardwood Forest Soil | PGGSKETPSGPRPLSPEDPVFHKAVDLLKAPAKKAA |
| ⦗Top⦘ |